MDJ1/YFL016C S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YFL016C_S288C   1   MAFQQGVLSRCSGVFRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_AWRI796   1   MAFQQGVLSRCSGVLRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_BC187   1   MAFQQGVLSRCSGVLRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_BY4741   1   MAFQQGVLSRCSGVFRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_BY4742   1   MAFQQGVLSRCSGVFRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_CBS7960   1   MAFQQGVLSRCSGVLRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_CEN.PK   1   MAFQQGVLSRCSGVFRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_CLIB215   1   MAFQQGVLSRCSGVLRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_D273-10B   1   MAFQQGVLSRCSGVLRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_DBVPG6044   1   MAFQQGVLSRCSGVLRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_EC1118   1   MAFQQGVLSRCSGVLRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_EC9-8   1   MAFQQGVLSRCSGVLRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_FL100   1   MAFQQGVLSRCSGVLRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_FY1679   1   MAFQQGVLSRCSGVFRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_FostersB   1   MAFQQGVLSRCSGVLRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_FostersO   1   MAFQQGVLSRCSGVLRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_JAY291   1   MAFQQGVLSRCSGVLRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_JK9-3d   1   MAFQQGVLSRCSGVLRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_K11   1   MAFQQGVLSRCSGVFRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_Kyokai7   1   MAFQQGVLSRCSGVLRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_L1528   1   MAFQQGVLSRCSGVLRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_LalvinQA23   
   --------------------------------------------------   
YFL016C_PW5   1   MAFQQGVLSRCSGVLRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_RM11-1a   1   MAFQQGVLSRCSGVLRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_RedStar   1   MAFQQGVLSRCSGVLRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_SEY6210   1   MAFQQGVLSRCSGVFRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_SK1   1   MAFQQGVLSRCSGVLRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_T7   1   MAFQQGVLSRCSGVLRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHA   50
YFL016C_T73   1   MAFQQGVLSRCSGVLRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_UC5   1   MAFQQGVLSRCSGVLRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_VL3   1   MAFQQGVLSRCSGVLRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_Vin13   1   MAFQQGVLSRCSGVLRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_W303   1   MAFQQGVLSRCSGVFRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_X2180-1A   1   MAFQQGVLSRCSGVFRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_Y55   1   MAFQQGVLSRCSGVLRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_YJM269   1   MAFQQGVLSRCSGVLRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_YJM339   1   MAFQQGVLSRCSGVFRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_YJM789   1   MAFQQGVLSRCSGVLRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_YPH499   1   MAFQQGVLSRCSGVFRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_YPS128   1   MAFQQGVLSRCSGVLRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_YPS163   1   MAFQQGVLSRCSGVLRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_YS9   1   MAFQQGVLSRCSGVLRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
YFL016C_ZTW1   1   MAFQQGVLSRCSGVFRHHVGHSRHINNILYRHAIAFASIAPRIPKSSFHT   50
         

YFL016C_S288C   51   SAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_AWRI796   51   SAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_BC187   51   SAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_BY4741   51   SAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_BY4742   51   SAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_CBS7960   51   SAISKNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_CEN.PK   51   SAIRNSEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_CLIB215   51   SAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_D273-10B   51   SAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_DBVPG6044   51   SAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_EC1118   51   SAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_EC9-8   51   SAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_FL100   51   SAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_FY1679   51   SAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_FostersB   51   SXIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_FostersO   51   SAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_JAY291   51   SAISKNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_JK9-3d   51   SAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_K11   51   SAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_Kyokai7   51   SAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_L1528   51   SAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_LalvinQA23   1   ----------------------------------------------MLRK   4
YFL016C_PW5   51   SAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_RM11-1a   51   SAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_RedStar   51   SAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_SEY6210   51   SAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_SK1   51   SAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_T7   51   SAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_T73   51   SAISKNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_UC5   51   SAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_VL3   51   SAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_Vin13   51   SAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_W303   51   SAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_X2180-1A   51   SAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_Y55   51   SAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_YJM269   51   SAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_YJM339   51   SAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_YJM789   51   SAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_YPH499   51   SAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_YPS128   51   SAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_YPS163   51   SAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_YS9   51   SAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
YFL016C_ZTW1   51   SAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPDINKEPDAEK   100
         

