SPT15/YER148W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YER148W_S288C   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_AWRI1631   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_AWRI796   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_BC187   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_BY4741   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_BY4742   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_CBS7960   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_CEN.PK   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_CLIB215   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_CLIB324   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_D273-10B   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_DBVPG6044   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_EC1118   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_EC9-8   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_FL100   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_FY1679   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_FostersB   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_FostersO   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_JAY291   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_JK9-3d   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_K11   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_Kyokai7   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_LalvinQA23   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_PW5   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_RM11-1a   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_RedStar   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_SEY6210   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_SK1   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_T7   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_T73   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_UC5   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_UWOPS05_217_3   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_VL3   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_Vin13   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_W303   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_X2180-1A   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_Y10   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_Y55   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_YJM269   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_YJM339   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_YJM789   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_YPH499   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_YPS128   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_YPS163   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_YS9   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
YER148W_ZTW1   1   MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAA   50
         

YER148W_S288C   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_AWRI1631   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPSRFA   100
YER148W_AWRI796   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_BC187   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_BY4741   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_BY4742   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_CBS7960   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_CEN.PK   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_CLIB215   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_CLIB324   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_D273-10B   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_DBVPG6044   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_EC1118   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_EC9-8   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_FL100   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_FY1679   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_FostersB   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKXFA   100
YER148W_FostersO   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_JAY291   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_JK9-3d   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_K11   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_Kyokai7   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_LalvinQA23   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_PW5   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_RM11-1a   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_RedStar   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_SEY6210   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_SK1   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_T7   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_T73   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_UC5   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_UWOPS05_217_3   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_VL3   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_Vin13   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_W303   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_X2180-1A   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_Y10   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_Y55   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_YJM269   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_YJM339   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_YJM789   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_YPH499   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_YPS128   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_YPS163   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_YS9   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
YER148W_ZTW1   51   PESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFA   100
         

YER148W_S288C   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_AWRI1631   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_AWRI796   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_BC187   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_BY4741   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_BY4742   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_CBS7960   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_CEN.PK   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_CLIB215   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_CLIB324   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_D273-10B   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_DBVPG6044   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_EC1118   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_EC9-8   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_FL100   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_FY1679   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_FostersB   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_FostersO   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_JAY291   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_JK9-3d   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_K11   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_Kyokai7   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_LalvinQA23   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_PW5   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_RM11-1a   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_RedStar   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_SEY6210   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_SK1   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_T7   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_T73   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_UC5   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_UWOPS05_217_3   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_VL3   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_Vin13   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_W303   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_X2180-1A   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_Y10   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_Y55   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_YJM269   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_YJM339   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_YJM789   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_YPH499   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_YPS128   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_YPS163   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_YS9   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
YER148W_ZTW1   101   AVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAA   150
         

YER148W_S288C   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_AWRI1631   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_AWRI796   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_BC187   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_BY4741   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_BY4742   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_CBS7960   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_CEN.PK   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_CLIB215   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_CLIB324   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_D273-10B   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_DBVPG6044   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_EC1118   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_EC9-8   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_FL100   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_FY1679   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_FostersB   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_FostersO   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_JAY291   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_JK9-3d   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_K11   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_Kyokai7   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_LalvinQA23   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_PW5   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_RM11-1a   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_RedStar   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_SEY6210   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_SK1   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_T7   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_T73   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_UC5   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_UWOPS05_217_3   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_VL3   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_Vin13   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_W303   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_X2180-1A   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_Y10   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_Y55   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_YJM269   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_YJM339   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_YJM789   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_YPH499   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_YPS128   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_YPS163   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_YS9   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
YER148W_ZTW1   151   KFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKP   200
         

YER148W_S288C   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_AWRI1631   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_AWRI796   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_BC187   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_BY4741   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_BY4742   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_CBS7960   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_CEN.PK   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_CLIB215   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_CLIB324   201   KLLW------------------------------------   204
YER148W_D273-10B   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_DBVPG6044   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_EC1118   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_EC9-8   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_FL100   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_FY1679   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_FostersB   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_FostersO   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_JAY291   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_JK9-3d   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_K11   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_Kyokai7   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_LalvinQA23   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_PW5   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_RM11-1a   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_RedStar   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_SEY6210   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_SK1   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_T7   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_T73   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_UC5   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_UWOPS05_217_3   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_VL3   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_Vin13   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_W303   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_X2180-1A   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_Y10   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_Y55   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_YJM269   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_YJM339   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_YJM789   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_YPH499   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_YPS128   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_YPS163   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_YS9   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
YER148W_ZTW1   201   KIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM   240
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YER148W_S288C from SGD:

YER148W_S288C [source=SGD]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_AWRI1631 from AWRI:

YER148W_AWRI1631 [source=AWRI]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 7236  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPSRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_AWRI796 from AWRI:

YER148W_AWRI796 [source=AWRI]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_BC187 from Stanford:

YER148W_BC187 [source=Stanford]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_BY4741 from Stanford:

YER148W_BY4741 [source=Stanford]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_BY4742 from Stanford:

YER148W_BY4742 [source=Stanford]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_CBS7960 from WashU:

YER148W_CBS7960 [source=WashU]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_CEN.PK from Stanford:

YER148W_CEN.PK [source=Stanford]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_CLIB215 from WashU:

YER148W_CLIB215 [source=WashU]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_CLIB324 from WashU:

YER148W_CLIB324 [source=WashU]  Length: 205  Tue Aug 14 22:20:44 2018  Type: P  Check: 9685  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KLLW*

Protein Sequence for YER148W_D273-10B from Stanford:

YER148W_D273-10B [source=Stanford]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_DBVPG6044 from Stanford:

YER148W_DBVPG6044 [source=Stanford]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_EC1118 from Genoscope:

YER148W_EC1118 [source=Genoscope]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_EC9-8 from ASinica:

YER148W_EC9-8 [source=ASinica]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_FL100 from Stanford:

YER148W_FL100 [source=Stanford]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_FY1679 from Stanford:

YER148W_FY1679 [source=Stanford]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_FostersB from AWRI:

YER148W_FostersB [source=AWRI]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 7162  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKXFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_FostersO from AWRI:

YER148W_FostersO [source=AWRI]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_JAY291 from Duke:

YER148W_JAY291 [source=Duke]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_JK9-3d from Stanford:

YER148W_JK9-3d [source=Stanford]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_K11 from Stanford:

YER148W_K11 [source=Stanford]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_Kyokai7 from NRIB:

YER148W_Kyokai7 [source=NRIB]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_LalvinQA23 from AWRI:

YER148W_LalvinQA23 [source=AWRI]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_PW5 from WashU:

YER148W_PW5 [source=WashU]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_RM11-1a from Stanford:

YER148W_RM11-1a [source=Stanford]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_RedStar from Stanford:

YER148W_RedStar [source=Stanford]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_SEY6210 from Stanford:

YER148W_SEY6210 [source=Stanford]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_SK1 from Stanford:

YER148W_SK1 [source=Stanford]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_T7 from WashU:

YER148W_T7 [source=WashU]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_T73 from WashU:

YER148W_T73 [source=WashU]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_UC5 from WashU:

YER148W_UC5 [source=WashU]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_UWOPS05_217_3 from Stanford:

YER148W_UWOPS05_217_3 [source=Stanford]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_VL3 from AWRI:

YER148W_VL3 [source=AWRI]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_Vin13 from AWRI:

YER148W_Vin13 [source=AWRI]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_W303 from Stanford:

YER148W_W303 [source=Stanford]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_X2180-1A from Stanford:

YER148W_X2180-1A [source=Stanford]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_Y10 from WashU:

YER148W_Y10 [source=WashU]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_Y55 from Stanford:

YER148W_Y55 [source=Stanford]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_YJM269 from WashU:

YER148W_YJM269 [source=WashU]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_YJM339 from Stanford:

YER148W_YJM339 [source=Stanford]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_YJM789 from Stanford:

YER148W_YJM789 [source=Stanford]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_YPH499 from Stanford:

YER148W_YPH499 [source=Stanford]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_YPS128 from Stanford:

YER148W_YPS128 [source=Stanford]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_YPS163 from Stanford:

YER148W_YPS163 [source=Stanford]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_YS9 from Stanford:

YER148W_YS9 [source=Stanford]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *


Protein Sequence for YER148W_ZTW1 from Zhejiang:

YER148W_ZTW1 [source=Zhejiang]  Length: 241  Tue Aug 14 22:20:44 2018  Type: P  Check: 6916  ..

       1  MADEERLKEF KEANKIVFDP NTRQVWENQN RDGTKPATTF QSEEDIKRAA

      51  PESEKDTSAT SGIVPTLQNI VATVTLGCRL DLKTVALHAR NAEYNPKRFA

     101  AVIMRIREPK TTALIFASGK MVVTGAKSED DSKLASRKYA RIIQKIGFAA

     151  KFTDFKIQNI VGSCDVKFPI RLEGLAFSHG TFSSYEPELF PGLIYRMVKP

     201  KIVLLIFVSG KIVLTGAKQR EEIYQAFEAI YPVLSEFRKM *