YER165C-A S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YER165C-A_S288C   1   MIVIFCVIVKCEFFCIFTFIFGCFIIEADLWP-AVFVACCTIIKMGRCNM   49
YER165C-A_AWRI1631   1   MIVIFCVIVKCEFFCIFTFIFGCFIIEADLWP-AVFVACCTIIKMGRCNM   49
YER165C-A_AWRI796   1   MIVIFCVIVKCEFFCIFTFIFGCFIIEADLWP-AVFVACCTIIKMGRCNM   49
YER165C-A_CBS7960   1   MIVIFCVIVKCEFFCIFTFIFGCFIIEADPWP-AVFVACCTIIKMGRCNM   49
YER165C-A_CLIB215   1   MIVIFCVIVKCEFFCIFTFIFGCFIIEADLWP-AVFVACCTIIKMGRCNM   49
YER165C-A_CLIB324   1   MIVIFCVIVKGKFFCIFTFIFGCSSLETDLWAGCNCLLGCTLHQNWEGAK   50
YER165C-A_CLIB382   1   MIVIFCVIVKCEFFCIFTFIFGCFIIEADLWP-AVFVACCTIIKMGRCNM   49
YER165C-A_EC1118   1   MIVIFCVIVKCEFFCIFTFIFGCFIIEADLWP-AVFVACCTIIKMGRCNM   49
YER165C-A_EC9-8   1   MIVIFCVIVKCEFFCIFTFIFGCFIIEADLWP-AVFVACCTVIKMGRCNM   49
YER165C-A_FostersB   1   MIVIFCVIVKCEFFCIFTFIFGCFIIEADLWP-AVFVACCTIIKMGRCNM   49
YER165C-A_FostersO   1   --------------------------------------------MGRCNM   6
YER165C-A_JAY291   1   MIVIFCVIVKCEFFCIFTFIFGCFIIEADPWP-AVFVACCTIIKMGRCNM   49
YER165C-A_Kyokai7   1   MIVIFCVIVKCEFFCIFTFIFGCFIIEADLWP-AVFVACCTIIKMGRCNM   49
YER165C-A_LalvinQA23   1   MIVIFCVIVKCEFFCIFTFIFGCFIIEADLWP-AVFVACCTIIKMGRCNM   49
YER165C-A_M22   1   MIVIFCVIVKCEFFCIFTFIFGCFIIEADLWP-AVFVACCTIIKMGRCNM   49
YER165C-A_PW5   1   MIVIFCVIVKCEFFCIFTFIFGCFIIEADLWP-AVFVACCTVIKMGRCNM   49
YER165C-A_T7   1   MIVIFCVIVKCEFFCIFTFIFGCFIIEADLWP-AVFVACCTIIKMGRCNM   49
YER165C-A_UC5   1   MIVIFCVIVKCEFFCIFTFIFGCFIIEADLWP-AVFVACCTIIKMGRCNM   49
YER165C-A_VL3   1   MIVIFCVIVKCEFFCIFTFIFGCFIIEADLWP-AVFVACCTIIKMGRCNM   49
YER165C-A_Vin13   1   MIVIFCVIVKCEFFCIFTFIFGCFIIEADLWP-AVFVACCTIIKMGRCNM   49
YER165C-A_Y10   1   MIVIFCVIVKCEFFCIFTFIFGCFIIEADLWP-AVFVACCTIIKMGRCNM   49
YER165C-A_YJM269   1   MIVIFCVIVKCEFFCIFTFIFGCFIIEADLWP-AVFVACCTIIKMGRCNM   49
YER165C-A_YJM789   1   MIVIFCVIVKCEFFCIFTFIFGCFIIEADLWP-AVFVACCTIIKMGRCNM   49
YER165C-A_ZTW1   1   MIVIFCVIVKCEFFCIFTFIFGCFIIEADLWP-AVFVACCTIIKMGRCNM   49
         

