GNA1/YFL017C S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YFL017C_S288C   1   MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATV   50
YFL017C_AWRI796   
   --------------------------------------------------   
YFL017C_BC187   1   MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATV   50
YFL017C_BY4741   1   MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATV   50
YFL017C_BY4742   1   MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATV   50
YFL017C_CBS7960   1   MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATV   50
YFL017C_CEN.PK   1   MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATV   50
YFL017C_CLIB215   1   MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATV   50
YFL017C_CLIB324   1   MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATV   50
YFL017C_D273-10B   1   MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATV   50
YFL017C_DBVPG6044   1   MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATV   50
YFL017C_EC1118   
   --------------------------------------------------   
YFL017C_EC9-8   1   MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATV   50
YFL017C_FY1679   1   MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATV   50
YFL017C_FostersB   1   ---------------------------------------------MKPQY   5
YFL017C_FostersO   1   MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATV   50
YFL017C_JAY291   1   MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATV   50
YFL017C_JK9-3d   1   MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATV   50
YFL017C_K11   1   MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNESTV   50
YFL017C_Kyokai7   1   MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATV   50
YFL017C_L1528   1   -----------MEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATV   39
YFL017C_LalvinQA23   1   MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATV   50
YFL017C_PW5   1   MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATV   50
YFL017C_RM11-1a   1   MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATV   50
YFL017C_RedStar   1   MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATV   50
YFL017C_SEY6210   1   MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATV   50
YFL017C_SK1   1   MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATV   50
YFL017C_T7   1   MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATV   50
YFL017C_T73   1   MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATV   50
YFL017C_UC5   1   MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNESTV   50
YFL017C_UWOPS05_217_3   
   --------------------------------------------------   
YFL017C_VL3   1   MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATV   50
YFL017C_Vin13   1   MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATV   50
YFL017C_W303   1   MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATV   50
YFL017C_X2180-1A   1   MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATV   50
YFL017C_Y10   1   MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATV   50
YFL017C_Y55   1   MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATV   50
YFL017C_YJM269   1   MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATV   50
YFL017C_YJM339   1   MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATV   50
YFL017C_YJM789   1   MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATV   50
YFL017C_YPH499   1   MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATV   50
YFL017C_YPS128   1   MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATV   50
YFL017C_YPS163   
   --------------------------------------------------   
YFL017C_YS9   1   MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATV   50
YFL017C_ZTW1   1   MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATV   50
         

