FTR1/YER145C S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YER145C_S288C   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_AWRI1631   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_AWRI796   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_BC187   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_BY4741   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_BY4742   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_CEN.PK   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_CLIB382   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_D273-10B   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_DBVPG6044   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_EC1118   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_EC9-8   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_FL100   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_FY1679   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_FostersB   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_FostersO   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_JAY291   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_JK9-3d   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_K11   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_Kyokai7   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_L1528   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_LalvinQA23   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRAXYRKLRIQ   50
YER145C_PW5   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_RM11-1a   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_RedStar   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_SEY6210   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_SK1   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_T7   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_T73   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_UC5   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_UWOPS05_217_3   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_VL3   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_Vin13   
   --------------------------------------------------   
YER145C_W303   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_X2180-1A   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_Y55   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_YJM339   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_YJM789   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_YPH499   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_YPS128   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_YPS163   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_YS9   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
YER145C_ZTW1   1   MPNKVFNVAVFFVVFRECLEAVIVISVLLSFLKQAIGEHDRALYRKLRIQ   50
         

YER145C_S288C   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_AWRI1631   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_AWRI796   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_BC187   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_BY4741   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_BY4742   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_CEN.PK   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_CLIB382   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_D273-10B   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_DBVPG6044   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_EC1118   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_EC9-8   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_FL100   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_FY1679   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_FostersB   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_FostersO   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_JAY291   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_JK9-3d   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_K11   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_Kyokai7   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_L1528   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_LalvinQA23   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_PW5   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_RM11-1a   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_RedStar   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_SEY6210   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_SK1   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_T7   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_T73   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_UC5   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_UWOPS05_217_3   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_VL3   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_Vin13   1   -------------------------------------------MIATIMI   7
YER145C_W303   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_X2180-1A   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_Y55   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_YJM339   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_YJM789   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_YPH499   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_YPS128   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_YPS163   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_YS9   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
YER145C_ZTW1   51   VWVGVLLGFIICLAIGAGFIGAYYSLQKDIFGSAEDLWEGIFCMIATIMI   100
         

YER145C_S288C   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_AWRI1631   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_AWRI796   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_BC187   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_BY4741   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_BY4742   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_CEN.PK   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_CLIB382   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_D273-10B   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_DBVPG6044   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_EC1118   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_EC9-8   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_FL100   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_FY1679   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_FostersB   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_FostersO   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_JAY291   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_JK9-3d   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_K11   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_Kyokai7   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_L1528   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_LalvinQA23   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_PW5   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_RM11-1a   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_RedStar   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_SEY6210   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_SK1   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_T7   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_T73   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_UC5   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_UWOPS05_217_3   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_VL3   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_Vin13   8   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   57
YER145C_W303   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_X2180-1A   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_Y55   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_YJM339   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_YJM789   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_YPH499   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_YPS128   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_YPS163   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_YS9   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
YER145C_ZTW1   101   SMMGIPMLRMNKMQSKWRVKIARSLVEIPHRKRDYFKIGFLSRRYAMFLL   150
         

YER145C_S288C   151   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   200
YER145C_AWRI1631   151   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   200
YER145C_AWRI796   151   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   200
YER145C_BC187   151   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   200
YER145C_BY4741   151   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   200
YER145C_BY4742   151   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   200
YER145C_CEN.PK   151   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   200
YER145C_CLIB382   151   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   200
YER145C_D273-10B   151   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   200
YER145C_DBVPG6044   151   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   200
YER145C_EC1118   151   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   200
YER145C_EC9-8   151   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   200
YER145C_FL100   151   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   200
YER145C_FY1679   151   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   200
YER145C_FostersB   151   PFITVLREGLEAVVFVAGAGITTQGSHGSAYPLPVVVGLICGGLVGYLLY   200
YER145C_FostersO   151   PFITVLREGLEAVVFVAGAGITTQGSHXSAYPLPVVVGLICGGLVGYLLY   200
YER145C_JAY291   151   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   200
YER145C_JK9-3d   151   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   200
YER145C_K11   151   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   200
YER145C_Kyokai7   151   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   200
YER145C_L1528   151   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   200
YER145C_LalvinQA23   151   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   200
YER145C_PW5   151   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   200
YER145C_RM11-1a   151   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   200
YER145C_RedStar   151   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   200
YER145C_SEY6210   151   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   200
YER145C_SK1   151   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   200
YER145C_T7   151   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   200
YER145C_T73   151   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   200
YER145C_UC5   151   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   200
YER145C_UWOPS05_217_3   151   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   200
YER145C_VL3   151   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   200
YER145C_Vin13   58   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   107
YER145C_W303   151   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   200
YER145C_X2180-1A   151   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   200
YER145C_Y55   151   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   200
YER145C_YJM339   151   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   200
YER145C_YJM789   151   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   200
YER145C_YPH499   151   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   200
YER145C_YPS128   151   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   200
YER145C_YPS163   151   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   200
YER145C_YS9   151   PFITVLREGLEAVVFVAGAGITTQGSHASAYPLPVVVGLICGGLVGYLLY   200
YER145C_ZTW1   151   PFITVLREGLEAVVFVAGAGITTQGSHGSAYPLPVVVGLICGGLVGYLLY   200
         

