ACT1/YFL039C S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YFL039C_S288C   1   MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   50
YFL039C_AWRI1631   1   MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   50
YFL039C_AWRI796   1   MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   50
YFL039C_BC187   1   ---------------MCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   35
YFL039C_BY4741   1   ---------------MCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   35
YFL039C_BY4742   1   ---------------MCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   35
YFL039C_CBS7960   1   MDFEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   50
YFL039C_CEN.PK   1   ---------------MCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   35
YFL039C_D273-10B   1   ---------------MCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   35
YFL039C_DBVPG6044   1   ---------------MCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   35
YFL039C_EC1118   1   MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   50
YFL039C_EC9-8   1   MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   50
YFL039C_FL100   1   ---------------MCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   35
YFL039C_FY1679   1   ---------------MCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   35
YFL039C_FostersB   1   MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   50
YFL039C_FostersO   1   MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   50
YFL039C_JAY291   1   MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   50
YFL039C_JK9-3d   1   ---------------MCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   35
YFL039C_K11   1   ---------------MCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   35
YFL039C_Kyokai7   1   MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   50
YFL039C_L1528   1   ---------------MCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   35
YFL039C_LalvinQA23   1   MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   50
YFL039C_PW5   1   MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   50
YFL039C_RM11-1a   1   ---------------MCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   35
YFL039C_RedStar   1   ---------------MCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   35
YFL039C_SEY6210   1   ---------------MCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   35
YFL039C_SK1   1   ---------------MCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   35
YFL039C_T7   1   MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   50
YFL039C_T73   1   MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   50
YFL039C_UC5   1   MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   50
YFL039C_UWOPS05_217_3   1   ---------------MCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   35
YFL039C_VL3   1   MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   50
YFL039C_W303   1   ---------------MCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   35
YFL039C_X2180-1A   1   ---------------MCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   35
YFL039C_Y55   1   ---------------MCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   35
YFL039C_YJM339   1   ---------------MCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   35
YFL039C_YJM789   1   MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   50
YFL039C_YPH499   1   ---------------MCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   35
YFL039C_YPS128   1   ---------------MCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   35
YFL039C_YPS163   1   ---------------MCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   35
YFL039C_YS9   1   ---------------MCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   35
YFL039C_ZTW1   1   MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQK   50
         

YFL039C_S288C   51   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   100
YFL039C_AWRI1631   51   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   100
YFL039C_AWRI796   51   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   100
YFL039C_BC187   36   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   85
YFL039C_BY4741   36   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   85
YFL039C_BY4742   36   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   85
YFL039C_CBS7960   51   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   100
YFL039C_CEN.PK   36   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   85
YFL039C_D273-10B   36   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   85
YFL039C_DBVPG6044   36   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   85
YFL039C_EC1118   51   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   100
YFL039C_EC9-8   51   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   100
YFL039C_FL100   36   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   85
YFL039C_FY1679   36   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   85
YFL039C_FostersB   51   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   100
YFL039C_FostersO   51   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   100
YFL039C_JAY291   51   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   100
YFL039C_JK9-3d   36   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   85
YFL039C_K11   36   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   85
YFL039C_Kyokai7   51   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   100
YFL039C_L1528   36   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   85
YFL039C_LalvinQA23   51   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   100
YFL039C_PW5   51   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   100
YFL039C_RM11-1a   36   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   85
YFL039C_RedStar   36   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   85
YFL039C_SEY6210   36   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   85
YFL039C_SK1   36   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   85
YFL039C_T7   51   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   100
YFL039C_T73   51   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   100
YFL039C_UC5   51   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   100
YFL039C_UWOPS05_217_3   36   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   85
YFL039C_VL3   51   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   100
YFL039C_W303   36   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   85
YFL039C_X2180-1A   36   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   85
YFL039C_Y55   36   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   85
YFL039C_YJM339   36   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   85
YFL039C_YJM789   51   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   100
YFL039C_YPH499   36   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   85
YFL039C_YPS128   36   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   85
YFL039C_YPS163   36   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   85
YFL039C_YS9   36   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   85
YFL039C_ZTW1   51   DSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE   100
         

YFL039C_S288C   101   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   150
YFL039C_AWRI1631   101   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   150
YFL039C_AWRI796   101   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   150
YFL039C_BC187   86   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   135
YFL039C_BY4741   86   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   135
YFL039C_BY4742   86   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   135
YFL039C_CBS7960   101   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   150
YFL039C_CEN.PK   86   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   135
YFL039C_D273-10B   86   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   135
YFL039C_DBVPG6044   86   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   135
YFL039C_EC1118   101   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   150
YFL039C_EC9-8   101   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   150
YFL039C_FL100   86   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   135
YFL039C_FY1679   86   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   135
YFL039C_FostersB   101   HPVLLTEAPMNPKSNREKMTQIMFETXNVPAFYVSIQAVLSLYSSGRTTG   150
YFL039C_FostersO   101   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   150
YFL039C_JAY291   101   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   150
YFL039C_JK9-3d   86   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   135
YFL039C_K11   86   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   135
YFL039C_Kyokai7   101   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   150
YFL039C_L1528   86   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   135
YFL039C_LalvinQA23   101   HPVLLTEAPMNPKSNREKMTQIMXETFNVPAFYVSIQAVLSLYSSGRTTG   150
YFL039C_PW5   101   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   150
YFL039C_RM11-1a   86   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   135
YFL039C_RedStar   86   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   135
YFL039C_SEY6210   86   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   135
YFL039C_SK1   86   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   135
YFL039C_T7   101   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   150
YFL039C_T73   101   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   150
YFL039C_UC5   101   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   150
YFL039C_UWOPS05_217_3   86   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   135
YFL039C_VL3   101   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   150
YFL039C_W303   86   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   135
YFL039C_X2180-1A   86   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   135
YFL039C_Y55   86   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   135
YFL039C_YJM339   86   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   135
YFL039C_YJM789   101   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   150
YFL039C_YPH499   86   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   135
YFL039C_YPS128   86   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   135
YFL039C_YPS163   86   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   135
YFL039C_YS9   86   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   135
YFL039C_ZTW1   101   HPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTG   150
         

YFL039C_S288C   151   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   200
YFL039C_AWRI1631   151   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   200
YFL039C_AWRI796   151   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   200
YFL039C_BC187   136   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   185
YFL039C_BY4741   136   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   185
YFL039C_BY4742   136   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   185
YFL039C_CBS7960   151   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   200
YFL039C_CEN.PK   136   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   185
YFL039C_D273-10B   136   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   185
YFL039C_DBVPG6044   136   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   185
YFL039C_EC1118   151   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   200
YFL039C_EC9-8   151   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   200
YFL039C_FL100   136   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   185
YFL039C_FY1679   136   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   185
YFL039C_FostersB   151   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   200
YFL039C_FostersO   151   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   200
YFL039C_JAY291   151   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   200
YFL039C_JK9-3d   136   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   185
YFL039C_K11   136   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   185
YFL039C_Kyokai7   151   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   200
YFL039C_L1528   136   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   185
YFL039C_LalvinQA23   151   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   200
YFL039C_PW5   151   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   200
YFL039C_RM11-1a   136   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   185
YFL039C_RedStar   136   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   185
YFL039C_SEY6210   136   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   185
YFL039C_SK1   136   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   185
YFL039C_T7   151   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   200
YFL039C_T73   151   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   200
YFL039C_UC5   151   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   200
YFL039C_UWOPS05_217_3   136   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   185
YFL039C_VL3   151   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   200
YFL039C_W303   136   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   185
YFL039C_X2180-1A   136   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   185
YFL039C_Y55   136   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   185
YFL039C_YJM339   136   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   185
YFL039C_YJM789   151   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   200
YFL039C_YPH499   136   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   185
YFL039C_YPS128   136   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   185
YFL039C_YPS163   136   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   185
YFL039C_YS9   136   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   185
YFL039C_ZTW1   151   IVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSF   200
         