YFL017C_S288C   51   WNDNEDKKIMQYNPMVIVDKRTETVAATGNIIIERKIIHELGLCGHIEDI   100
YFL017C_AWRI796   1   --------------MVIVDKRTETIAATGNIIIERKIIHELGLCGHIEDI   36
YFL017C_BC187   51   WNDNEDKKIMQYNPMVIVDKRTETIAATGNIIIERKIIHELGLCGHIEDI   100
YFL017C_BY4741   51   WNDNEDKKIMQYNPMVIVDKRTETVAATGNIIIERKIIHELGLCGHIEDI   100
YFL017C_BY4742   51   WNDNEDKKIMQYNPMVIVDKRTETVAATGNIIIERKIIHELGLCGHIEDI   100
YFL017C_CBS7960   51   WNDNEDKKIMQYNPMVIVDKRTETIAATGNIIIERKIIHELGLCGHIEDI   100
YFL017C_CEN.PK   51   WNDNEDKKIMQYNPMVIVDKRTETVAATGNIIIERKIIHELGLCGHIEDI   100
YFL017C_CLIB215   51   WNDNEDKKIMQYNPMVIVDKRTETIAATGNIIIERKIIHELGLCGHIEDI   100
YFL017C_CLIB324   51   WNDNEDKKIMQYNPMVIVDKRTETVAATGNIIIERKIIHELGLCGHIEDI   100
YFL017C_D273-10B   51   WNDNEDKKIMQYNPMVIVDKRTETVAATGNIIIERKIIHELGLCGHIEDI   100
YFL017C_DBVPG6044   51   WNDNEDKKIMQYNPMVIVDKRTETVAATGNIIIERKIIHELGLCGHIEDI   100
YFL017C_EC1118   1   ---------MQYNPMVIVDKRTETIAATGNIIIERKIIHELGLCGHIEDI   41
YFL017C_EC9-8   51   WNDNEDKKIMQYNPMVIVDKRTETVAATGNIIIERKIIHELGLCGHIEDI   100
YFL017C_FY1679   51   WNDNEDKKIMQYNPMVIVDKRTETVAATGNIIIERKIIHELGLCGHIEDI   100
YFL017C_FostersB   6   GMITKIKKXMQYNPMXIVDKRTETXAATGNXIIERKIIHEXGLCGHIEDI   55
YFL017C_FostersO   51   WNDNEDKKIMQYNPMVIVDKRTETVAATGNIIIERKIIHELGLCGHIEDI   100
YFL017C_JAY291   51   WNDNEDKKIMQYNPMVIVDKRTETIAATGNIIIERKIIHELGLCGHIEDI   100
YFL017C_JK9-3d   51   WNDNEDKKIMQYNPMVIVDKRTETVAATGNIIIERKIIHELGLCGHIEDI   100
YFL017C_K11   51   WNDNEDKKIMQYNPMVIVDKRTETVAATGNIIIERKIIHELGLCGHIEDI   100
YFL017C_Kyokai7   51   WNDNEDKKIMQYNPMVIVDKRTETVAATGNIIIERKIIHELGLCGHIEDI   100
YFL017C_L1528   40   WNDNEDKKIMQYNPMVIVDKRTETIAATGNIIIERKIIHELGLCGHIEDI   89
YFL017C_LalvinQA23   51   WNDNEDKKIMQYNPMVIVDKRTETIAATGNIIIERKIIHELGLCGHIEDI   100
YFL017C_PW5   51   WNDNEDKKIMQYNPMVIVDKRTETVAATGNIIIERKIIHELGLCGHIEDI   100
YFL017C_RM11-1a   51   WNDNEDKKIMQYNPMVIVDKRTETIAATGNIIIERKIIHELGLCGHIEDI   100
YFL017C_RedStar   51   WNDNEDKKIMQYNPMVIVDKRTETVAATGNIIIERKIIHELGLCGHIEDI   100
YFL017C_SEY6210   51   WNDNEDKKIMQYNPMVIVDKRTETVAATGNIIIERKIIHELGLCGHIEDI   100
YFL017C_SK1   51   WNDNEDKKIMQYNPMVIVDKRTETVAATGNIIIERKIIHELGLCGHIEDI   100
YFL017C_T7   51   WNDNEDKKIMQYNPMVIVDKRTETVAATGNIIIERKIIHELGLCGHIEDI   100
YFL017C_T73   51   WNDNEDKKIMQYNPMVIVDKRTETIAATGNIIIERKIIHELGLCGHIEDI   100
YFL017C_UC5   51   WNDNEDKKIMQYNPMVIVDKRTETVAATGNIIIERKIIHELGLCGHIEDI   100
YFL017C_UWOPS05_217_3   1   ---------MQYNPMVIVDKRTETIAATGNIIIERKIIHELGLCGHIEDI   41
YFL017C_VL3   51   WNDNEDKKIMQYNPMVIVDKRTETIAATGNIIIERKIIHELGLCGHIEDI   100
YFL017C_Vin13   51   WNDNEDKKIMQYNPMVIVDKRTETIAATGNIIIERKIIHELGLCGHIEDI   100
YFL017C_W303   51   WNDNEDKKIMQYNPMVIVDKRTETVAATGNIIIERKIIHELGLCGHIEDI   100
YFL017C_X2180-1A   51   WNDNEDKKIMQYNPMVIVDKRTETVAATGNIIIERKIIHELGLCGHIEDI   100
YFL017C_Y10   51   WNDNEDKKIMQYNPMVIVDKRTETIAATGNIIIERKIIHELGLCGHIEDI   100
YFL017C_Y55   51   WNDNEDKKIMQYNPMVIVDKRTETVAATGNIIIERKIIHELGLCGHIEDI   100
YFL017C_YJM269   51   WNDNEDKKIMQYNPMVIVDKRTETIAATGNIIIERKIIHELGLCGHIEDI   100
YFL017C_YJM339   51   WNDNEDKKIMQYNPMVIVDKRTETVAATGNIIIERKIIHELGLCGHIEDI   100
YFL017C_YJM789   51   WNDNEDKKIMQYNPMVIVDKRTETIAATGNIIIERKIIHELGLCGHIEDI   100
YFL017C_YPH499   51   WNDNEDKKIMQYNPMVIVDKRTETVAATGNIIIERKIIHELGLCGHIEDI   100
YFL017C_YPS128   51   WNDNEDKKIMQYNPMVIVDKRTETIAATGNIIIERKIIHELGLCGHIEDI   100
YFL017C_YPS163   1   ---------MQYNPMVIVDKRTETIAATGNIIIERKIIHELGLCGHIEDI   41
YFL017C_YS9   51   WNDNEDKKIMQYNPMVIVDKRTETIAATGNIIIERKIIHELGLCGHIEDI   100
YFL017C_ZTW1   51   WNDNEDKKIMQYNPMVIVDKRTETVAATGNIIIERKIIHELGLCGHIEDI   100
         