YFL016C_S288C   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGAGGGSGSPFGSQF   150
YFL016C_AWRI796   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGASGGSGSPFGSQF   150
YFL016C_BC187   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGASGGSGSPFGSQF   150
YFL016C_BY4741   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGAGGGSGSPFGSQF   150
YFL016C_BY4742   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGAGGGSGSPFGSQF   150
YFL016C_CBS7960   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGASGGSGSPFGSQF   150
YFL016C_CEN.PK   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGAGGGSGSPFGSQF   150
YFL016C_CLIB215   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGASGGSGSPFGSQF   150
YFL016C_D273-10B   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGASGGSGSPFGSQF   150
YFL016C_DBVPG6044   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGAGGGSGSPFGSQF   150
YFL016C_EC1118   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGASGGSGSPFGSQF   150
YFL016C_EC9-8   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGAGGGSGSPFGSQF   150
YFL016C_FL100   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGASGGSGSPFGSQF   150
YFL016C_FY1679   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGAGGGSGSPFGSQF   150
YFL016C_FostersB   101   KXHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGASGGSGSPFGSQF   150
YFL016C_FostersO   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGASGGSGSPFGSQF   150
YFL016C_JAY291   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGASGGSGSPFGSQF   150
YFL016C_JK9-3d   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGASGGSGSPFGSQF   150
YFL016C_K11   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGAGGGSGSPFGSQF   150
YFL016C_Kyokai7   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGAGGGSGSPFGSQF   150
YFL016C_L1528   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGASGGSGSPFGSQF   150
YFL016C_LalvinQA23   5   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGASGGSGSPFGSQF   54
YFL016C_PW5   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGAGGGSGSPFGSQF   150
YFL016C_RM11-1a   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGASGGSGSPFGSQF   150
YFL016C_RedStar   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGAGGGSGSPFGSQF   150
YFL016C_SEY6210   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGAGGGSGSPFGSQF   150
YFL016C_SK1   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGAGGGSGSPFGSQF   150
YFL016C_T7   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGAGGGSGSPFGSQF   150
YFL016C_T73   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGASGGSGSPFGSQF   150
YFL016C_UC5   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGAGGGSGSPFGSQF   150
YFL016C_VL3   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGASGGSGSPFGSQF   150
YFL016C_Vin13   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGASGGSGSPFGSQF   150
YFL016C_W303   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGAGGGSGSPFGSQF   150
YFL016C_X2180-1A   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGAGGGSGSPFGSQF   150
YFL016C_Y55   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGAGGGSGSPFGSQF   150
YFL016C_YJM269   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGAGGGSGSPFGSQF   150
YFL016C_YJM339   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGAGGGSGSPFGSQF   150
YFL016C_YJM789   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGAGGGSGSPFGSQF   150
YFL016C_YPH499   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGAGGGSGSPFGSQF   150
YFL016C_YPS128   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGAGGGSGSPFGSQF   150
YFL016C_YPS163   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGAGGGSGSPFGSQF   150
YFL016C_YS9   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGASGGSGSPFGSQF   150
YFL016C_ZTW1   101   KFHDLQNAYEILSDETKRQQYDQFGPAAFGGGGAAGGAGGGSGSPFGSQF   150
         

YFL016C_S288C   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_AWRI796   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_BC187   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_BY4741   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_BY4742   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_CBS7960   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_CEN.PK   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_CLIB215   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_D273-10B   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_DBVPG6044   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_EC1118   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_EC9-8   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_FL100   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_FY1679   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_FostersB   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_FostersO   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_JAY291   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_JK9-3d   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_K11   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_Kyokai7   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_L1528   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGN   200
YFL016C_LalvinQA23   55   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   104
YFL016C_PW5   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_RM11-1a   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_RedStar   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_SEY6210   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_SK1   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_T7   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_T73   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_UC5   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_VL3   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_Vin13   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_W303   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_X2180-1A   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_Y55   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_YJM269   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_YJM339   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_YJM789   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_YPH499   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_YPS128   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_YPS163   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_YS9   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
YFL016C_ZTW1   151   HDFSGFTSAGGSPFGGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGD   200
         