YFL039C_S288C   201   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   250
YFL039C_AWRI1631   201   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   250
YFL039C_AWRI796   201   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   250
YFL039C_BC187   186   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   235
YFL039C_BY4741   186   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   235
YFL039C_BY4742   186   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   235
YFL039C_CBS7960   201   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   250
YFL039C_CEN.PK   186   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   235
YFL039C_D273-10B   186   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   235
YFL039C_DBVPG6044   186   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   235
YFL039C_EC1118   201   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   250
YFL039C_EC9-8   201   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   250
YFL039C_FL100   186   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   235
YFL039C_FY1679   186   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   235
YFL039C_FostersB   201   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   250
YFL039C_FostersO   201   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   250
YFL039C_JAY291   201   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   250
YFL039C_JK9-3d   186   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   235
YFL039C_K11   186   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   235
YFL039C_Kyokai7   201   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   250
YFL039C_L1528   186   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   235
YFL039C_LalvinQA23   201   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   250
YFL039C_PW5   201   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   250
YFL039C_RM11-1a   186   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   235
YFL039C_RedStar   186   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   235
YFL039C_SEY6210   186   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   235
YFL039C_SK1   186   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   235
YFL039C_T7   201   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   250
YFL039C_T73   201   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   250
YFL039C_UC5   201   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   250
YFL039C_UWOPS05_217_3   186   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   235
YFL039C_VL3   201   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   250
YFL039C_W303   186   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   235
YFL039C_X2180-1A   186   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   235
YFL039C_Y55   186   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   235
YFL039C_YJM339   186   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   235
YFL039C_YJM789   201   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   250
YFL039C_YPH499   186   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   235
YFL039C_YPS128   186   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   235
YFL039C_YPS163   186   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   235
YFL039C_YS9   186   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   235
YFL039C_ZTW1   201   STTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITI   250
         

YFL039C_S288C   251   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   300
YFL039C_AWRI1631   251   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   300
YFL039C_AWRI796   251   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   300
YFL039C_BC187   236   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   285
YFL039C_BY4741   236   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   285
YFL039C_BY4742   236   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   285
YFL039C_CBS7960   251   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   300
YFL039C_CEN.PK   236   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   285
YFL039C_D273-10B   236   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   285
YFL039C_DBVPG6044   236   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   285
YFL039C_EC1118   251   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   300
YFL039C_EC9-8   251   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   300
YFL039C_FL100   236   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   285
YFL039C_FY1679   236   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   285
YFL039C_FostersB   251   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   300
YFL039C_FostersO   251   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   300
YFL039C_JAY291   251   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   300
YFL039C_JK9-3d   236   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   285
YFL039C_K11   236   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   285
YFL039C_Kyokai7   251   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   300
YFL039C_L1528   236   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   285
YFL039C_LalvinQA23   251   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   300
YFL039C_PW5   251   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   300
YFL039C_RM11-1a   236   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   285
YFL039C_RedStar   236   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   285
YFL039C_SEY6210   236   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   285
YFL039C_SK1   236   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   285
YFL039C_T7   251   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   300
YFL039C_T73   251   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   300
YFL039C_UC5   251   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   300
YFL039C_UWOPS05_217_3   236   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   285
YFL039C_VL3   251   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   300
YFL039C_W303   236   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   285
YFL039C_X2180-1A   236   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   285
YFL039C_Y55   236   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   285
YFL039C_YJM339   236   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   285
YFL039C_YJM789   251   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   300
YFL039C_YPH499   236   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   285
YFL039C_YPS128   236   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   285
YFL039C_YPS163   236   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   285
YFL039C_YS9   236   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   285
YFL039C_ZTW1   251   GNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMS   300
         

YFL039C_S288C   301   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   350
YFL039C_AWRI1631   301   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   350
YFL039C_AWRI796   301   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   350
YFL039C_BC187   286   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   335
YFL039C_BY4741   286   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   335
YFL039C_BY4742   286   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   335
YFL039C_CBS7960   301   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   350
YFL039C_CEN.PK   286   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   335
YFL039C_D273-10B   286   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   335
YFL039C_DBVPG6044   286   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   335
YFL039C_EC1118   301   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   350
YFL039C_EC9-8   301   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   350
YFL039C_FL100   286   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   335
YFL039C_FY1679   286   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   335
YFL039C_FostersB   301   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   350
YFL039C_FostersO   301   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   350
YFL039C_JAY291   301   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   350
YFL039C_JK9-3d   286   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   335
YFL039C_K11   286   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   335
YFL039C_Kyokai7   301   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   350
YFL039C_L1528   286   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   335
YFL039C_LalvinQA23   301   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   350
YFL039C_PW5   301   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   350
YFL039C_RM11-1a   286   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   335
YFL039C_RedStar   286   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   335
YFL039C_SEY6210   286   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   335
YFL039C_SK1   286   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   335
YFL039C_T7   301   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   350
YFL039C_T73   301   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   350
YFL039C_UC5   301   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   350
YFL039C_UWOPS05_217_3   286   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   335
YFL039C_VL3   301   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   350
YFL039C_W303   286   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   335
YFL039C_X2180-1A   286   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   335
YFL039C_Y55   286   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   335
YFL039C_YJM339   286   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   335
YFL039C_YJM789   301   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   350
YFL039C_YPH499   286   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   335
YFL039C_YPS128   286   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   335
YFL039C_YPS163   286   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   335
YFL039C_YS9   286   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   335
YFL039C_ZTW1   301   GGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLT   350
         

YFL039C_S288C   351   TFQQMWISKQEYDESGPSIVHHKCF   375
YFL039C_AWRI1631   351   TFQQMWISKQEYDESGPSIVHHKCF   375
YFL039C_AWRI796   351   TFQQMWISKQEYDESGPSIVHHKCF   375
YFL039C_BC187   336   TFQQMWISKQEYDESGPSIVHHKCF   360
YFL039C_BY4741   336   TFQQMWISKQEYDESGPSIVHHKCF   360
YFL039C_BY4742   336   TFQQMWISKQEYDESGPSIVHHKCF   360
YFL039C_CBS7960   351   TFQQMWISKQEYDESGPSIVHHKCF   375
YFL039C_CEN.PK   336   TFQQMWISKQEYDESGPSIVHHKCF   360
YFL039C_D273-10B   336   TFQQMWISKQEYDESGPSIVHHKCF   360
YFL039C_DBVPG6044   336   TFQQMWISKQEYDESGPSIVHHKCF   360
YFL039C_EC1118   351   TFQQMWISKQEYDESGPSIVHHKCF   375
YFL039C_EC9-8   351   TFQQMWISKQEYDESGPSIVHHKCF   375
YFL039C_FL100   336   TFQQMWISKQEYDESGPSIVHHKCF   360
YFL039C_FY1679   336   TFQQMWISKQEYDESGPSIVHHKCF   360
YFL039C_FostersB   351   TFQQMWISKQEYDESGPSIVHHKCF   375
YFL039C_FostersO   351   TFQQMWISKQEYDESGPSIVHHKCF   375
YFL039C_JAY291   351   TFQQMWISKQEYDESGPSIVHHKCF   375
YFL039C_JK9-3d   336   TFQQMWISKQEYDESGPSIVHHKCF   360
YFL039C_K11   336   TFQQMWISKQEYDESGPSIVHHKCF   360
YFL039C_Kyokai7   351   TFQQMWISKQEYDESGPSIVHHKCF   375
YFL039C_L1528   336   TFQQMWISKQEYDESGPSIVHHKCF   360
YFL039C_LalvinQA23   351   TFQQMWISKQEYDESGPSIVHHKCF   375
YFL039C_PW5   351   TFQQMWISKQEYDESGPSIVHHKCF   375
YFL039C_RM11-1a   336   TFQQMWISKQEYDESGPSIVHHKCF   360
YFL039C_RedStar   336   TFQQMWISKQEYDESGPSIVHHKCF   360
YFL039C_SEY6210   336   TFQQMWISKQEYDESGPSIVHHKCF   360
YFL039C_SK1   336   TFQQMWISKQEYDESGPSIVHHKCF   360
YFL039C_T7   351   TFQQMWISKQEYDESGPSIVHHKCF   375
YFL039C_T73   351   TFQQMWISKQEYDESGPSIVHHKCF   375
YFL039C_UC5   351   TFQQMWISKQEYDESGPSIVHHKCF   375
YFL039C_UWOPS05_217_3   336   TFQQMWISKQEYDESGPSIVHHKCF   360
YFL039C_VL3   351   TFQQMWISKQEYDESGPSIVHHKCF   375
YFL039C_W303   336   TFQQMWISKQEYDESGPSIVHHKCF   360
YFL039C_X2180-1A   336   TFQQMWISKQEYDESGPSIVHHKCF   360
YFL039C_Y55   336   TFQQMWISKQEYDESGPSIVHHKCF   360
YFL039C_YJM339   336   TFQQMWISKQEYDESGPSIVHHKCF   360
YFL039C_YJM789   351   TFQQMWISKQEYDESGPSIVHHKCF   375
YFL039C_YPH499   336   TFQQMWISKQEYDESGPSIVHHKCF   360
YFL039C_YPS128   336   TFQQMWISKQEYDESGPSIVHHKCF   360
YFL039C_YPS163   336   TFQQMWISKQEYDESGPSIVHHKCF   360
YFL039C_YS9   336   TFQQMWISKQEYDESGPSIVHHKCF   360
YFL039C_ZTW1   351   TFQQMWISKQEYDESGPSIVHHKCF   375
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YFL039C_S288C from SGD:

YFL039C_S288C [source=SGD]  Length: 376  Tue Feb 20 21:27:05 2018  Type: P  Check: 1974  ..