YFL017C_S288C   101   AVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSN   150
YFL017C_AWRI796   37   AVNSKYQGQGLGKLLIGQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFNN   86
YFL017C_BC187   101   AVNSKYQGQGLGKLLIGQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFNN   150
YFL017C_BY4741   101   AVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSN   150
YFL017C_BY4742   101   AVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSN   150
YFL017C_CBS7960   101   AVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFNN   150
YFL017C_CEN.PK   101   AVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSN   150
YFL017C_CLIB215   101   AVNSKYQGQGLGKLLIGQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFNN   150
YFL017C_CLIB324   101   AVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSN   150
YFL017C_D273-10B   101   AVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSN   150
YFL017C_DBVPG6044   101   AVNSKYQGQGLGKLLIHQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSN   150
YFL017C_EC1118   42   AVNSKYQGQGLGKLLIGQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFNN   91
YFL017C_EC9-8   101   AVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSN   150
YFL017C_FY1679   101   AVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSN   150
YFL017C_FostersB   56   AVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFXN   105
YFL017C_FostersO   101   AVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFXN   150
YFL017C_JAY291   101   AVNSKYQGQGLGKLLIGQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFNN   150
YFL017C_JK9-3d   101   AVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSN   150
YFL017C_K11   101   AVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSN   150
YFL017C_Kyokai7   101   AVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSN   150
YFL017C_L1528   90   AVNSKYQGQGLGKLLIGQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFNN   139
YFL017C_LalvinQA23   101   AVNSKYQGQGLGKLLIXQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFNN   150
YFL017C_PW5   101   AVNSKYQGQGLGKLLIHQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSN   150
YFL017C_RM11-1a   101   AVNSKYQGQGLGKLLIGQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFNN   150
YFL017C_RedStar   101   AVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSN   150
YFL017C_SEY6210   101   AVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSN   150
YFL017C_SK1   101   AVNSKYQGQGLGKLLIHQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSN   150
YFL017C_T7   101   AVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSN   150
YFL017C_T73   101   AVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFNN   150
YFL017C_UC5   101   AVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSN   150
YFL017C_UWOPS05_217_3   42   AVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSN   91
YFL017C_VL3   101   AVNSKYQGQGLGKLLIGQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFNN   150
YFL017C_Vin13   101   AVNSKYQGQGLGKLLIGQLVTIGFDYGCYKIILDCDEKNVKFYEKMWV--   148
YFL017C_W303   101   AVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSN   150
YFL017C_X2180-1A   101   AVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSN   150
YFL017C_Y10   101   AVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSN   150
YFL017C_Y55   101   AVNSKYQGQGLGKLLIHQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSN   150
YFL017C_YJM269   101   AVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSN   150
YFL017C_YJM339   101   AVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSN   150
YFL017C_YJM789   101   AVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSN   150
YFL017C_YPH499   101   AVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSN   150
YFL017C_YPS128   101   AVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSN   150
YFL017C_YPS163   42   AVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSN   91
YFL017C_YS9   101   AVNSKYQGQGLGKLLIGQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFNN   150
YFL017C_ZTW1   101   AVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSN   150
         

YFL017C_S288C   151   AGVEMQIRK   159
YFL017C_AWRI796   87   AGVEMQIRK   95
YFL017C_BC187   151   AGVEMQIRK   159
YFL017C_BY4741   151   AGVEMQIRK   159
YFL017C_BY4742   151   AGVEMQIRK   159
YFL017C_CBS7960   151   AGVEMQIRK   159
YFL017C_CEN.PK   151   AGVEMQIRK   159
YFL017C_CLIB215   151   AGVEMQIRK   159
YFL017C_CLIB324   151   AGVEMQIRK   159
YFL017C_D273-10B   151   AGVEMQIRK   159
YFL017C_DBVPG6044   151   AGVEMQIRK   159
YFL017C_EC1118   92   AGVEMQIRK   100
YFL017C_EC9-8   151   AGVEMQIRK   159
YFL017C_FY1679   151   AGVEMQIRK   159
YFL017C_FostersB   106   AGVEMQIRK   114
YFL017C_FostersO   151   AGVEMQIRK   159
YFL017C_JAY291   151   AGVEMQIRK   159
YFL017C_JK9-3d   151   AGVEMQIRK   159
YFL017C_K11   151   AGVEMQIRK   159
YFL017C_Kyokai7   151   AGVEMQIRK   159
YFL017C_L1528   140   AGVEMQIRK   148
YFL017C_LalvinQA23   151   AGVEMQIRK   159
YFL017C_PW5   151   AGVEMQIRK   159
YFL017C_RM11-1a   151   AGVEMQIRK   159
YFL017C_RedStar   151   AGVEMQIRK   159
YFL017C_SEY6210   151   AGVEMQIRK   159
YFL017C_SK1   151   AGVEMQIRK   159
YFL017C_T7   151   AGVEMQIRK   159
YFL017C_T73   151   AGVEMQIRK   159
YFL017C_UC5   151   AGVEMQIRK   159
YFL017C_UWOPS05_217_3   92   AGVEMQIRK   100
YFL017C_VL3   151   AGVEMQIRK   159
YFL017C_Vin13   
   ---------   
YFL017C_W303   151   AGVEMQIRK   159
YFL017C_X2180-1A   151   AGVEMQIRK   159
YFL017C_Y10   151   AGVEMQIRK   159
YFL017C_Y55   151   AGVEMQIRK   159
YFL017C_YJM269   151   AGVEMQIRK   159
YFL017C_YJM339   151   AGVEMQIRK   159
YFL017C_YJM789   151   AGVEMQIRK   159
YFL017C_YPH499   151   AGVEMQIRK   159
YFL017C_YPS128   151   AGVEMQIRK   159
YFL017C_YPS163   92   AGVEMQIRK   100
YFL017C_YS9   151   AGVEMQIRK   159
YFL017C_ZTW1   151   AGVEMQIRK   159
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YFL017C_S288C from SGD:

YFL017C_S288C [source=SGD]  Length: 160  Fri Dec 15 17:38:07 2017  Type: P  Check: 1206  ..

       1  MSLPDGFYIR RMEEGDLEQV TETLKVLTTV GTITPESFSK LIKYWNEATV

      51  WNDNEDKKIM QYNPMVIVDK RTETVAATGN IIIERKIIHE LGLCGHIEDI

     101  AVNSKYQGQG LGKLLIDQLV TIGFDYGCYK IILDCDEKNV KFYEKCGFSN

     151  AGVEMQIRK*

Protein Sequence for YFL017C_AWRI796 from AWRI:

YFL017C_AWRI796 [source=AWRI]  Length: 96  Fri Dec 15 17:38:07 2017  Type: P  Check: 1964  ..