YFL016C_S288C   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_AWRI796   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_BC187   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_BY4741   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_BY4742   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_CBS7960   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_CEN.PK   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_CLIB215   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_D273-10B   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_DBVPG6044   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_EC1118   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_EC9-8   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_FL100   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_FY1679   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_FostersB   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_FostersO   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_JAY291   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_JK9-3d   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_K11   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_Kyokai7   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_L1528   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_LalvinQA23   105   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   154
YFL016C_PW5   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_RM11-1a   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_RedStar   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_SEY6210   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_SK1   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_T7   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_T73   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_UC5   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_VL3   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_Vin13   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_W303   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_X2180-1A   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_Y55   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_YJM269   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_YJM339   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_YJM789   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_YPH499   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_YPS128   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_YPS163   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_YS9   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
YFL016C_ZTW1   201   PIEIVHKVSFKDAVFGSKNVQLRFSALDPCSTCSGTGMKPNTHKVSCSTC   250
         

YFL016C_S288C   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_AWRI796   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_BC187   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_BY4741   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_BY4742   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_CBS7960   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_CEN.PK   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_CLIB215   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_D273-10B   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_DBVPG6044   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_EC1118   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_EC9-8   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_FL100   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_FY1679   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_FostersB   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_FostersO   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_JAY291   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_JK9-3d   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_K11   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_Kyokai7   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_L1528   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_LalvinQA23   155   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   204
YFL016C_PW5   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_RM11-1a   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_RedStar   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_SEY6210   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_SK1   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_T7   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_T73   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_UC5   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_VL3   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_Vin13   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_W303   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_X2180-1A   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_Y55   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_YJM269   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_YJM339   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_YJM789   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_YPH499   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_YPS128   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_YPS163   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_YS9   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
YFL016C_ZTW1   251   HGTGTTVHIRGGFQMMSTCPTCNGEGTMKRPQDNCTKCHGEGVQVNRAKT   300
         

YFL016C_S288C   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_AWRI796   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_BC187   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_BY4741   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_BY4742   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_CBS7960   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_CEN.PK   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_CLIB215   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_D273-10B   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_DBVPG6044   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_EC1118   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_EC9-8   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_FL100   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_FY1679   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_FostersB   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_FostersO   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_JAY291   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_JK9-3d   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_K11   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_Kyokai7   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_L1528   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_LalvinQA23   205   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   254
YFL016C_PW5   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_RM11-1a   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_RedStar   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_SEY6210   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_SK1   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_T7   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_T73   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_UC5   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_VL3   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_Vin13   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_W303   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_X2180-1A   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_Y55   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_YJM269   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_YJM339   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_YJM789   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_YPH499   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_YPS128   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_YPS163   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_YS9   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
YFL016C_ZTW1   301   ITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLKDSVKLSRGDILVRIRVD   350
         

YFL016C_S288C   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_AWRI796   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_BC187   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_BY4741   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_BY4742   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_CBS7960   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_CEN.PK   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_CLIB215   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_D273-10B   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_DBVPG6044   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_EC1118   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_EC9-8   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_FL100   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_FY1679   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_FostersB   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_FostersO   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_JAY291   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_JK9-3d   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_K11   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_Kyokai7   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_L1528   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_LalvinQA23   255   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   304
YFL016C_PW5   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_RM11-1a   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_RedStar   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_SEY6210   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_SK1   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_T7   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_T73   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_UC5   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_VL3   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_Vin13   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_W303   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_X2180-1A   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_Y55   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_YJM269   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_YJM339   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_YJM789   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_YPH499   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_YPS128   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_YPS163   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_YS9   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
YFL016C_ZTW1   351   KDPNFSIKNKYDIWYDKEIPITTAALGGTVTIPTVEGQKIRIKVAPGTQY   400
         

YFL016C_S288C   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_AWRI796   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_BC187   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_BY4741   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_BY4742   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_CBS7960   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_CEN.PK   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_CLIB215   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_D273-10B   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_DBVPG6044   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_EC1118   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_EC9-8   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_FL100   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_FY1679   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_FostersB   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_FostersO   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_JAY291   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_JK9-3d   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_K11   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_Kyokai7   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_L1528   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_LalvinQA23   305   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   354
YFL016C_PW5   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_RM11-1a   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_RedStar   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_SEY6210   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_SK1   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_T7   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_T73   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_UC5   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_VL3   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_Vin13   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_W303   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_X2180-1A   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_Y55   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_YJM269   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_YJM339   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_YJM789   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_YPH499   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_YPS128   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_YPS163   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_YS9   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
YFL016C_ZTW1   401   NQVISIPNMGVPKTSTIRGDMKVQYKIVVKKPQSLAEKCLWEALADVTND   450
         