YER165C-A_S288C   50   CIFITAIIFKLKCIFKGRHGSMPIAMKSSRHNYQLTFLFKVNCVFISLPG   99
YER165C-A_AWRI1631   50   CIFITAIIFKLKCIFKGRHGSMPIAMKSSRHNYQLTFLFKVNCVFISLPG   99
YER165C-A_AWRI796   50   CIFITAIIFKLKCIFKGRHGSMPIAMKSSRHNYQLTFLFKVNCVFISLPG   99
YER165C-A_CBS7960   50   CIFITAIIFKLKCIFKGRHGSMPIAMKSSRHNYQLTFLFKVNCVFISLPG   99
YER165C-A_CLIB215   50   CIFITAIIFKLKCIFKGRHGSMPIAMKSSRHNYQLTFLFKVNCVFISLPG   99
YER165C-A_CLIB324   51   CRLYLLLVAPSSKWVGAICVSSLLLLSSH---------------------   79
YER165C-A_CLIB382   50   CIFITAIIFKLKCIFKGRHGSMPIAMKSSRHNYQLTFLFKVNCVFISLPG   99
YER165C-A_EC1118   50   CIFITAIIFKLKCIFKGRHGSMPIAMKSSRHNYQLTFLFKVNCVFISLPG   99
YER165C-A_EC9-8   50   CIFITAIIFKLKCIFKGRHGSMPIAMKSSRHNYQLTLLFKVNCVFISLPG   99
YER165C-A_FostersB   50   CIFITAIIFKLKCIFKGRHGSMPIAMKSSRHNYQLTFLFKVNCVFISLPG   99
YER165C-A_FostersO   7   CIFITAIIFKLKCIFKGRHGSMPIAMKSSRHNYQLTFLFKVNCVFISLPG   56
YER165C-A_JAY291   50   CIFITAIIFKLKCIFKGRHGSMPIAMKSSRHNYQLTFLFKVNCVFISLPG   99
YER165C-A_Kyokai7   50   CIFITAIIFKLKCIFKGRHGSMPIAMKSSRHNYQLTFLFKVNCVFISLPG   99
YER165C-A_LalvinQA23   50   CIFITAIIFKLKCIFKGRHGSMPIAMKSSRHNYQLTFLFKVNCVFISLPG   99
YER165C-A_M22   50   CIFITAIIFKLKCIFKGRHGSMPIAMKSSRHNYQLTFLFKVNCVFISLPG   99
YER165C-A_PW5   50   CIFITAIIFKLKCIFKGRHGSMPIAMKSSRHNYQLTFLFKVNCVFISLPG   99
YER165C-A_T7   50   CIFITAIIFKLKCIFKGRHGSMPIAMKSSRHNYQLTFLFKVNCVFISLPG   99
YER165C-A_UC5   50   CIFITAIIFKLKCIFKGRHGSMPIAMKSSRHNYQLTFLFKVNCVFISLPG   99
YER165C-A_VL3   50   CIFITAIIFKLKCIFKGRHGSMPIAMKSSRHNYQLTFLFKVNCVFISLPG   99
YER165C-A_Vin13   50   CIFITAIIFKLKCIFKGRHXSMPIAMKSSRHNYQLTFLFKVNCVFISLPG   99
YER165C-A_Y10   50   CIFITAIIFKLKCIFKGRHGSMPIAMKSSRHNYQLTFLFKDNCVFISLPG   99
YER165C-A_YJM269   50   CIFITAIIFKLKCIFKGRHGSMPIAMKSSRHNYQLTFLFKDNCVFISLPG   99
YER165C-A_YJM789   50   CIFITAIIFKLKCIFKGRHGSMPIAMKSSRHNYQLTFLFKVNCVFISLPG   99
YER165C-A_ZTW1   50   CIFITAIIFKLKCIFKGRHGSMPIAMKSSRHNYQLTFLFKVNCVFISLPG   99
         

YER165C-A_S288C   100   GNKGFLLRLLSLAQPPVNF   118
YER165C-A_AWRI1631   100   GNKGFLLRLLSLAQPPVNF   118
YER165C-A_AWRI796   100   GNKGFLLRLLSLAQPPVNF   118
YER165C-A_CBS7960   100   GNKGFLLRLLSLAQPPVNF   118
YER165C-A_CLIB215   100   GNKGFLLRLLSLAQPPVNF   118
YER165C-A_CLIB324   
   -------------------   
YER165C-A_CLIB382   100   GNKGFLLRLLSLAQPPVNF   118
YER165C-A_EC1118   100   GNKGFLLRLLSLAQPPVNF   118
YER165C-A_EC9-8   100   GNKGFLLPLLSLAQPPVNF   118
YER165C-A_FostersB   100   GNKGFLLRLLSLAQPPVNF   118
YER165C-A_FostersO   57   GNKGFLLRLLSLAQPPVNF   75
YER165C-A_JAY291   100   GNKGFLLRLLSLAQPPVNF   118
YER165C-A_Kyokai7   100   GNKGFLLPLLSLAQPPVNF   118
YER165C-A_LalvinQA23   100   GNKGFLLRLLSLAQPPVNF   118
YER165C-A_M22   100   GNKGFLLRLLSLAQPPVNF   118
YER165C-A_PW5   100   GNKGFLLPLLSLAQPPVNF   118
YER165C-A_T7   100   GNKGFLLPLLSLAQPPVNF   118
YER165C-A_UC5   100   GNKGFLLPLLSLAQPPVNF   118
YER165C-A_VL3   100   GNKGFLLRLLSLAQPPVNF   118
YER165C-A_Vin13   100   GNKGFLLRLLSLAQPPVNF   118
YER165C-A_Y10   100   GNKGFLLPLLSLAQPPVNF   118
YER165C-A_YJM269   100   GNKGFLLPLLSLAQPPVNF   118
YER165C-A_YJM789   100   GNKGFLLPLLSLAQPPVNF   118
YER165C-A_ZTW1   100   GNKGFLLPLLSLAQPPVNF   118
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YER165C-A_S288C from SGD:

YER165C-A_S288C [source=SGD]  Length: 119  Fri Sep 22 21:27:51 2017  Type: P  Check: 8514  ..

       1  MIVIFCVIVK CEFFCIFTFI FGCFIIEADL WPAVFVACCT IIKMGRCNMC

      51  IFITAIIFKL KCIFKGRHGS MPIAMKSSRH NYQLTFLFKV NCVFISLPGG

     101  NKGFLLRLLS LAQPPVNF*

Protein Sequence for YER165C-A_AWRI1631 from AWRI:

YER165C-A_AWRI1631 [source=AWRI]  Length: 119  Fri Sep 22 21:27:51 2017  Type: P  Check: 8514  ..

       1  MIVIFCVIVK CEFFCIFTFI FGCFIIEADL WPAVFVACCT IIKMGRCNMC

      51  IFITAIIFKL KCIFKGRHGS MPIAMKSSRH NYQLTFLFKV NCVFISLPGG

     101  NKGFLLRLLS LAQPPVNF*

Protein Sequence for YER165C-A_AWRI796 from AWRI:

YER165C-A_AWRI796 [source=AWRI]  Length: 119  Fri Sep 22 21:27:51 2017  Type: P  Check: 8514  ..

       1  MIVIFCVIVK CEFFCIFTFI FGCFIIEADL WPAVFVACCT IIKMGRCNMC

      51  IFITAIIFKL KCIFKGRHGS MPIAMKSSRH NYQLTFLFKV NCVFISLPGG

     101  NKGFLLRLLS LAQPPVNF*

Protein Sequence for YER165C-A_CBS7960 from WashU:

YER165C-A_CBS7960 [source=WashU]  Length: 119  Fri Sep 22 21:27:51 2017  Type: P  Check: 8634  ..

       1  MIVIFCVIVK CEFFCIFTFI FGCFIIEADP WPAVFVACCT IIKMGRCNMC

      51  IFITAIIFKL KCIFKGRHGS MPIAMKSSRH NYQLTFLFKV NCVFISLPGG

     101  NKGFLLRLLS LAQPPVNF*

Protein Sequence for YER165C-A_CLIB215 from WashU:

YER165C-A_CLIB215 [source=WashU]  Length: 119  Fri Sep 22 21:27:51 2017  Type: P  Check: 8514  ..

       1  MIVIFCVIVK CEFFCIFTFI FGCFIIEADL WPAVFVACCT IIKMGRCNMC

      51  IFITAIIFKL KCIFKGRHGS MPIAMKSSRH NYQLTFLFKV NCVFISLPGG

     101  NKGFLLRLLS LAQPPVNF*

Protein Sequence for YER165C-A_CLIB324 from WashU:

YER165C-A_CLIB324 [source=WashU]  Length: 80  Fri Sep 22 21:27:51 2017  Type: P  Check: 4564  ..

       1  MIVIFCVIVK GKFFCIFTFI FGCSSLETDL WAGCNCLLGC TLHQNWEGAK

      51  CRLYLLLVAP SSKWVGAICV SSLLLLSSH*

Protein Sequence for YER165C-A_CLIB382 from WashU:

YER165C-A_CLIB382 [source=WashU]  Length: 119  Fri Sep 22 21:27:51 2017  Type: P  Check: 8514  ..

       1  MIVIFCVIVK CEFFCIFTFI FGCFIIEADL WPAVFVACCT IIKMGRCNMC

      51  IFITAIIFKL KCIFKGRHGS MPIAMKSSRH NYQLTFLFKV NCVFISLPGG

     101  NKGFLLRLLS LAQPPVNF*

Protein Sequence for YER165C-A_EC1118 from Genoscope:

YER165C-A_EC1118 [source=Genoscope]  Length: 119  Fri Sep 22 21:27:51 2017  Type: P  Check: 8514  ..