       1  MVIVDKRTET IAATGNIIIE RKIIHELGLC GHIEDIAVNS KYQGQGLGKL

      51  LIGQLVTIGF DYGCYKIILD CDEKNVKFYE KCGFNNAGVE MQIRK*


Protein Sequence for YFL017C_BC187 from Stanford:

YFL017C_BC187 [source=Stanford]  Length: 160  Fri Dec 15 17:38:07 2017  Type: P  Check: 806  ..

       1  MSLPDGFYIR RMEEGDLEQV TETLKVLTTV GTITPESFSK LIKYWNEATV

      51  WNDNEDKKIM QYNPMVIVDK RTETIAATGN IIIERKIIHE LGLCGHIEDI

     101  AVNSKYQGQG LGKLLIGQLV TIGFDYGCYK IILDCDEKNV KFYEKCGFNN

     151  AGVEMQIRK*

Protein Sequence for YFL017C_BY4741 from Stanford:

YFL017C_BY4741 [source=Stanford]  Length: 160  Fri Dec 15 17:38:07 2017  Type: P  Check: 1206  ..

       1  MSLPDGFYIR RMEEGDLEQV TETLKVLTTV GTITPESFSK LIKYWNEATV

      51  WNDNEDKKIM QYNPMVIVDK RTETVAATGN IIIERKIIHE LGLCGHIEDI

     101  AVNSKYQGQG LGKLLIDQLV TIGFDYGCYK IILDCDEKNV KFYEKCGFSN

     151  AGVEMQIRK*

Protein Sequence for YFL017C_BY4742 from Stanford:

YFL017C_BY4742 [source=Stanford]  Length: 160  Fri Dec 15 17:38:07 2017  Type: P  Check: 1206  ..

       1  MSLPDGFYIR RMEEGDLEQV TETLKVLTTV GTITPESFSK LIKYWNEATV

      51  WNDNEDKKIM QYNPMVIVDK RTETVAATGN IIIERKIIHE LGLCGHIEDI

     101  AVNSKYQGQG LGKLLIDQLV TIGFDYGCYK IILDCDEKNV KFYEKCGFSN

     151  AGVEMQIRK*

Protein Sequence for YFL017C_CBS7960 from WashU:

YFL017C_CBS7960 [source=WashU]  Length: 160  Fri Dec 15 17:38:07 2017  Type: P  Check: 797  ..

       1  MSLPDGFYIR RMEEGDLEQV TETLKVLTTV GTITPESFSK LIKYWNEATV

      51  WNDNEDKKIM QYNPMVIVDK RTETIAATGN IIIERKIIHE LGLCGHIEDI

     101  AVNSKYQGQG LGKLLIDQLV TIGFDYGCYK IILDCDEKNV KFYEKCGFNN

     151  AGVEMQIRK*

Protein Sequence for YFL017C_CEN.PK from Stanford:

YFL017C_CEN.PK [source=Stanford]  Length: 160  Fri Dec 15 17:38:07 2017  Type: P  Check: 1206  ..

       1  MSLPDGFYIR RMEEGDLEQV TETLKVLTTV GTITPESFSK LIKYWNEATV

      51  WNDNEDKKIM QYNPMVIVDK RTETVAATGN IIIERKIIHE LGLCGHIEDI

     101  AVNSKYQGQG LGKLLIDQLV TIGFDYGCYK IILDCDEKNV KFYEKCGFSN

     151  AGVEMQIRK*

Protein Sequence for YFL017C_CLIB215 from WashU:

YFL017C_CLIB215 [source=WashU]  Length: 160  Fri Dec 15 17:38:07 2017  Type: P  Check: 806  ..

       1  MSLPDGFYIR RMEEGDLEQV TETLKVLTTV GTITPESFSK LIKYWNEATV

      51  WNDNEDKKIM QYNPMVIVDK RTETIAATGN IIIERKIIHE LGLCGHIEDI

     101  AVNSKYQGQG LGKLLIGQLV TIGFDYGCYK IILDCDEKNV KFYEKCGFNN

     151  AGVEMQIRK*

Protein Sequence for YFL017C_CLIB324 from WashU:

YFL017C_CLIB324 [source=WashU]  Length: 160  Fri Dec 15 17:38:07 2017  Type: P  Check: 1206  ..

       1  MSLPDGFYIR RMEEGDLEQV TETLKVLTTV GTITPESFSK LIKYWNEATV

      51  WNDNEDKKIM QYNPMVIVDK RTETVAATGN IIIERKIIHE LGLCGHIEDI

     101  AVNSKYQGQG LGKLLIDQLV TIGFDYGCYK IILDCDEKNV KFYEKCGFSN

     151  AGVEMQIRK*

Protein Sequence for YFL017C_D273-10B from Stanford:

YFL017C_D273-10B [source=Stanford]  Length: 160  Fri Dec 15 17:38:07 2017  Type: P  Check: 1206  ..

       1  MSLPDGFYIR RMEEGDLEQV TETLKVLTTV GTITPESFSK LIKYWNEATV

      51  WNDNEDKKIM QYNPMVIVDK RTETVAATGN IIIERKIIHE LGLCGHIEDI

     101  AVNSKYQGQG LGKLLIDQLV TIGFDYGCYK IILDCDEKNV KFYEKCGFSN

     151  AGVEMQIRK*

Protein Sequence for YFL017C_DBVPG6044 from Stanford:

YFL017C_DBVPG6044 [source=Stanford]  Length: 160  Fri Dec 15 17:38:07 2017  Type: P  Check: 1218  ..