YFL016C_S288C   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
YFL016C_AWRI796   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
YFL016C_BC187   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
YFL016C_BY4741   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
YFL016C_BY4742   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
YFL016C_CBS7960   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
YFL016C_CEN.PK   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
YFL016C_CLIB215   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
YFL016C_D273-10B   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
YFL016C_DBVPG6044   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
YFL016C_EC1118   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
YFL016C_EC9-8   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
YFL016C_FL100   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
YFL016C_FY1679   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
YFL016C_FostersB   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
YFL016C_FostersO   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
YFL016C_JAY291   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLRRLENFITN   500
YFL016C_JK9-3d   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
YFL016C_K11   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
YFL016C_Kyokai7   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
YFL016C_L1528   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
YFL016C_LalvinQA23   355   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   404
YFL016C_PW5   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
YFL016C_RM11-1a   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
YFL016C_RedStar   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
YFL016C_SEY6210   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
YFL016C_SK1   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
YFL016C_T7   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
YFL016C_T73   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKRDDDNTLKRLENFITN   500
YFL016C_UC5   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
YFL016C_VL3   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
YFL016C_Vin13   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
YFL016C_W303   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
YFL016C_X2180-1A   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
YFL016C_Y55   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
YFL016C_YJM269   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
YFL016C_YJM339   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
YFL016C_YJM789   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
YFL016C_YPH499   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
YFL016C_YPS128   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
YFL016C_YPS163   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
YFL016C_YS9   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
YFL016C_ZTW1   451   DMAKKTMQPGTAAGTAINEEILKKQKQEEEKHAKKDDDNTLKRLENFITN   500
         

YFL016C_S288C   501   TFRKIKGDKKN------------   511
YFL016C_AWRI796   501   TFRKIKGDKKKLNFMQFLVDKEK   523
YFL016C_BC187   501   TFRKIKGDKKN------------   511
YFL016C_BY4741   501   TFRKIKGDKKN------------   511
YFL016C_BY4742   501   TFRKIKGDKKN------------   511
YFL016C_CBS7960   501   TFRKIKGDKKN------------   511
YFL016C_CEN.PK   501   TFRKIKGDKKN------------   511
YFL016C_CLIB215   501   TFRKIKGDKKN------------   511
YFL016C_D273-10B   501   TFRKIKGDKKN------------   511
YFL016C_DBVPG6044   501   TFRKIKGDKKN------------   511
YFL016C_EC1118   501   TFRKIKGDKKN------------   511
YFL016C_EC9-8   501   TFRKIKGDKKN------------   511
YFL016C_FL100   501   TFRKIKGDKKN------------   511
YFL016C_FY1679   501   TFRKIKGDKKN------------   511
YFL016C_FostersB   501   TFRKIKGDKKN------------   511
YFL016C_FostersO   501   TFRKIKGDKKN------------   511
YFL016C_JAY291   501   TFRKIKGDKKN------------   511
YFL016C_JK9-3d   501   TFRKIKGDKKN------------   511
YFL016C_K11   501   TFRKIKGDKKN------------   511
YFL016C_Kyokai7   501   TFRKIKGDKKN------------   511
YFL016C_L1528   501   TFRKIKGDKKN------------   511
YFL016C_LalvinQA23   405   TFRKIKGDKKN------------   415
YFL016C_PW5   501   TFRKIKGDKKKLNFMQFLVDKEK   523
YFL016C_RM11-1a   501   TFRKIKGDKKN------------   511
YFL016C_RedStar   501   TFRKIKGDKKN------------   511
YFL016C_SEY6210   501   TFRKIKGDKKN------------   511
YFL016C_SK1   501   TFRKIKGDKKN------------   511
YFL016C_T7   501   TFRKIKGDKKN------------   511
YFL016C_T73   501   TFRKIKGDKKN------------   511
YFL016C_UC5   501   TFRKIKGDKKN------------   511
YFL016C_VL3   501   TFRKIKGDKKN------------   511
YFL016C_Vin13   501   TFRKIKGDKKN------------   511
YFL016C_W303   501   TFRKIKGDKKN------------   511
YFL016C_X2180-1A   501   TFRKIKGDKKN------------   511
YFL016C_Y55   501   TFRKIKGDKKN------------   511
YFL016C_YJM269   501   TFRKIKGDKKN------------   511
YFL016C_YJM339   501   TFRKIKGDKKN------------   511
YFL016C_YJM789   501   TFRKIKGDKKN------------   511
YFL016C_YPH499   501   TFRKIKGDKKN------------   511
YFL016C_YPS128   501   TFRKIKGDKKN------------   511
YFL016C_YPS163   501   TFRKIKGDKKN------------   511
YFL016C_YS9   501   TFRKIKGDKKN------------   511
YFL016C_ZTW1   501   TFRKIKGDKKN------------   511
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YFL016C_S288C from SGD:

YFL016C_S288C [source=SGD]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 6905  ..

       1  MAFQQGVLSR CSGVFRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAIRNNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGAGG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK N*

Protein Sequence for YFL016C_AWRI796 from AWRI:

YFL016C_AWRI796 [source=AWRI]  Length: 524  Sun Sep 24 01:53:09 2017  Type: P  Check: 8032  ..

       1  MAFQQGVLSR CSGVLRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAIRNNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGASG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK KLNFMQFLVD KEK*

Protein Sequence for YFL016C_BC187 from Stanford:

YFL016C_BC187 [source=Stanford]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 7295  ..

       1  MAFQQGVLSR CSGVLRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAIRNNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGASG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK N*

Protein Sequence for YFL016C_BY4741 from Stanford:

YFL016C_BY4741 [source=Stanford]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 6905  ..

       1  MAFQQGVLSR CSGVFRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAIRNNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGAGG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK N*

Protein Sequence for YFL016C_BY4742 from Stanford:

YFL016C_BY4742 [source=Stanford]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 6905  ..

       1  MAFQQGVLSR CSGVFRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAIRNNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGAGG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK N*

Protein Sequence for YFL016C_CBS7960 from WashU:

YFL016C_CBS7960 [source=WashU]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 7184  ..

       1  MAFQQGVLSR CSGVLRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAISKNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGASG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK N*

Protein Sequence for YFL016C_CEN.PK from Stanford:

YFL016C_CEN.PK [source=Stanford]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 7185  ..

       1  MAFQQGVLSR CSGVFRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAIRNSEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGAGG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK N*

Protein Sequence for YFL016C_CLIB215 from WashU:

YFL016C_CLIB215 [source=WashU]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 7295  ..

       1  MAFQQGVLSR CSGVLRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAIRNNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGASG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK N*

Protein Sequence for YFL016C_D273-10B from Stanford:

YFL016C_D273-10B [source=Stanford]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 7295  ..

       1  MAFQQGVLSR CSGVLRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAIRNNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGASG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK N*

Protein Sequence for YFL016C_DBVPG6044 from Stanford:

YFL016C_DBVPG6044 [source=Stanford]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 6995  ..

       1  MAFQQGVLSR CSGVLRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAIRNNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGAGG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK N*

Protein Sequence for YFL016C_EC1118 from Genoscope:

YFL016C_EC1118 [source=Genoscope]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 7295  ..

       1  MAFQQGVLSR CSGVLRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAIRNNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGASG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK N*

Protein Sequence for YFL016C_EC9-8 from ASinica:

YFL016C_EC9-8 [source=ASinica]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 6995  ..

       1  MAFQQGVLSR CSGVLRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAIRNNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGAGG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK N*

Protein Sequence for YFL016C_FL100 from Stanford:

YFL016C_FL100 [source=Stanford]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 7295  ..

       1  MAFQQGVLSR CSGVLRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAIRNNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGASG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK N*

Protein Sequence for YFL016C_FY1679 from Stanford:

YFL016C_FY1679 [source=Stanford]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 6905  ..

       1  MAFQQGVLSR CSGVFRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAIRNNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGAGG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK N*

Protein Sequence for YFL016C_FostersB from AWRI:

YFL016C_FostersB [source=AWRI]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 9301  ..

       1  MAFQQGVLSR CSGVLRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SXIRNNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KXHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGASG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK N*

Protein Sequence for YFL016C_FostersO from AWRI:

YFL016C_FostersO [source=AWRI]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 7295  ..