       1  MIVIFCVIVK CEFFCIFTFI FGCFIIEADL WPAVFVACCT IIKMGRCNMC

      51  IFITAIIFKL KCIFKGRHGS MPIAMKSSRH NYQLTFLFKV NCVFISLPGG

     101  NKGFLLRLLS LAQPPVNF*

Protein Sequence for YER165C-A_EC9-8 from ASinica:

YER165C-A_EC9-8 [source=ASinica]  Length: 119  Fri Sep 22 21:27:51 2017  Type: P  Check: 9121  ..

       1  MIVIFCVIVK CEFFCIFTFI FGCFIIEADL WPAVFVACCT VIKMGRCNMC

      51  IFITAIIFKL KCIFKGRHGS MPIAMKSSRH NYQLTLLFKV NCVFISLPGG

     101  NKGFLLPLLS LAQPPVNF*

Protein Sequence for YER165C-A_FostersB from AWRI:

YER165C-A_FostersB [source=AWRI]  Length: 119  Fri Sep 22 21:27:51 2017  Type: P  Check: 8514  ..

       1  MIVIFCVIVK CEFFCIFTFI FGCFIIEADL WPAVFVACCT IIKMGRCNMC

      51  IFITAIIFKL KCIFKGRHGS MPIAMKSSRH NYQLTFLFKV NCVFISLPGG

     101  NKGFLLRLLS LAQPPVNF*

Protein Sequence for YER165C-A_FostersO from AWRI:

YER165C-A_FostersO [source=AWRI]  Length: 76  Fri Sep 22 21:27:51 2017  Type: P  Check: 9805  ..

       1  MGRCNMCIFI TAIIFKLKCI FKGRHGSMPI AMKSSRHNYQ LTFLFKVNCV

      51  FISLPGGNKG FLLRLLSLAQ PPVNF*

Protein Sequence for YER165C-A_JAY291 from Duke:

YER165C-A_JAY291 [source=Duke]  Length: 119  Fri Sep 22 21:27:51 2017  Type: P  Check: 8634  ..

       1  MIVIFCVIVK CEFFCIFTFI FGCFIIEADP WPAVFVACCT IIKMGRCNMC

      51  IFITAIIFKL KCIFKGRHGS MPIAMKSSRH NYQLTFLFKV NCVFISLPGG

     101  NKGFLLRLLS LAQPPVNF*

Protein Sequence for YER165C-A_Kyokai7 from NRIB:

YER165C-A_Kyokai7 [source=NRIB]  Length: 119  Fri Sep 22 21:27:51 2017  Type: P  Check: 8414  ..

       1  MIVIFCVIVK CEFFCIFTFI FGCFIIEADL WPAVFVACCT IIKMGRCNMC

      51  IFITAIIFKL KCIFKGRHGS MPIAMKSSRH NYQLTFLFKV NCVFISLPGG

     101  NKGFLLPLLS LAQPPVNF*

Protein Sequence for YER165C-A_LalvinQA23 from AWRI:

YER165C-A_LalvinQA23 [source=AWRI]  Length: 119  Fri Sep 22 21:27:51 2017  Type: P  Check: 8514  ..

       1  MIVIFCVIVK CEFFCIFTFI FGCFIIEADL WPAVFVACCT IIKMGRCNMC

      51  IFITAIIFKL KCIFKGRHGS MPIAMKSSRH NYQLTFLFKV NCVFISLPGG

     101  NKGFLLRLLS LAQPPVNF*

Protein Sequence for YER165C-A_M22 from WashU:

YER165C-A_M22 [source=WashU]  Length: 119  Fri Sep 22 21:27:51 2017  Type: P  Check: 8514  ..

       1  MIVIFCVIVK CEFFCIFTFI FGCFIIEADL WPAVFVACCT IIKMGRCNMC

      51  IFITAIIFKL KCIFKGRHGS MPIAMKSSRH NYQLTFLFKV NCVFISLPGG

     101  NKGFLLRLLS LAQPPVNF*

Protein Sequence for YER165C-A_PW5 from WashU:

YER165C-A_PW5 [source=WashU]  Length: 119  Fri Sep 22 21:27:51 2017  Type: P  Check: 8947  ..