       1  MSLPDGFYIR RMEEGDLEQV TETLKVLTTV GTITPESFSK LIKYWNEATV

      51  WNDNEDKKIM QYNPMVIVDK RTETVAATGN IIIERKIIHE LGLCGHIEDI

     101  AVNSKYQGQG LGKLLIHQLV TIGFDYGCYK IILDCDEKNV KFYEKCGFSN

     151  AGVEMQIRK*

Protein Sequence for YFL017C_EC1118 from Genoscope:

YFL017C_EC1118 [source=Genoscope]  Length: 101  Fri Dec 15 17:38:07 2017  Type: P  Check: 6306  ..

       1  MQYNPMVIVD KRTETIAATG NIIIERKIIH ELGLCGHIED IAVNSKYQGQ

      51  GLGKLLIGQL VTIGFDYGCY KIILDCDEKN VKFYEKCGFN NAGVEMQIRK

     101  *

Protein Sequence for YFL017C_EC9-8 from ASinica:

YFL017C_EC9-8 [source=ASinica]  Length: 160  Fri Dec 15 17:38:07 2017  Type: P  Check: 1206  ..

       1  MSLPDGFYIR RMEEGDLEQV TETLKVLTTV GTITPESFSK LIKYWNEATV

      51  WNDNEDKKIM QYNPMVIVDK RTETVAATGN IIIERKIIHE LGLCGHIEDI

     101  AVNSKYQGQG LGKLLIDQLV TIGFDYGCYK IILDCDEKNV KFYEKCGFSN

     151  AGVEMQIRK*

Protein Sequence for YFL017C_FY1679 from Stanford:

YFL017C_FY1679 [source=Stanford]  Length: 160  Fri Dec 15 17:38:07 2017  Type: P  Check: 1206  ..

       1  MSLPDGFYIR RMEEGDLEQV TETLKVLTTV GTITPESFSK LIKYWNEATV

      51  WNDNEDKKIM QYNPMVIVDK RTETVAATGN IIIERKIIHE LGLCGHIEDI

     101  AVNSKYQGQG LGKLLIDQLV TIGFDYGCYK IILDCDEKNV KFYEKCGFSN

     151  AGVEMQIRK*

Protein Sequence for YFL017C_FostersB from AWRI:

YFL017C_FostersB [source=AWRI]  Length: 115  Fri Dec 15 17:38:07 2017  Type: P  Check: 8728  ..

       1  MKPQYGMITK IKKXMQYNPM XIVDKRTETX AATGNXIIER KIIHEXGLCG

      51  HIEDIAVNSK YQGQGLGKLL IDQLVTIGFD YGCYKIILDC DEKNVKFYEK

     101  CGFXNAGVEM QIRK*

Protein Sequence for YFL017C_FostersO from AWRI:

YFL017C_FostersO [source=AWRI]  Length: 160  Fri Dec 15 17:38:07 2017  Type: P  Check: 1381  ..

       1  MSLPDGFYIR RMEEGDLEQV TETLKVLTTV GTITPESFSK LIKYWNEATV

      51  WNDNEDKKIM QYNPMVIVDK RTETVAATGN IIIERKIIHE LGLCGHIEDI

     101  AVNSKYQGQG LGKLLIDQLV TIGFDYGCYK IILDCDEKNV KFYEKCGFXN

     151  AGVEMQIRK*

Protein Sequence for YFL017C_JAY291 from Duke:

YFL017C_JAY291 [source=Duke]  Length: 160  Fri Dec 15 17:38:07 2017  Type: P  Check: 806  ..

       1  MSLPDGFYIR RMEEGDLEQV TETLKVLTTV GTITPESFSK LIKYWNEATV

      51  WNDNEDKKIM QYNPMVIVDK RTETIAATGN IIIERKIIHE LGLCGHIEDI

     101  AVNSKYQGQG LGKLLIGQLV TIGFDYGCYK IILDCDEKNV KFYEKCGFNN

     151  AGVEMQIRK*

Protein Sequence for YFL017C_JK9-3d from Stanford:

YFL017C_JK9-3d [source=Stanford]  Length: 160  Fri Dec 15 17:38:07 2017  Type: P  Check: 1206  ..

       1  MSLPDGFYIR RMEEGDLEQV TETLKVLTTV GTITPESFSK LIKYWNEATV

      51  WNDNEDKKIM QYNPMVIVDK RTETVAATGN IIIERKIIHE LGLCGHIEDI

     101  AVNSKYQGQG LGKLLIDQLV TIGFDYGCYK IILDCDEKNV KFYEKCGFSN

     151  AGVEMQIRK*

Protein Sequence for YFL017C_K11 from Stanford:

YFL017C_K11 [source=Stanford]  Length: 160  Fri Dec 15 17:38:07 2017  Type: P  Check: 2070  ..

       1  MSLPDGFYIR RMEEGDLEQV TETLKVLTTV GTITPESFSK LIKYWNESTV

      51  WNDNEDKKIM QYNPMVIVDK RTETVAATGN IIIERKIIHE LGLCGHIEDI

     101  AVNSKYQGQG LGKLLIDQLV TIGFDYGCYK IILDCDEKNV KFYEKCGFSN

     151  AGVEMQIRK*

Protein Sequence for YFL017C_Kyokai7 from NRIB:

YFL017C_Kyokai7 [source=NRIB]  Length: 160  Fri Dec 15 17:38:07 2017  Type: P  Check: 1206  ..