       1  MAFQQGVLSR CSGVLRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAIRNNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGASG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK N*

Protein Sequence for YFL016C_JAY291 from Duke:

YFL016C_JAY291 [source=Duke]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 7436  ..

       1  MAFQQGVLSR CSGVLRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAISKNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGASG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LRRLENFITN

     501  TFRKIKGDKK N*

Protein Sequence for YFL016C_JK9-3d from Stanford:

YFL016C_JK9-3d [source=Stanford]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 7295  ..

       1  MAFQQGVLSR CSGVLRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAIRNNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGASG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK N*

Protein Sequence for YFL016C_K11 from Stanford:

YFL016C_K11 [source=Stanford]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 6905  ..

       1  MAFQQGVLSR CSGVFRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAIRNNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGAGG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK N*

Protein Sequence for YFL016C_Kyokai7 from NRIB:

YFL016C_Kyokai7 [source=NRIB]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 6995  ..

       1  MAFQQGVLSR CSGVLRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAIRNNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGAGG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK N*

Protein Sequence for YFL016C_L1528 from Stanford:

YFL016C_L1528 [source=Stanford]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 7585  ..

       1  MAFQQGVLSR CSGVLRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAIRNNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGASG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGN

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK N*

Protein Sequence for YFL016C_LalvinQA23 from AWRI:

YFL016C_LalvinQA23 [source=AWRI]  Length: 416  Sun Sep 24 01:53:09 2017  Type: P  Check: 554  ..

       1  MLRKKFHDLQ NAYEILSDET KRQQYDQFGP AAFGGGGAAG GASGGSGSPF

      51  GSQFHDFSGF TSAGGSPFGG INFEDLFGAA FGGGGRGSGG ASRSSSMFRQ

     101  YRGDPIEIVH KVSFKDAVFG SKNVQLRFSA LDPCSTCSGT GMKPNTHKVS

     151  CSTCHGTGTT VHIRGGFQMM STCPTCNGEG TMKRPQDNCT KCHGEGVQVN

     201  RAKTITVDLP HGLQDGDVVR IPGQGSYPDI AVEADLKDSV KLSRGDILVR

     251  IRVDKDPNFS IKNKYDIWYD KEIPITTAAL GGTVTIPTVE GQKIRIKVAP

     301  GTQYNQVISI PNMGVPKTST IRGDMKVQYK IVVKKPQSLA EKCLWEALAD

     351  VTNDDMAKKT MQPGTAAGTA INEEILKKQK QEEEKHAKKD DDNTLKRLEN

     401  FITNTFRKIK GDKKN*

Protein Sequence for YFL016C_PW5 from WashU:

YFL016C_PW5 [source=WashU]  Length: 524  Sun Sep 24 01:53:09 2017  Type: P  Check: 7732  ..

       1  MAFQQGVLSR CSGVLRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAIRNNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGAGG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK KLNFMQFLVD KEK*

Protein Sequence for YFL016C_RM11-1a from Stanford:

YFL016C_RM11-1a [source=Stanford]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 7295  ..

       1  MAFQQGVLSR CSGVLRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAIRNNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGASG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK N*

Protein Sequence for YFL016C_RedStar from Stanford:

YFL016C_RedStar [source=Stanford]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 6995  ..

       1  MAFQQGVLSR CSGVLRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAIRNNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGAGG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK N*

Protein Sequence for YFL016C_SEY6210 from Stanford:

YFL016C_SEY6210 [source=Stanford]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 6905  ..

       1  MAFQQGVLSR CSGVFRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAIRNNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGAGG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK N*

Protein Sequence for YFL016C_SK1 from Stanford:

YFL016C_SK1 [source=Stanford]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 6995  ..

       1  MAFQQGVLSR CSGVLRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAIRNNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGAGG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK N*

Protein Sequence for YFL016C_T7 from WashU:

YFL016C_T7 [source=WashU]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 6045  ..

       1  MAFQQGVLSR CSGVLRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHA

      51  SAIRNNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGAGG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK N*

Protein Sequence for YFL016C_T73 from WashU:

YFL016C_T73 [source=WashU]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 7387  ..

       1  MAFQQGVLSR CSGVLRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAISKNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGASG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKRDDDNT LKRLENFITN

     501  TFRKIKGDKK N*

Protein Sequence for YFL016C_UC5 from WashU:

YFL016C_UC5 [source=WashU]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 6995  ..