       1  MDSEVAALVI DNGSGMCKAG FAGDDAPRAV FPSIVGRPRH QGIMVGMGQK

      51  DSYVGDEAQS KRGILTLRYP IEHGIVTNWD DMEKIWHHTF YNELRVAPEE

     101  HPVLLTEAPM NPKSNREKMT QIMFETFNVP AFYVSIQAVL SLYSSGRTTG

     151  IVLDSGDGVT HVVPIYAGFS LPHAILRIDL AGRDLTDYLM KILSERGYSF

     201  STTAEREIVR DIKEKLCYVA LDFEQEMQTA AQSSSIEKSY ELPDGQVITI

     251  GNERFRAPEA LFHPSVLGLE SAGIDQTTYN SIMKCDVDVR KELYGNIVMS

     301  GGTTMFPGIA ERMQKEITAL APSSMKVKII APPERKYSVW IGGSILASLT

     351  TFQQMWISKQ EYDESGPSIV HHKCF*

Protein Sequence for YFL039C_AWRI1631 from AWRI:

YFL039C_AWRI1631 [source=AWRI]  Length: 376  Tue Feb 20 21:27:05 2018  Type: P  Check: 1974  ..

       1  MDSEVAALVI DNGSGMCKAG FAGDDAPRAV FPSIVGRPRH QGIMVGMGQK

      51  DSYVGDEAQS KRGILTLRYP IEHGIVTNWD DMEKIWHHTF YNELRVAPEE

     101  HPVLLTEAPM NPKSNREKMT QIMFETFNVP AFYVSIQAVL SLYSSGRTTG

     151  IVLDSGDGVT HVVPIYAGFS LPHAILRIDL AGRDLTDYLM KILSERGYSF

     201  STTAEREIVR DIKEKLCYVA LDFEQEMQTA AQSSSIEKSY ELPDGQVITI

     251  GNERFRAPEA LFHPSVLGLE SAGIDQTTYN SIMKCDVDVR KELYGNIVMS

     301  GGTTMFPGIA ERMQKEITAL APSSMKVKII APPERKYSVW IGGSILASLT

     351  TFQQMWISKQ EYDESGPSIV HHKCF*

Protein Sequence for YFL039C_AWRI796 from AWRI:

YFL039C_AWRI796 [source=AWRI]  Length: 376  Tue Feb 20 21:27:05 2018  Type: P  Check: 1974  ..

       1  MDSEVAALVI DNGSGMCKAG FAGDDAPRAV FPSIVGRPRH QGIMVGMGQK

      51  DSYVGDEAQS KRGILTLRYP IEHGIVTNWD DMEKIWHHTF YNELRVAPEE

     101  HPVLLTEAPM NPKSNREKMT QIMFETFNVP AFYVSIQAVL SLYSSGRTTG

     151  IVLDSGDGVT HVVPIYAGFS LPHAILRIDL AGRDLTDYLM KILSERGYSF

     201  STTAEREIVR DIKEKLCYVA LDFEQEMQTA AQSSSIEKSY ELPDGQVITI

     251  GNERFRAPEA LFHPSVLGLE SAGIDQTTYN SIMKCDVDVR KELYGNIVMS

     301  GGTTMFPGIA ERMQKEITAL APSSMKVKII APPERKYSVW IGGSILASLT

     351  TFQQMWISKQ EYDESGPSIV HHKCF*

Protein Sequence for YFL039C_BC187 from Stanford:

YFL039C_BC187 [source=Stanford]  Length: 361  Tue Feb 20 21:27:05 2018  Type: P  Check: 3989  ..

       1  MCKAGFAGDD APRAVFPSIV GRPRHQGIMV GMGQKDSYVG DEAQSKRGIL

      51  TLRYPIEHGI VTNWDDMEKI WHHTFYNELR VAPEEHPVLL TEAPMNPKSN

     101  REKMTQIMFE TFNVPAFYVS IQAVLSLYSS GRTTGIVLDS GDGVTHVVPI

     151  YAGFSLPHAI LRIDLAGRDL TDYLMKILSE RGYSFSTTAE REIVRDIKEK

     201  LCYVALDFEQ EMQTAAQSSS IEKSYELPDG QVITIGNERF RAPEALFHPS

     251  VLGLESAGID QTTYNSIMKC DVDVRKELYG NIVMSGGTTM FPGIAERMQK

     301  EITALAPSSM KVKIIAPPER KYSVWIGGSI LASLTTFQQM WISKQEYDES

     351  GPSIVHHKCF *

Protein Sequence for YFL039C_BY4741 from Stanford:

YFL039C_BY4741 [source=Stanford]  Length: 361  Tue Feb 20 21:27:05 2018  Type: P  Check: 3989  ..

       1  MCKAGFAGDD APRAVFPSIV GRPRHQGIMV GMGQKDSYVG DEAQSKRGIL

      51  TLRYPIEHGI VTNWDDMEKI WHHTFYNELR VAPEEHPVLL TEAPMNPKSN

     101  REKMTQIMFE TFNVPAFYVS IQAVLSLYSS GRTTGIVLDS GDGVTHVVPI

     151  YAGFSLPHAI LRIDLAGRDL TDYLMKILSE RGYSFSTTAE REIVRDIKEK

     201  LCYVALDFEQ EMQTAAQSSS IEKSYELPDG QVITIGNERF RAPEALFHPS

     251  VLGLESAGID QTTYNSIMKC DVDVRKELYG NIVMSGGTTM FPGIAERMQK

     301  EITALAPSSM KVKIIAPPER KYSVWIGGSI LASLTTFQQM WISKQEYDES

     351  GPSIVHHKCF *

Protein Sequence for YFL039C_BY4742 from Stanford:

YFL039C_BY4742 [source=Stanford]  Length: 361  Tue Feb 20 21:27:05 2018  Type: P  Check: 3989  ..

       1  MCKAGFAGDD APRAVFPSIV GRPRHQGIMV GMGQKDSYVG DEAQSKRGIL

      51  TLRYPIEHGI VTNWDDMEKI WHHTFYNELR VAPEEHPVLL TEAPMNPKSN

     101  REKMTQIMFE TFNVPAFYVS IQAVLSLYSS GRTTGIVLDS GDGVTHVVPI

     151  YAGFSLPHAI LRIDLAGRDL TDYLMKILSE RGYSFSTTAE REIVRDIKEK

     201  LCYVALDFEQ EMQTAAQSSS IEKSYELPDG QVITIGNERF RAPEALFHPS

     251  VLGLESAGID QTTYNSIMKC DVDVRKELYG NIVMSGGTTM FPGIAERMQK

     301  EITALAPSSM KVKIIAPPER KYSVWIGGSI LASLTTFQQM WISKQEYDES

     351  GPSIVHHKCF *

Protein Sequence for YFL039C_CBS7960 from WashU:

YFL039C_CBS7960 [source=WashU]  Length: 376  Tue Feb 20 21:27:05 2018  Type: P  Check: 1935  ..