       1  MSLPDGFYIR RMEEGDLEQV TETLKVLTTV GTITPESFSK LIKYWNEATV

      51  WNDNEDKKIM QYNPMVIVDK RTETVAATGN IIIERKIIHE LGLCGHIEDI

     101  AVNSKYQGQG LGKLLIDQLV TIGFDYGCYK IILDCDEKNV KFYEKCGFSN

     151  AGVEMQIRK*

Protein Sequence for YFL017C_L1528 from Stanford:

YFL017C_L1528 [source=Stanford]  Length: 149  Fri Dec 15 17:38:07 2017  Type: P  Check: 8914  ..

       1  MEEGDLEQVT ETLKVLTTVG TITPESFSKL IKYWNEATVW NDNEDKKIMQ

      51  YNPMVIVDKR TETIAATGNI IIERKIIHEL GLCGHIEDIA VNSKYQGQGL

     101  GKLLIGQLVT IGFDYGCYKI ILDCDEKNVK FYEKCGFNNA GVEMQIRK*


Protein Sequence for YFL017C_LalvinQA23 from AWRI:

YFL017C_LalvinQA23 [source=AWRI]  Length: 160  Fri Dec 15 17:38:07 2017  Type: P  Check: 857  ..

       1  MSLPDGFYIR RMEEGDLEQV TETLKVLTTV GTITPESFSK LIKYWNEATV

      51  WNDNEDKKIM QYNPMVIVDK RTETIAATGN IIIERKIIHE LGLCGHIEDI

     101  AVNSKYQGQG LGKLLIXQLV TIGFDYGCYK IILDCDEKNV KFYEKCGFNN

     151  AGVEMQIRK*

Protein Sequence for YFL017C_PW5 from WashU:

YFL017C_PW5 [source=WashU]  Length: 160  Fri Dec 15 17:38:07 2017  Type: P  Check: 1218  ..

       1  MSLPDGFYIR RMEEGDLEQV TETLKVLTTV GTITPESFSK LIKYWNEATV

      51  WNDNEDKKIM QYNPMVIVDK RTETVAATGN IIIERKIIHE LGLCGHIEDI

     101  AVNSKYQGQG LGKLLIHQLV TIGFDYGCYK IILDCDEKNV KFYEKCGFSN

     151  AGVEMQIRK*

Protein Sequence for YFL017C_RM11-1a from Stanford:

YFL017C_RM11-1a [source=Stanford]  Length: 160  Fri Dec 15 17:38:07 2017  Type: P  Check: 806  ..

       1  MSLPDGFYIR RMEEGDLEQV TETLKVLTTV GTITPESFSK LIKYWNEATV

      51  WNDNEDKKIM QYNPMVIVDK RTETIAATGN IIIERKIIHE LGLCGHIEDI

     101  AVNSKYQGQG LGKLLIGQLV TIGFDYGCYK IILDCDEKNV KFYEKCGFNN

     151  AGVEMQIRK*

Protein Sequence for YFL017C_RedStar from Stanford:

YFL017C_RedStar [source=Stanford]  Length: 160  Fri Dec 15 17:38:07 2017  Type: P  Check: 1206  ..

       1  MSLPDGFYIR RMEEGDLEQV TETLKVLTTV GTITPESFSK LIKYWNEATV

      51  WNDNEDKKIM QYNPMVIVDK RTETVAATGN IIIERKIIHE LGLCGHIEDI

     101  AVNSKYQGQG LGKLLIDQLV TIGFDYGCYK IILDCDEKNV KFYEKCGFSN

     151  AGVEMQIRK*

Protein Sequence for YFL017C_SEY6210 from Stanford:

YFL017C_SEY6210 [source=Stanford]  Length: 160  Fri Dec 15 17:38:07 2017  Type: P  Check: 1206  ..

       1  MSLPDGFYIR RMEEGDLEQV TETLKVLTTV GTITPESFSK LIKYWNEATV

      51  WNDNEDKKIM QYNPMVIVDK RTETVAATGN IIIERKIIHE LGLCGHIEDI

     101  AVNSKYQGQG LGKLLIDQLV TIGFDYGCYK IILDCDEKNV KFYEKCGFSN

     151  AGVEMQIRK*

Protein Sequence for YFL017C_SK1 from Stanford:

YFL017C_SK1 [source=Stanford]  Length: 160  Fri Dec 15 17:38:07 2017  Type: P  Check: 1218  ..

       1  MSLPDGFYIR RMEEGDLEQV TETLKVLTTV GTITPESFSK LIKYWNEATV

      51  WNDNEDKKIM QYNPMVIVDK RTETVAATGN IIIERKIIHE LGLCGHIEDI

     101  AVNSKYQGQG LGKLLIHQLV TIGFDYGCYK IILDCDEKNV KFYEKCGFSN

     151  AGVEMQIRK*

Protein Sequence for YFL017C_T7 from WashU:

YFL017C_T7 [source=WashU]  Length: 160  Fri Dec 15 17:38:07 2017  Type: P  Check: 1206  ..