       1  MAFQQGVLSR CSGVLRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAIRNNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGAGG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK N*

Protein Sequence for YFL016C_VL3 from AWRI:

YFL016C_VL3 [source=AWRI]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 7295  ..

       1  MAFQQGVLSR CSGVLRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAIRNNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGASG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK N*

Protein Sequence for YFL016C_Vin13 from AWRI:

YFL016C_Vin13 [source=AWRI]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 7295  ..

       1  MAFQQGVLSR CSGVLRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAIRNNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGASG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK N*

Protein Sequence for YFL016C_W303 from Stanford:

YFL016C_W303 [source=Stanford]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 6905  ..

       1  MAFQQGVLSR CSGVFRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAIRNNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGAGG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK N*

Protein Sequence for YFL016C_X2180-1A from Stanford:

YFL016C_X2180-1A [source=Stanford]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 6905  ..

       1  MAFQQGVLSR CSGVFRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAIRNNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGAGG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK N*

Protein Sequence for YFL016C_Y55 from Stanford:

YFL016C_Y55 [source=Stanford]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 6995  ..

       1  MAFQQGVLSR CSGVLRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAIRNNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGAGG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK N*

Protein Sequence for YFL016C_YJM269 from WashU:

YFL016C_YJM269 [source=WashU]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 6995  ..

       1  MAFQQGVLSR CSGVLRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAIRNNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGAGG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK N*

Protein Sequence for YFL016C_YJM339 from Stanford:

YFL016C_YJM339 [source=Stanford]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 6905  ..

       1  MAFQQGVLSR CSGVFRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAIRNNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGAGG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK N*

Protein Sequence for YFL016C_YJM789 from Stanford:

YFL016C_YJM789 [source=Stanford]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 6995  ..

       1  MAFQQGVLSR CSGVLRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAIRNNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGAGG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK N*

Protein Sequence for YFL016C_YPH499 from Stanford:

YFL016C_YPH499 [source=Stanford]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 6905  ..

       1  MAFQQGVLSR CSGVFRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAIRNNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGAGG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK N*

Protein Sequence for YFL016C_YPS128 from Stanford:

YFL016C_YPS128 [source=Stanford]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 6995  ..

       1  MAFQQGVLSR CSGVLRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAIRNNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGAGG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK N*

Protein Sequence for YFL016C_YPS163 from Stanford:

YFL016C_YPS163 [source=Stanford]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 6995  ..

       1  MAFQQGVLSR CSGVLRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAIRNNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGAGG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK N*

Protein Sequence for YFL016C_YS9 from Stanford:

YFL016C_YS9 [source=Stanford]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 7295  ..

       1  MAFQQGVLSR CSGVLRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAIRNNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGASG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK N*

Protein Sequence for YFL016C_ZTW1 from Zhejiang:

YFL016C_ZTW1 [source=Zhejiang]  Length: 512  Sun Sep 24 01:53:09 2017  Type: P  Check: 6905  ..

       1  MAFQQGVLSR CSGVFRHHVG HSRHINNILY RHAIAFASIA PRIPKSSFHT

      51  SAIRNNEAFK DPYDTLGLKK SATGAEIKKA YYKLAKKYHP DINKEPDAEK

     101  KFHDLQNAYE ILSDETKRQQ YDQFGPAAFG GGGAAGGAGG GSGSPFGSQF

     151  HDFSGFTSAG GSPFGGINFE DLFGAAFGGG GRGSGGASRS SSMFRQYRGD

     201  PIEIVHKVSF KDAVFGSKNV QLRFSALDPC STCSGTGMKP NTHKVSCSTC

     251  HGTGTTVHIR GGFQMMSTCP TCNGEGTMKR PQDNCTKCHG EGVQVNRAKT

     301  ITVDLPHGLQ DGDVVRIPGQ GSYPDIAVEA DLKDSVKLSR GDILVRIRVD

     351  KDPNFSIKNK YDIWYDKEIP ITTAALGGTV TIPTVEGQKI RIKVAPGTQY

     401  NQVISIPNMG VPKTSTIRGD MKVQYKIVVK KPQSLAEKCL WEALADVTND

     451  DMAKKTMQPG TAAGTAINEE ILKKQKQEEE KHAKKDDDNT LKRLENFITN

     501  TFRKIKGDKK N*