       1  MDFEVAALVI DNGSGMCKAG FAGDDAPRAV FPSIVGRPRH QGIMVGMGQK

      51  DSYVGDEAQS KRGILTLRYP IEHGIVTNWD DMEKIWHHTF YNELRVAPEE

     101  HPVLLTEAPM NPKSNREKMT QIMFETFNVP AFYVSIQAVL SLYSSGRTTG

     151  IVLDSGDGVT HVVPIYAGFS LPHAILRIDL AGRDLTDYLM KILSERGYSF

     201  STTAEREIVR DIKEKLCYVA LDFEQEMQTA AQSSSIEKSY ELPDGQVITI

     251  GNERFRAPEA LFHPSVLGLE SAGIDQTTYN SIMKCDVDVR KELYGNIVMS

     301  GGTTMFPGIA ERMQKEITAL APSSMKVKII APPERKYSVW IGGSILASLT

     351  TFQQMWISKQ EYDESGPSIV HHKCF*

Protein Sequence for YFL039C_CEN.PK from Stanford:

YFL039C_CEN.PK [source=Stanford]  Length: 361  Tue Feb 20 21:27:05 2018  Type: P  Check: 3989  ..

       1  MCKAGFAGDD APRAVFPSIV GRPRHQGIMV GMGQKDSYVG DEAQSKRGIL

      51  TLRYPIEHGI VTNWDDMEKI WHHTFYNELR VAPEEHPVLL TEAPMNPKSN

     101  REKMTQIMFE TFNVPAFYVS IQAVLSLYSS GRTTGIVLDS GDGVTHVVPI

     151  YAGFSLPHAI LRIDLAGRDL TDYLMKILSE RGYSFSTTAE REIVRDIKEK

     201  LCYVALDFEQ EMQTAAQSSS IEKSYELPDG QVITIGNERF RAPEALFHPS

     251  VLGLESAGID QTTYNSIMKC DVDVRKELYG NIVMSGGTTM FPGIAERMQK

     301  EITALAPSSM KVKIIAPPER KYSVWIGGSI LASLTTFQQM WISKQEYDES

     351  GPSIVHHKCF *

Protein Sequence for YFL039C_D273-10B from Stanford:

YFL039C_D273-10B [source=Stanford]  Length: 361  Tue Feb 20 21:27:05 2018  Type: P  Check: 3989  ..

       1  MCKAGFAGDD APRAVFPSIV GRPRHQGIMV GMGQKDSYVG DEAQSKRGIL

      51  TLRYPIEHGI VTNWDDMEKI WHHTFYNELR VAPEEHPVLL TEAPMNPKSN

     101  REKMTQIMFE TFNVPAFYVS IQAVLSLYSS GRTTGIVLDS GDGVTHVVPI

     151  YAGFSLPHAI LRIDLAGRDL TDYLMKILSE RGYSFSTTAE REIVRDIKEK

     201  LCYVALDFEQ EMQTAAQSSS IEKSYELPDG QVITIGNERF RAPEALFHPS

     251  VLGLESAGID QTTYNSIMKC DVDVRKELYG NIVMSGGTTM FPGIAERMQK

     301  EITALAPSSM KVKIIAPPER KYSVWIGGSI LASLTTFQQM WISKQEYDES

     351  GPSIVHHKCF *

Protein Sequence for YFL039C_DBVPG6044 from Stanford:

YFL039C_DBVPG6044 [source=Stanford]  Length: 361  Tue Feb 20 21:27:05 2018  Type: P  Check: 3989  ..

       1  MCKAGFAGDD APRAVFPSIV GRPRHQGIMV GMGQKDSYVG DEAQSKRGIL

      51  TLRYPIEHGI VTNWDDMEKI WHHTFYNELR VAPEEHPVLL TEAPMNPKSN

     101  REKMTQIMFE TFNVPAFYVS IQAVLSLYSS GRTTGIVLDS GDGVTHVVPI

     151  YAGFSLPHAI LRIDLAGRDL TDYLMKILSE RGYSFSTTAE REIVRDIKEK

     201  LCYVALDFEQ EMQTAAQSSS IEKSYELPDG QVITIGNERF RAPEALFHPS

     251  VLGLESAGID QTTYNSIMKC DVDVRKELYG NIVMSGGTTM FPGIAERMQK

     301  EITALAPSSM KVKIIAPPER KYSVWIGGSI LASLTTFQQM WISKQEYDES

     351  GPSIVHHKCF *

Protein Sequence for YFL039C_EC1118 from Genoscope:

YFL039C_EC1118 [source=Genoscope]  Length: 376  Tue Feb 20 21:27:05 2018  Type: P  Check: 1974  ..

       1  MDSEVAALVI DNGSGMCKAG FAGDDAPRAV FPSIVGRPRH QGIMVGMGQK

      51  DSYVGDEAQS KRGILTLRYP IEHGIVTNWD DMEKIWHHTF YNELRVAPEE

     101  HPVLLTEAPM NPKSNREKMT QIMFETFNVP AFYVSIQAVL SLYSSGRTTG

     151  IVLDSGDGVT HVVPIYAGFS LPHAILRIDL AGRDLTDYLM KILSERGYSF

     201  STTAEREIVR DIKEKLCYVA LDFEQEMQTA AQSSSIEKSY ELPDGQVITI

     251  GNERFRAPEA LFHPSVLGLE SAGIDQTTYN SIMKCDVDVR KELYGNIVMS

     301  GGTTMFPGIA ERMQKEITAL APSSMKVKII APPERKYSVW IGGSILASLT

     351  TFQQMWISKQ EYDESGPSIV HHKCF*

Protein Sequence for YFL039C_EC9-8 from ASinica:

YFL039C_EC9-8 [source=ASinica]  Length: 376  Tue Feb 20 21:27:05 2018  Type: P  Check: 1974  ..

       1  MDSEVAALVI DNGSGMCKAG FAGDDAPRAV FPSIVGRPRH QGIMVGMGQK

      51  DSYVGDEAQS KRGILTLRYP IEHGIVTNWD DMEKIWHHTF YNELRVAPEE

     101  HPVLLTEAPM NPKSNREKMT QIMFETFNVP AFYVSIQAVL SLYSSGRTTG

     151  IVLDSGDGVT HVVPIYAGFS LPHAILRIDL AGRDLTDYLM KILSERGYSF

     201  STTAEREIVR DIKEKLCYVA LDFEQEMQTA AQSSSIEKSY ELPDGQVITI

     251  GNERFRAPEA LFHPSVLGLE SAGIDQTTYN SIMKCDVDVR KELYGNIVMS

     301  GGTTMFPGIA ERMQKEITAL APSSMKVKII APPERKYSVW IGGSILASLT

     351  TFQQMWISKQ EYDESGPSIV HHKCF*

Protein Sequence for YFL039C_FL100 from Stanford:

YFL039C_FL100 [source=Stanford]  Length: 361  Tue Feb 20 21:27:05 2018  Type: P  Check: 3989  ..

       1  MCKAGFAGDD APRAVFPSIV GRPRHQGIMV GMGQKDSYVG DEAQSKRGIL

      51  TLRYPIEHGI VTNWDDMEKI WHHTFYNELR VAPEEHPVLL TEAPMNPKSN

     101  REKMTQIMFE TFNVPAFYVS IQAVLSLYSS GRTTGIVLDS GDGVTHVVPI

     151  YAGFSLPHAI LRIDLAGRDL TDYLMKILSE RGYSFSTTAE REIVRDIKEK

     201  LCYVALDFEQ EMQTAAQSSS IEKSYELPDG QVITIGNERF RAPEALFHPS

     251  VLGLESAGID QTTYNSIMKC DVDVRKELYG NIVMSGGTTM FPGIAERMQK

     301  EITALAPSSM KVKIIAPPER KYSVWIGGSI LASLTTFQQM WISKQEYDES

     351  GPSIVHHKCF *

Protein Sequence for YFL039C_FY1679 from Stanford:

YFL039C_FY1679 [source=Stanford]  Length: 361  Tue Feb 20 21:27:05 2018  Type: P  Check: 3989  ..