       1  MSLPDGFYIR RMEEGDLEQV TETLKVLTTV GTITPESFSK LIKYWNEATV

      51  WNDNEDKKIM QYNPMVIVDK RTETVAATGN IIIERKIIHE LGLCGHIEDI

     101  AVNSKYQGQG LGKLLIDQLV TIGFDYGCYK IILDCDEKNV KFYEKCGFSN

     151  AGVEMQIRK*

Protein Sequence for YFL017C_T73 from WashU:

YFL017C_T73 [source=WashU]  Length: 160  Fri Dec 15 17:38:07 2017  Type: P  Check: 797  ..

       1  MSLPDGFYIR RMEEGDLEQV TETLKVLTTV GTITPESFSK LIKYWNEATV

      51  WNDNEDKKIM QYNPMVIVDK RTETIAATGN IIIERKIIHE LGLCGHIEDI

     101  AVNSKYQGQG LGKLLIDQLV TIGFDYGCYK IILDCDEKNV KFYEKCGFNN

     151  AGVEMQIRK*

Protein Sequence for YFL017C_UC5 from WashU:

YFL017C_UC5 [source=WashU]  Length: 160  Fri Dec 15 17:38:07 2017  Type: P  Check: 2070  ..

       1  MSLPDGFYIR RMEEGDLEQV TETLKVLTTV GTITPESFSK LIKYWNESTV

      51  WNDNEDKKIM QYNPMVIVDK RTETVAATGN IIIERKIIHE LGLCGHIEDI

     101  AVNSKYQGQG LGKLLIDQLV TIGFDYGCYK IILDCDEKNV KFYEKCGFSN

     151  AGVEMQIRK*

Protein Sequence for YFL017C_UWOPS05_217_3 from Stanford:

YFL017C_UWOPS05_217_3 [source=Stanford]  Length: 101  Fri Dec 15 17:38:07 2017  Type: P  Check: 6468  ..

       1  MQYNPMVIVD KRTETIAATG NIIIERKIIH ELGLCGHIED IAVNSKYQGQ

      51  GLGKLLIDQL VTIGFDYGCY KIILDCDEKN VKFYEKCGFS NAGVEMQIRK

     101  *

Protein Sequence for YFL017C_VL3 from AWRI:

YFL017C_VL3 [source=AWRI]  Length: 160  Fri Dec 15 17:38:07 2017  Type: P  Check: 806  ..

       1  MSLPDGFYIR RMEEGDLEQV TETLKVLTTV GTITPESFSK LIKYWNEATV

      51  WNDNEDKKIM QYNPMVIVDK RTETIAATGN IIIERKIIHE LGLCGHIEDI

     101  AVNSKYQGQG LGKLLIGQLV TIGFDYGCYK IILDCDEKNV KFYEKCGFNN

     151  AGVEMQIRK*

Protein Sequence for YFL017C_Vin13 from AWRI:

YFL017C_Vin13 [source=AWRI]  Length: 149  Fri Dec 15 17:38:07 2017  Type: P  Check: 8300  ..

       1  MSLPDGFYIR RMEEGDLEQV TETLKVLTTV GTITPESFSK LIKYWNEATV

      51  WNDNEDKKIM QYNPMVIVDK RTETIAATGN IIIERKIIHE LGLCGHIEDI

     101  AVNSKYQGQG LGKLLIGQLV TIGFDYGCYK IILDCDEKNV KFYEKMWV*


Protein Sequence for YFL017C_W303 from Stanford:

YFL017C_W303 [source=Stanford]  Length: 160  Fri Dec 15 17:38:07 2017  Type: P  Check: 1206  ..

       1  MSLPDGFYIR RMEEGDLEQV TETLKVLTTV GTITPESFSK LIKYWNEATV

      51  WNDNEDKKIM QYNPMVIVDK RTETVAATGN IIIERKIIHE LGLCGHIEDI

     101  AVNSKYQGQG LGKLLIDQLV TIGFDYGCYK IILDCDEKNV KFYEKCGFSN

     151  AGVEMQIRK*

Protein Sequence for YFL017C_X2180-1A from Stanford:

YFL017C_X2180-1A [source=Stanford]  Length: 160  Fri Dec 15 17:38:07 2017  Type: P  Check: 1206  ..

       1  MSLPDGFYIR RMEEGDLEQV TETLKVLTTV GTITPESFSK LIKYWNEATV

      51  WNDNEDKKIM QYNPMVIVDK RTETVAATGN IIIERKIIHE LGLCGHIEDI

     101  AVNSKYQGQG LGKLLIDQLV TIGFDYGCYK IILDCDEKNV KFYEKCGFSN

     151  AGVEMQIRK*

Protein Sequence for YFL017C_Y10 from WashU:

YFL017C_Y10 [source=WashU]  Length: 160  Fri Dec 15 17:38:07 2017  Type: P  Check: 972  ..

       1  MSLPDGFYIR RMEEGDLEQV TETLKVLTTV GTITPESFSK LIKYWNEATV

      51  WNDNEDKKIM QYNPMVIVDK RTETIAATGN IIIERKIIHE LGLCGHIEDI

     101  AVNSKYQGQG LGKLLIDQLV TIGFDYGCYK IILDCDEKNV KFYEKCGFSN

     151  AGVEMQIRK*

Protein Sequence for YFL017C_Y55 from Stanford:

YFL017C_Y55 [source=Stanford]  Length: 160  Fri Dec 15 17:38:07 2017  Type: P  Check: 1218  ..