       1  MIVIFCVIVK CEFFCIFTFI FGCFIIEADL WPAVFVACCT VIKMGRCNMC

      51  IFITAIIFKL KCIFKGRHGS MPIAMKSSRH NYQLTFLFKV NCVFISLPGG

     101  NKGFLLPLLS LAQPPVNF*

Protein Sequence for YER165C-A_T7 from WashU:

YER165C-A_T7 [source=WashU]  Length: 119  Fri Sep 22 21:27:51 2017  Type: P  Check: 8414  ..

       1  MIVIFCVIVK CEFFCIFTFI FGCFIIEADL WPAVFVACCT IIKMGRCNMC

      51  IFITAIIFKL KCIFKGRHGS MPIAMKSSRH NYQLTFLFKV NCVFISLPGG

     101  NKGFLLPLLS LAQPPVNF*

Protein Sequence for YER165C-A_UC5 from WashU:

YER165C-A_UC5 [source=WashU]  Length: 119  Fri Sep 22 21:27:51 2017  Type: P  Check: 8414  ..

       1  MIVIFCVIVK CEFFCIFTFI FGCFIIEADL WPAVFVACCT IIKMGRCNMC

      51  IFITAIIFKL KCIFKGRHGS MPIAMKSSRH NYQLTFLFKV NCVFISLPGG

     101  NKGFLLPLLS LAQPPVNF*

Protein Sequence for YER165C-A_VL3 from AWRI:

YER165C-A_VL3 [source=AWRI]  Length: 119  Fri Sep 22 21:27:51 2017  Type: P  Check: 8514  ..

       1  MIVIFCVIVK CEFFCIFTFI FGCFIIEADL WPAVFVACCT IIKMGRCNMC

      51  IFITAIIFKL KCIFKGRHGS MPIAMKSSRH NYQLTFLFKV NCVFISLPGG

     101  NKGFLLRLLS LAQPPVNF*

Protein Sequence for YER165C-A_Vin13 from AWRI:

YER165C-A_Vin13 [source=AWRI]  Length: 119  Fri Sep 22 21:27:51 2017  Type: P  Check: 8718  ..

       1  MIVIFCVIVK CEFFCIFTFI FGCFIIEADL WPAVFVACCT IIKMGRCNMC

      51  IFITAIIFKL KCIFKGRHXS MPIAMKSSRH NYQLTFLFKV NCVFISLPGG

     101  NKGFLLRLLS LAQPPVNF*

Protein Sequence for YER165C-A_Y10 from WashU:

YER165C-A_Y10 [source=WashU]  Length: 119  Fri Sep 22 21:27:51 2017  Type: P  Check: 7820  ..

       1  MIVIFCVIVK CEFFCIFTFI FGCFIIEADL WPAVFVACCT IIKMGRCNMC

      51  IFITAIIFKL KCIFKGRHGS MPIAMKSSRH NYQLTFLFKD NCVFISLPGG

     101  NKGFLLPLLS LAQPPVNF*

Protein Sequence for YER165C-A_YJM269 from WashU:

YER165C-A_YJM269 [source=WashU]  Length: 119  Fri Sep 22 21:27:51 2017  Type: P  Check: 7820  ..

       1  MIVIFCVIVK CEFFCIFTFI FGCFIIEADL WPAVFVACCT IIKMGRCNMC

      51  IFITAIIFKL KCIFKGRHGS MPIAMKSSRH NYQLTFLFKD NCVFISLPGG

     101  NKGFLLPLLS LAQPPVNF*

Protein Sequence for YER165C-A_YJM789 from Stanford:

YER165C-A_YJM789 [source=Stanford]  Length: 119  Fri Sep 22 21:27:51 2017  Type: P  Check: 8414  ..

       1  MIVIFCVIVK CEFFCIFTFI FGCFIIEADL WPAVFVACCT IIKMGRCNMC

      51  IFITAIIFKL KCIFKGRHGS MPIAMKSSRH NYQLTFLFKV NCVFISLPGG

     101  NKGFLLPLLS LAQPPVNF*

Protein Sequence for YER165C-A_ZTW1 from Zhejiang:

YER165C-A_ZTW1 [source=Zhejiang]  Length: 119  Fri Sep 22 21:27:51 2017  Type: P  Check: 8414  ..

       1  MIVIFCVIVK CEFFCIFTFI FGCFIIEADL WPAVFVACCT IIKMGRCNMC

      51  IFITAIIFKL KCIFKGRHGS MPIAMKSSRH NYQLTFLFKV NCVFISLPGG

     101  NKGFLLPLLS LAQPPVNF*