       1  MCKAGFAGDD APRAVFPSIV GRPRHQGIMV GMGQKDSYVG DEAQSKRGIL

      51  TLRYPIEHGI VTNWDDMEKI WHHTFYNELR VAPEEHPVLL TEAPMNPKSN

     101  REKMTQIMFE TFNVPAFYVS IQAVLSLYSS GRTTGIVLDS GDGVTHVVPI

     151  YAGFSLPHAI LRIDLAGRDL TDYLMKILSE RGYSFSTTAE REIVRDIKEK

     201  LCYVALDFEQ EMQTAAQSSS IEKSYELPDG QVITIGNERF RAPEALFHPS

     251  VLGLESAGID QTTYNSIMKC DVDVRKELYG NIVMSGGTTM FPGIAERMQK

     301  EITALAPSSM KVKIIAPPER KYSVWIGGSI LASLTTFQQM WISKQEYDES

     351  GPSIVHHKCF *

Protein Sequence for YFL039C_FostersB from AWRI:

YFL039C_FostersB [source=AWRI]  Length: 376  Tue Feb 20 21:27:05 2018  Type: P  Check: 2208  ..

       1  MDSEVAALVI DNGSGMCKAG FAGDDAPRAV FPSIVGRPRH QGIMVGMGQK

      51  DSYVGDEAQS KRGILTLRYP IEHGIVTNWD DMEKIWHHTF YNELRVAPEE

     101  HPVLLTEAPM NPKSNREKMT QIMFETXNVP AFYVSIQAVL SLYSSGRTTG

     151  IVLDSGDGVT HVVPIYAGFS LPHAILRIDL AGRDLTDYLM KILSERGYSF

     201  STTAEREIVR DIKEKLCYVA LDFEQEMQTA AQSSSIEKSY ELPDGQVITI

     251  GNERFRAPEA LFHPSVLGLE SAGIDQTTYN SIMKCDVDVR KELYGNIVMS

     301  GGTTMFPGIA ERMQKEITAL APSSMKVKII APPERKYSVW IGGSILASLT

     351  TFQQMWISKQ EYDESGPSIV HHKCF*

Protein Sequence for YFL039C_FostersO from AWRI:

YFL039C_FostersO [source=AWRI]  Length: 376  Tue Feb 20 21:27:05 2018  Type: P  Check: 1974  ..

       1  MDSEVAALVI DNGSGMCKAG FAGDDAPRAV FPSIVGRPRH QGIMVGMGQK

      51  DSYVGDEAQS KRGILTLRYP IEHGIVTNWD DMEKIWHHTF YNELRVAPEE

     101  HPVLLTEAPM NPKSNREKMT QIMFETFNVP AFYVSIQAVL SLYSSGRTTG

     151  IVLDSGDGVT HVVPIYAGFS LPHAILRIDL AGRDLTDYLM KILSERGYSF

     201  STTAEREIVR DIKEKLCYVA LDFEQEMQTA AQSSSIEKSY ELPDGQVITI

     251  GNERFRAPEA LFHPSVLGLE SAGIDQTTYN SIMKCDVDVR KELYGNIVMS

     301  GGTTMFPGIA ERMQKEITAL APSSMKVKII APPERKYSVW IGGSILASLT

     351  TFQQMWISKQ EYDESGPSIV HHKCF*

Protein Sequence for YFL039C_JAY291 from Duke:

YFL039C_JAY291 [source=Duke]  Length: 376  Tue Feb 20 21:27:05 2018  Type: P  Check: 1974  ..

       1  MDSEVAALVI DNGSGMCKAG FAGDDAPRAV FPSIVGRPRH QGIMVGMGQK

      51  DSYVGDEAQS KRGILTLRYP IEHGIVTNWD DMEKIWHHTF YNELRVAPEE

     101  HPVLLTEAPM NPKSNREKMT QIMFETFNVP AFYVSIQAVL SLYSSGRTTG

     151  IVLDSGDGVT HVVPIYAGFS LPHAILRIDL AGRDLTDYLM KILSERGYSF

     201  STTAEREIVR DIKEKLCYVA LDFEQEMQTA AQSSSIEKSY ELPDGQVITI

     251  GNERFRAPEA LFHPSVLGLE SAGIDQTTYN SIMKCDVDVR KELYGNIVMS

     301  GGTTMFPGIA ERMQKEITAL APSSMKVKII APPERKYSVW IGGSILASLT

     351  TFQQMWISKQ EYDESGPSIV HHKCF*

Protein Sequence for YFL039C_JK9-3d from Stanford:

YFL039C_JK9-3d [source=Stanford]  Length: 361  Tue Feb 20 21:27:05 2018  Type: P  Check: 3989  ..

       1  MCKAGFAGDD APRAVFPSIV GRPRHQGIMV GMGQKDSYVG DEAQSKRGIL

      51  TLRYPIEHGI VTNWDDMEKI WHHTFYNELR VAPEEHPVLL TEAPMNPKSN

     101  REKMTQIMFE TFNVPAFYVS IQAVLSLYSS GRTTGIVLDS GDGVTHVVPI

     151  YAGFSLPHAI LRIDLAGRDL TDYLMKILSE RGYSFSTTAE REIVRDIKEK

     201  LCYVALDFEQ EMQTAAQSSS IEKSYELPDG QVITIGNERF RAPEALFHPS

     251  VLGLESAGID QTTYNSIMKC DVDVRKELYG NIVMSGGTTM FPGIAERMQK

     301  EITALAPSSM KVKIIAPPER KYSVWIGGSI LASLTTFQQM WISKQEYDES

     351  GPSIVHHKCF *

Protein Sequence for YFL039C_K11 from Stanford:

YFL039C_K11 [source=Stanford]  Length: 361  Tue Feb 20 21:27:05 2018  Type: P  Check: 3989  ..

       1  MCKAGFAGDD APRAVFPSIV GRPRHQGIMV GMGQKDSYVG DEAQSKRGIL

      51  TLRYPIEHGI VTNWDDMEKI WHHTFYNELR VAPEEHPVLL TEAPMNPKSN

     101  REKMTQIMFE TFNVPAFYVS IQAVLSLYSS GRTTGIVLDS GDGVTHVVPI

     151  YAGFSLPHAI LRIDLAGRDL TDYLMKILSE RGYSFSTTAE REIVRDIKEK

     201  LCYVALDFEQ EMQTAAQSSS IEKSYELPDG QVITIGNERF RAPEALFHPS

     251  VLGLESAGID QTTYNSIMKC DVDVRKELYG NIVMSGGTTM FPGIAERMQK

     301  EITALAPSSM KVKIIAPPER KYSVWIGGSI LASLTTFQQM WISKQEYDES

     351  GPSIVHHKCF *

Protein Sequence for YFL039C_Kyokai7 from NRIB:

YFL039C_Kyokai7 [source=NRIB]  Length: 376  Tue Feb 20 21:27:05 2018  Type: P  Check: 1974  ..

       1  MDSEVAALVI DNGSGMCKAG FAGDDAPRAV FPSIVGRPRH QGIMVGMGQK

      51  DSYVGDEAQS KRGILTLRYP IEHGIVTNWD DMEKIWHHTF YNELRVAPEE

     101  HPVLLTEAPM NPKSNREKMT QIMFETFNVP AFYVSIQAVL SLYSSGRTTG

     151  IVLDSGDGVT HVVPIYAGFS LPHAILRIDL AGRDLTDYLM KILSERGYSF

     201  STTAEREIVR DIKEKLCYVA LDFEQEMQTA AQSSSIEKSY ELPDGQVITI

     251  GNERFRAPEA LFHPSVLGLE SAGIDQTTYN SIMKCDVDVR KELYGNIVMS

     301  GGTTMFPGIA ERMQKEITAL APSSMKVKII APPERKYSVW IGGSILASLT

     351  TFQQMWISKQ EYDESGPSIV HHKCF*

Protein Sequence for YFL039C_L1528 from Stanford:

YFL039C_L1528 [source=Stanford]  Length: 361  Tue Feb 20 21:27:05 2018  Type: P  Check: 3989  ..