       1  MSLPDGFYIR RMEEGDLEQV TETLKVLTTV GTITPESFSK LIKYWNEATV

      51  WNDNEDKKIM QYNPMVIVDK RTETVAATGN IIIERKIIHE LGLCGHIEDI

     101  AVNSKYQGQG LGKLLIHQLV TIGFDYGCYK IILDCDEKNV KFYEKCGFSN

     151  AGVEMQIRK*

Protein Sequence for YFL017C_YJM269 from WashU:

YFL017C_YJM269 [source=WashU]  Length: 160  Fri Dec 15 17:38:07 2017  Type: P  Check: 972  ..

       1  MSLPDGFYIR RMEEGDLEQV TETLKVLTTV GTITPESFSK LIKYWNEATV

      51  WNDNEDKKIM QYNPMVIVDK RTETIAATGN IIIERKIIHE LGLCGHIEDI

     101  AVNSKYQGQG LGKLLIDQLV TIGFDYGCYK IILDCDEKNV KFYEKCGFSN

     151  AGVEMQIRK*

Protein Sequence for YFL017C_YJM339 from Stanford:

YFL017C_YJM339 [source=Stanford]  Length: 160  Fri Dec 15 17:38:07 2017  Type: P  Check: 1206  ..

       1  MSLPDGFYIR RMEEGDLEQV TETLKVLTTV GTITPESFSK LIKYWNEATV

      51  WNDNEDKKIM QYNPMVIVDK RTETVAATGN IIIERKIIHE LGLCGHIEDI

     101  AVNSKYQGQG LGKLLIDQLV TIGFDYGCYK IILDCDEKNV KFYEKCGFSN

     151  AGVEMQIRK*

Protein Sequence for YFL017C_YJM789 from Stanford:

YFL017C_YJM789 [source=Stanford]  Length: 160  Fri Dec 15 17:38:07 2017  Type: P  Check: 972  ..

       1  MSLPDGFYIR RMEEGDLEQV TETLKVLTTV GTITPESFSK LIKYWNEATV

      51  WNDNEDKKIM QYNPMVIVDK RTETIAATGN IIIERKIIHE LGLCGHIEDI

     101  AVNSKYQGQG LGKLLIDQLV TIGFDYGCYK IILDCDEKNV KFYEKCGFSN

     151  AGVEMQIRK*

Protein Sequence for YFL017C_YPH499 from Stanford:

YFL017C_YPH499 [source=Stanford]  Length: 160  Fri Dec 15 17:38:07 2017  Type: P  Check: 1206  ..

       1  MSLPDGFYIR RMEEGDLEQV TETLKVLTTV GTITPESFSK LIKYWNEATV

      51  WNDNEDKKIM QYNPMVIVDK RTETVAATGN IIIERKIIHE LGLCGHIEDI

     101  AVNSKYQGQG LGKLLIDQLV TIGFDYGCYK IILDCDEKNV KFYEKCGFSN

     151  AGVEMQIRK*

Protein Sequence for YFL017C_YPS128 from Stanford:

YFL017C_YPS128 [source=Stanford]  Length: 160  Fri Dec 15 17:38:07 2017  Type: P  Check: 972  ..

       1  MSLPDGFYIR RMEEGDLEQV TETLKVLTTV GTITPESFSK LIKYWNEATV

      51  WNDNEDKKIM QYNPMVIVDK RTETIAATGN IIIERKIIHE LGLCGHIEDI

     101  AVNSKYQGQG LGKLLIDQLV TIGFDYGCYK IILDCDEKNV KFYEKCGFSN

     151  AGVEMQIRK*

Protein Sequence for YFL017C_YPS163 from Stanford:

YFL017C_YPS163 [source=Stanford]  Length: 101  Fri Dec 15 17:38:07 2017  Type: P  Check: 6468  ..

       1  MQYNPMVIVD KRTETIAATG NIIIERKIIH ELGLCGHIED IAVNSKYQGQ

      51  GLGKLLIDQL VTIGFDYGCY KIILDCDEKN VKFYEKCGFS NAGVEMQIRK

     101  *

Protein Sequence for YFL017C_YS9 from Stanford:

YFL017C_YS9 [source=Stanford]  Length: 160  Fri Dec 15 17:38:07 2017  Type: P  Check: 806  ..

       1  MSLPDGFYIR RMEEGDLEQV TETLKVLTTV GTITPESFSK LIKYWNEATV

      51  WNDNEDKKIM QYNPMVIVDK RTETIAATGN IIIERKIIHE LGLCGHIEDI

     101  AVNSKYQGQG LGKLLIGQLV TIGFDYGCYK IILDCDEKNV KFYEKCGFNN

     151  AGVEMQIRK*

Protein Sequence for YFL017C_ZTW1 from Zhejiang:

YFL017C_ZTW1 [source=Zhejiang]  Length: 160  Fri Dec 15 17:38:07 2017  Type: P  Check: 1206  ..

       1  MSLPDGFYIR RMEEGDLEQV TETLKVLTTV GTITPESFSK LIKYWNEATV

      51  WNDNEDKKIM QYNPMVIVDK RTETVAATGN IIIERKIIHE LGLCGHIEDI

     101  AVNSKYQGQG LGKLLIDQLV TIGFDYGCYK IILDCDEKNV KFYEKCGFSN

     151  AGVEMQIRK*