       1  MCKAGFAGDD APRAVFPSIV GRPRHQGIMV GMGQKDSYVG DEAQSKRGIL

      51  TLRYPIEHGI VTNWDDMEKI WHHTFYNELR VAPEEHPVLL TEAPMNPKSN

     101  REKMTQIMFE TFNVPAFYVS IQAVLSLYSS GRTTGIVLDS GDGVTHVVPI

     151  YAGFSLPHAI LRIDLAGRDL TDYLMKILSE RGYSFSTTAE REIVRDIKEK

     201  LCYVALDFEQ EMQTAAQSSS IEKSYELPDG QVITIGNERF RAPEALFHPS

     251  VLGLESAGID QTTYNSIMKC DVDVRKELYG NIVMSGGTTM FPGIAERMQK

     301  EITALAPSSM KVKIIAPPER KYSVWIGGSI LASLTTFQQM WISKQEYDES

     351  GPSIVHHKCF *

Protein Sequence for YFL039C_LalvinQA23 from AWRI:

YFL039C_LalvinQA23 [source=AWRI]  Length: 376  Tue Feb 20 21:27:05 2018  Type: P  Check: 2154  ..

       1  MDSEVAALVI DNGSGMCKAG FAGDDAPRAV FPSIVGRPRH QGIMVGMGQK

      51  DSYVGDEAQS KRGILTLRYP IEHGIVTNWD DMEKIWHHTF YNELRVAPEE

     101  HPVLLTEAPM NPKSNREKMT QIMXETFNVP AFYVSIQAVL SLYSSGRTTG

     151  IVLDSGDGVT HVVPIYAGFS LPHAILRIDL AGRDLTDYLM KILSERGYSF

     201  STTAEREIVR DIKEKLCYVA LDFEQEMQTA AQSSSIEKSY ELPDGQVITI

     251  GNERFRAPEA LFHPSVLGLE SAGIDQTTYN SIMKCDVDVR KELYGNIVMS

     301  GGTTMFPGIA ERMQKEITAL APSSMKVKII APPERKYSVW IGGSILASLT

     351  TFQQMWISKQ EYDESGPSIV HHKCF*

Protein Sequence for YFL039C_PW5 from WashU:

YFL039C_PW5 [source=WashU]  Length: 376  Tue Feb 20 21:27:05 2018  Type: P  Check: 1974  ..

       1  MDSEVAALVI DNGSGMCKAG FAGDDAPRAV FPSIVGRPRH QGIMVGMGQK

      51  DSYVGDEAQS KRGILTLRYP IEHGIVTNWD DMEKIWHHTF YNELRVAPEE

     101  HPVLLTEAPM NPKSNREKMT QIMFETFNVP AFYVSIQAVL SLYSSGRTTG

     151  IVLDSGDGVT HVVPIYAGFS LPHAILRIDL AGRDLTDYLM KILSERGYSF

     201  STTAEREIVR DIKEKLCYVA LDFEQEMQTA AQSSSIEKSY ELPDGQVITI

     251  GNERFRAPEA LFHPSVLGLE SAGIDQTTYN SIMKCDVDVR KELYGNIVMS

     301  GGTTMFPGIA ERMQKEITAL APSSMKVKII APPERKYSVW IGGSILASLT

     351  TFQQMWISKQ EYDESGPSIV HHKCF*

Protein Sequence for YFL039C_RM11-1a from Stanford:

YFL039C_RM11-1a [source=Stanford]  Length: 361  Tue Feb 20 21:27:05 2018  Type: P  Check: 3989  ..

       1  MCKAGFAGDD APRAVFPSIV GRPRHQGIMV GMGQKDSYVG DEAQSKRGIL

      51  TLRYPIEHGI VTNWDDMEKI WHHTFYNELR VAPEEHPVLL TEAPMNPKSN

     101  REKMTQIMFE TFNVPAFYVS IQAVLSLYSS GRTTGIVLDS GDGVTHVVPI

     151  YAGFSLPHAI LRIDLAGRDL TDYLMKILSE RGYSFSTTAE REIVRDIKEK

     201  LCYVALDFEQ EMQTAAQSSS IEKSYELPDG QVITIGNERF RAPEALFHPS

     251  VLGLESAGID QTTYNSIMKC DVDVRKELYG NIVMSGGTTM FPGIAERMQK

     301  EITALAPSSM KVKIIAPPER KYSVWIGGSI LASLTTFQQM WISKQEYDES

     351  GPSIVHHKCF *

Protein Sequence for YFL039C_RedStar from Stanford:

YFL039C_RedStar [source=Stanford]  Length: 361  Tue Feb 20 21:27:05 2018  Type: P  Check: 3989  ..

       1  MCKAGFAGDD APRAVFPSIV GRPRHQGIMV GMGQKDSYVG DEAQSKRGIL

      51  TLRYPIEHGI VTNWDDMEKI WHHTFYNELR VAPEEHPVLL TEAPMNPKSN

     101  REKMTQIMFE TFNVPAFYVS IQAVLSLYSS GRTTGIVLDS GDGVTHVVPI

     151  YAGFSLPHAI LRIDLAGRDL TDYLMKILSE RGYSFSTTAE REIVRDIKEK

     201  LCYVALDFEQ EMQTAAQSSS IEKSYELPDG QVITIGNERF RAPEALFHPS

     251  VLGLESAGID QTTYNSIMKC DVDVRKELYG NIVMSGGTTM FPGIAERMQK

     301  EITALAPSSM KVKIIAPPER KYSVWIGGSI LASLTTFQQM WISKQEYDES

     351  GPSIVHHKCF *

Protein Sequence for YFL039C_SEY6210 from Stanford:

YFL039C_SEY6210 [source=Stanford]  Length: 361  Tue Feb 20 21:27:05 2018  Type: P  Check: 3989  ..

       1  MCKAGFAGDD APRAVFPSIV GRPRHQGIMV GMGQKDSYVG DEAQSKRGIL

      51  TLRYPIEHGI VTNWDDMEKI WHHTFYNELR VAPEEHPVLL TEAPMNPKSN

     101  REKMTQIMFE TFNVPAFYVS IQAVLSLYSS GRTTGIVLDS GDGVTHVVPI

     151  YAGFSLPHAI LRIDLAGRDL TDYLMKILSE RGYSFSTTAE REIVRDIKEK

     201  LCYVALDFEQ EMQTAAQSSS IEKSYELPDG QVITIGNERF RAPEALFHPS

     251  VLGLESAGID QTTYNSIMKC DVDVRKELYG NIVMSGGTTM FPGIAERMQK

     301  EITALAPSSM KVKIIAPPER KYSVWIGGSI LASLTTFQQM WISKQEYDES

     351  GPSIVHHKCF *

Protein Sequence for YFL039C_SK1 from Stanford:

YFL039C_SK1 [source=Stanford]  Length: 361  Tue Feb 20 21:27:05 2018  Type: P  Check: 3989  ..

       1  MCKAGFAGDD APRAVFPSIV GRPRHQGIMV GMGQKDSYVG DEAQSKRGIL

      51  TLRYPIEHGI VTNWDDMEKI WHHTFYNELR VAPEEHPVLL TEAPMNPKSN

     101  REKMTQIMFE TFNVPAFYVS IQAVLSLYSS GRTTGIVLDS GDGVTHVVPI

     151  YAGFSLPHAI LRIDLAGRDL TDYLMKILSE RGYSFSTTAE REIVRDIKEK

     201  LCYVALDFEQ EMQTAAQSSS IEKSYELPDG QVITIGNERF RAPEALFHPS

     251  VLGLESAGID QTTYNSIMKC DVDVRKELYG NIVMSGGTTM FPGIAERMQK

     301  EITALAPSSM KVKIIAPPER KYSVWIGGSI LASLTTFQQM WISKQEYDES

     351  GPSIVHHKCF *

Protein Sequence for YFL039C_T7 from WashU:

YFL039C_T7 [source=WashU]  Length: 376  Tue Feb 20 21:27:05 2018  Type: P  Check: 1974  ..

       1  MDSEVAALVI DNGSGMCKAG FAGDDAPRAV FPSIVGRPRH QGIMVGMGQK

      51  DSYVGDEAQS KRGILTLRYP IEHGIVTNWD DMEKIWHHTF YNELRVAPEE

     101  HPVLLTEAPM NPKSNREKMT QIMFETFNVP AFYVSIQAVL SLYSSGRTTG

     151  IVLDSGDGVT HVVPIYAGFS LPHAILRIDL AGRDLTDYLM KILSERGYSF

     201  STTAEREIVR DIKEKLCYVA LDFEQEMQTA AQSSSIEKSY ELPDGQVITI

     251  GNERFRAPEA LFHPSVLGLE SAGIDQTTYN SIMKCDVDVR KELYGNIVMS

     301  GGTTMFPGIA ERMQKEITAL APSSMKVKII APPERKYSVW IGGSILASLT

     351  TFQQMWISKQ EYDESGPSIV HHKCF*

Protein Sequence for YFL039C_T73 from WashU:

YFL039C_T73 [source=WashU]  Length: 376  Tue Feb 20 21:27:05 2018  Type: P  Check: 1974  ..

       1  MDSEVAALVI DNGSGMCKAG FAGDDAPRAV FPSIVGRPRH QGIMVGMGQK

      51  DSYVGDEAQS KRGILTLRYP IEHGIVTNWD DMEKIWHHTF YNELRVAPEE

     101  HPVLLTEAPM NPKSNREKMT QIMFETFNVP AFYVSIQAVL SLYSSGRTTG

     151  IVLDSGDGVT HVVPIYAGFS LPHAILRIDL AGRDLTDYLM KILSERGYSF

     201  STTAEREIVR DIKEKLCYVA LDFEQEMQTA AQSSSIEKSY ELPDGQVITI

     251  GNERFRAPEA LFHPSVLGLE SAGIDQTTYN SIMKCDVDVR KELYGNIVMS

     301  GGTTMFPGIA ERMQKEITAL APSSMKVKII APPERKYSVW IGGSILASLT

     351  TFQQMWISKQ EYDESGPSIV HHKCF*

Protein Sequence for YFL039C_UC5 from WashU:

YFL039C_UC5 [source=WashU]  Length: 376  Tue Feb 20 21:27:05 2018  Type: P  Check: 1974  ..

       1  MDSEVAALVI DNGSGMCKAG FAGDDAPRAV FPSIVGRPRH QGIMVGMGQK

      51  DSYVGDEAQS KRGILTLRYP IEHGIVTNWD DMEKIWHHTF YNELRVAPEE

     101  HPVLLTEAPM NPKSNREKMT QIMFETFNVP AFYVSIQAVL SLYSSGRTTG

     151  IVLDSGDGVT HVVPIYAGFS LPHAILRIDL AGRDLTDYLM KILSERGYSF

     201  STTAEREIVR DIKEKLCYVA LDFEQEMQTA AQSSSIEKSY ELPDGQVITI

     251  GNERFRAPEA LFHPSVLGLE SAGIDQTTYN SIMKCDVDVR KELYGNIVMS

     301  GGTTMFPGIA ERMQKEITAL APSSMKVKII APPERKYSVW IGGSILASLT

     351  TFQQMWISKQ EYDESGPSIV HHKCF*

Protein Sequence for YFL039C_UWOPS05_217_3 from Stanford:

YFL039C_UWOPS05_217_3 [source=Stanford]  Length: 361  Tue Feb 20 21:27:05 2018  Type: P  Check: 3989  ..

       1  MCKAGFAGDD APRAVFPSIV GRPRHQGIMV GMGQKDSYVG DEAQSKRGIL

      51  TLRYPIEHGI VTNWDDMEKI WHHTFYNELR VAPEEHPVLL TEAPMNPKSN

     101  REKMTQIMFE TFNVPAFYVS IQAVLSLYSS GRTTGIVLDS GDGVTHVVPI

     151  YAGFSLPHAI LRIDLAGRDL TDYLMKILSE RGYSFSTTAE REIVRDIKEK

     201  LCYVALDFEQ EMQTAAQSSS IEKSYELPDG QVITIGNERF RAPEALFHPS

     251  VLGLESAGID QTTYNSIMKC DVDVRKELYG NIVMSGGTTM FPGIAERMQK

     301  EITALAPSSM KVKIIAPPER KYSVWIGGSI LASLTTFQQM WISKQEYDES

     351  GPSIVHHKCF *

Protein Sequence for YFL039C_VL3 from AWRI:

YFL039C_VL3 [source=AWRI]  Length: 376  Tue Feb 20 21:27:05 2018  Type: P  Check: 1974  ..

       1  MDSEVAALVI DNGSGMCKAG FAGDDAPRAV FPSIVGRPRH QGIMVGMGQK

      51  DSYVGDEAQS KRGILTLRYP IEHGIVTNWD DMEKIWHHTF YNELRVAPEE

     101  HPVLLTEAPM NPKSNREKMT QIMFETFNVP AFYVSIQAVL SLYSSGRTTG

     151  IVLDSGDGVT HVVPIYAGFS LPHAILRIDL AGRDLTDYLM KILSERGYSF

     201  STTAEREIVR DIKEKLCYVA LDFEQEMQTA AQSSSIEKSY ELPDGQVITI

     251  GNERFRAPEA LFHPSVLGLE SAGIDQTTYN SIMKCDVDVR KELYGNIVMS

     301  GGTTMFPGIA ERMQKEITAL APSSMKVKII APPERKYSVW IGGSILASLT

     351  TFQQMWISKQ EYDESGPSIV HHKCF*

Protein Sequence for YFL039C_W303 from Stanford:

YFL039C_W303 [source=Stanford]  Length: 361  Tue Feb 20 21:27:05 2018  Type: P  Check: 3989  ..

       1  MCKAGFAGDD APRAVFPSIV GRPRHQGIMV GMGQKDSYVG DEAQSKRGIL

      51  TLRYPIEHGI VTNWDDMEKI WHHTFYNELR VAPEEHPVLL TEAPMNPKSN

     101  REKMTQIMFE TFNVPAFYVS IQAVLSLYSS GRTTGIVLDS GDGVTHVVPI

     151  YAGFSLPHAI LRIDLAGRDL TDYLMKILSE RGYSFSTTAE REIVRDIKEK

     201  LCYVALDFEQ EMQTAAQSSS IEKSYELPDG QVITIGNERF RAPEALFHPS

     251  VLGLESAGID QTTYNSIMKC DVDVRKELYG NIVMSGGTTM FPGIAERMQK

     301  EITALAPSSM KVKIIAPPER KYSVWIGGSI LASLTTFQQM WISKQEYDES

     351  GPSIVHHKCF *

Protein Sequence for YFL039C_X2180-1A from Stanford:

YFL039C_X2180-1A [source=Stanford]  Length: 361  Tue Feb 20 21:27:05 2018  Type: P  Check: 3989  ..

       1  MCKAGFAGDD APRAVFPSIV GRPRHQGIMV GMGQKDSYVG DEAQSKRGIL

      51  TLRYPIEHGI VTNWDDMEKI WHHTFYNELR VAPEEHPVLL TEAPMNPKSN

     101  REKMTQIMFE TFNVPAFYVS IQAVLSLYSS GRTTGIVLDS GDGVTHVVPI

     151  YAGFSLPHAI LRIDLAGRDL TDYLMKILSE RGYSFSTTAE REIVRDIKEK

     201  LCYVALDFEQ EMQTAAQSSS IEKSYELPDG QVITIGNERF RAPEALFHPS

     251  VLGLESAGID QTTYNSIMKC DVDVRKELYG NIVMSGGTTM FPGIAERMQK

     301  EITALAPSSM KVKIIAPPER KYSVWIGGSI LASLTTFQQM WISKQEYDES

     351  GPSIVHHKCF *

Protein Sequence for YFL039C_Y55 from Stanford:

YFL039C_Y55 [source=Stanford]  Length: 361  Tue Feb 20 21:27:05 2018  Type: P  Check: 3989  ..

       1  MCKAGFAGDD APRAVFPSIV GRPRHQGIMV GMGQKDSYVG DEAQSKRGIL

      51  TLRYPIEHGI VTNWDDMEKI WHHTFYNELR VAPEEHPVLL TEAPMNPKSN

     101  REKMTQIMFE TFNVPAFYVS IQAVLSLYSS GRTTGIVLDS GDGVTHVVPI

     151  YAGFSLPHAI LRIDLAGRDL TDYLMKILSE RGYSFSTTAE REIVRDIKEK

     201  LCYVALDFEQ EMQTAAQSSS IEKSYELPDG QVITIGNERF RAPEALFHPS

     251  VLGLESAGID QTTYNSIMKC DVDVRKELYG NIVMSGGTTM FPGIAERMQK

     301  EITALAPSSM KVKIIAPPER KYSVWIGGSI LASLTTFQQM WISKQEYDES

     351  GPSIVHHKCF *

Protein Sequence for YFL039C_YJM339 from Stanford:

YFL039C_YJM339 [source=Stanford]  Length: 361  Tue Feb 20 21:27:05 2018  Type: P  Check: 3989  ..

       1  MCKAGFAGDD APRAVFPSIV GRPRHQGIMV GMGQKDSYVG DEAQSKRGIL

      51  TLRYPIEHGI VTNWDDMEKI WHHTFYNELR VAPEEHPVLL TEAPMNPKSN

     101  REKMTQIMFE TFNVPAFYVS IQAVLSLYSS GRTTGIVLDS GDGVTHVVPI

     151  YAGFSLPHAI LRIDLAGRDL TDYLMKILSE RGYSFSTTAE REIVRDIKEK

     201  LCYVALDFEQ EMQTAAQSSS IEKSYELPDG QVITIGNERF RAPEALFHPS

     251  VLGLESAGID QTTYNSIMKC DVDVRKELYG NIVMSGGTTM FPGIAERMQK

     301  EITALAPSSM KVKIIAPPER KYSVWIGGSI LASLTTFQQM WISKQEYDES

     351  GPSIVHHKCF *

Protein Sequence for YFL039C_YJM789 from Stanford:

YFL039C_YJM789 [source=Stanford]  Length: 376  Tue Feb 20 21:27:05 2018  Type: P  Check: 1974  ..

       1  MDSEVAALVI DNGSGMCKAG FAGDDAPRAV FPSIVGRPRH QGIMVGMGQK

      51  DSYVGDEAQS KRGILTLRYP IEHGIVTNWD DMEKIWHHTF YNELRVAPEE

     101  HPVLLTEAPM NPKSNREKMT QIMFETFNVP AFYVSIQAVL SLYSSGRTTG

     151  IVLDSGDGVT HVVPIYAGFS LPHAILRIDL AGRDLTDYLM KILSERGYSF

     201  STTAEREIVR DIKEKLCYVA LDFEQEMQTA AQSSSIEKSY ELPDGQVITI

     251  GNERFRAPEA LFHPSVLGLE SAGIDQTTYN SIMKCDVDVR KELYGNIVMS

     301  GGTTMFPGIA ERMQKEITAL APSSMKVKII APPERKYSVW IGGSILASLT

     351  TFQQMWISKQ EYDESGPSIV HHKCF*

Protein Sequence for YFL039C_YPH499 from Stanford:

YFL039C_YPH499 [source=Stanford]  Length: 361  Tue Feb 20 21:27:05 2018  Type: P  Check: 3989  ..

       1  MCKAGFAGDD APRAVFPSIV GRPRHQGIMV GMGQKDSYVG DEAQSKRGIL

      51  TLRYPIEHGI VTNWDDMEKI WHHTFYNELR VAPEEHPVLL TEAPMNPKSN

     101  REKMTQIMFE TFNVPAFYVS IQAVLSLYSS GRTTGIVLDS GDGVTHVVPI

     151  YAGFSLPHAI LRIDLAGRDL TDYLMKILSE RGYSFSTTAE REIVRDIKEK

     201  LCYVALDFEQ EMQTAAQSSS IEKSYELPDG QVITIGNERF RAPEALFHPS

     251  VLGLESAGID QTTYNSIMKC DVDVRKELYG NIVMSGGTTM FPGIAERMQK

     301  EITALAPSSM KVKIIAPPER KYSVWIGGSI LASLTTFQQM WISKQEYDES

     351  GPSIVHHKCF *

Protein Sequence for YFL039C_YPS128 from Stanford:

YFL039C_YPS128 [source=Stanford]  Length: 361  Tue Feb 20 21:27:05 2018  Type: P  Check: 3989  ..

       1  MCKAGFAGDD APRAVFPSIV GRPRHQGIMV GMGQKDSYVG DEAQSKRGIL

      51  TLRYPIEHGI VTNWDDMEKI WHHTFYNELR VAPEEHPVLL TEAPMNPKSN

     101  REKMTQIMFE TFNVPAFYVS IQAVLSLYSS GRTTGIVLDS GDGVTHVVPI

     151  YAGFSLPHAI LRIDLAGRDL TDYLMKILSE RGYSFSTTAE REIVRDIKEK

     201  LCYVALDFEQ EMQTAAQSSS IEKSYELPDG QVITIGNERF RAPEALFHPS

     251  VLGLESAGID QTTYNSIMKC DVDVRKELYG NIVMSGGTTM FPGIAERMQK

     301  EITALAPSSM KVKIIAPPER KYSVWIGGSI LASLTTFQQM WISKQEYDES

     351  GPSIVHHKCF *

Protein Sequence for YFL039C_YPS163 from Stanford:

YFL039C_YPS163 [source=Stanford]  Length: 361  Tue Feb 20 21:27:05 2018  Type: P  Check: 3989  ..

       1  MCKAGFAGDD APRAVFPSIV GRPRHQGIMV GMGQKDSYVG DEAQSKRGIL

      51  TLRYPIEHGI VTNWDDMEKI WHHTFYNELR VAPEEHPVLL TEAPMNPKSN

     101  REKMTQIMFE TFNVPAFYVS IQAVLSLYSS GRTTGIVLDS GDGVTHVVPI

     151  YAGFSLPHAI LRIDLAGRDL TDYLMKILSE RGYSFSTTAE REIVRDIKEK

     201  LCYVALDFEQ EMQTAAQSSS IEKSYELPDG QVITIGNERF RAPEALFHPS

     251  VLGLESAGID QTTYNSIMKC DVDVRKELYG NIVMSGGTTM FPGIAERMQK

     301  EITALAPSSM KVKIIAPPER KYSVWIGGSI LASLTTFQQM WISKQEYDES

     351  GPSIVHHKCF *

Protein Sequence for YFL039C_YS9 from Stanford:

YFL039C_YS9 [source=Stanford]  Length: 361  Tue Feb 20 21:27:05 2018  Type: P  Check: 3989  ..

       1  MCKAGFAGDD APRAVFPSIV GRPRHQGIMV GMGQKDSYVG DEAQSKRGIL

      51  TLRYPIEHGI VTNWDDMEKI WHHTFYNELR VAPEEHPVLL TEAPMNPKSN

     101  REKMTQIMFE TFNVPAFYVS IQAVLSLYSS GRTTGIVLDS GDGVTHVVPI

     151  YAGFSLPHAI LRIDLAGRDL TDYLMKILSE RGYSFSTTAE REIVRDIKEK

     201  LCYVALDFEQ EMQTAAQSSS IEKSYELPDG QVITIGNERF RAPEALFHPS

     251  VLGLESAGID QTTYNSIMKC DVDVRKELYG NIVMSGGTTM FPGIAERMQK

     301  EITALAPSSM KVKIIAPPER KYSVWIGGSI LASLTTFQQM WISKQEYDES

     351  GPSIVHHKCF *

Protein Sequence for YFL039C_ZTW1 from Zhejiang:

YFL039C_ZTW1 [source=Zhejiang]  Length: 376  Tue Feb 20 21:27:05 2018  Type: P  Check: 1974  ..

       1  MDSEVAALVI DNGSGMCKAG FAGDDAPRAV FPSIVGRPRH QGIMVGMGQK

      51  DSYVGDEAQS KRGILTLRYP IEHGIVTNWD DMEKIWHHTF YNELRVAPEE

     101  HPVLLTEAPM NPKSNREKMT QIMFETFNVP AFYVSIQAVL SLYSSGRTTG

     151  IVLDSGDGVT HVVPIYAGFS LPHAILRIDL AGRDLTDYLM KILSERGYSF

     201  STTAEREIVR DIKEKLCYVA LDFEQEMQTA AQSSSIEKSY ELPDGQVITI

     251  GNERFRAPEA LFHPSVLGLE SAGIDQTTYN SIMKCDVDVR KELYGNIVMS

     301  GGTTMFPGIA ERMQKEITAL APSSMKVKII APPERKYSVW IGGSILASLT

     351  TFQQMWISKQ EYDESGPSIV HHKCF*