YER145C_S288C   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEG   250
YER145C_AWRI1631   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEG   250
YER145C_AWRI796   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEG   250
YER145C_BC187   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEG   250
YER145C_BY4741   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEG   250
YER145C_BY4742   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEG   250
YER145C_CEN.PK   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEG   250
YER145C_CLIB382   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEG   250
YER145C_D273-10B   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEG   250
YER145C_DBVPG6044   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEG   250
YER145C_EC1118   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEG   250
YER145C_EC9-8   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEG   250
YER145C_FL100   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEG   250
YER145C_FY1679   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEG   250
YER145C_FostersB   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEG   250
YER145C_FostersO   201   YGASKSSLQIFLILSTSILYLIFRRSFLSWCVVL----------------   234
YER145C_JAY291   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEG   250
YER145C_JK9-3d   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEG   250
YER145C_K11   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWFFENYRFNLASGGDASEG   250
YER145C_Kyokai7   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWFFENYRFNLASGGDASEG   250
YER145C_L1528   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEG   250
YER145C_LalvinQA23   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEG   250
YER145C_PW5   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEG   250
YER145C_RM11-1a   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEG   250
YER145C_RedStar   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEG   250
YER145C_SEY6210   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEG   250
YER145C_SK1   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEG   250
YER145C_T7   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEG   250
YER145C_T73   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEG   250
YER145C_UC5   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWFFENYRFNLASGGDASEG   250
YER145C_UWOPS05_217_3   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEG   250
YER145C_VL3   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEG   250
YER145C_Vin13   108   YGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEG   157
YER145C_W303   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEG   250
YER145C_X2180-1A   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEG   250
YER145C_Y55   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEG   250
YER145C_YJM339   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEG   250
YER145C_YJM789   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEG   250
YER145C_YPH499   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEG   250
YER145C_YPS128   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEG   250
YER145C_YPS163   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEG   250
YER145C_YS9   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEG   250
YER145C_ZTW1   201   YGASKSSLQIFLILSTSILYLISAGLFSRGAWYFENYRFNLASGGDASEG   250
         

YER145C_S288C   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   298
YER145C_AWRI1631   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   298
YER145C_AWRI796   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   298
YER145C_BC187   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   298
YER145C_BY4741   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   298
YER145C_BY4742   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   298
YER145C_CEN.PK   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   298
YER145C_CLIB382   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   298
YER145C_D273-10B   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   298
YER145C_DBVPG6044   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   298
YER145C_EC1118   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   298
YER145C_EC9-8   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   298
YER145C_FL100   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   298
YER145C_FY1679   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   298
YER145C_FostersB   251   GDGNGSYNIRKGRFTMSIVATQNWTMGGISSXLCLDGRTPATCHPCFVTT   300
YER145C_FostersO   
   --------------------------------------------------   
YER145C_JAY291   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   298
YER145C_JK9-3d   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   298
YER145C_K11   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   298
YER145C_Kyokai7   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   298
YER145C_L1528   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   298
YER145C_LalvinQA23   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   298
YER145C_PW5   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   298
YER145C_RM11-1a   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   298
YER145C_RedStar   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   298
YER145C_SEY6210   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   298
YER145C_SK1   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   298
YER145C_T7   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   298
YER145C_T73   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSYMLCY   298
YER145C_UC5   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   298
YER145C_UWOPS05_217_3   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   298
YER145C_VL3   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   298
YER145C_Vin13   158   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   205
YER145C_W303   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   298
YER145C_X2180-1A   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   298
YER145C_Y55   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   298
YER145C_YJM339   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   298
YER145C_YJM789   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   298
YER145C_YPH499   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   298
YER145C_YPS128   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   298
YER145C_YPS163   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   298
YER145C_YS9   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   298
YER145C_ZTW1   251   GDGNGSYNIRKAVYHVNCCNPELDNGWDIFN--ALLGWQNTGYLSSMLCY   298
         

YER145C_S288C   299   NIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTE   348
YER145C_AWRI1631   299   NIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTE   348
YER145C_AWRI796   299   NIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTE   348
YER145C_BC187   299   NIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTE   348
YER145C_BY4741   299   NIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTE   348
YER145C_BY4742   299   NIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTE   348
YER145C_CEN.PK   299   NIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTE   348
YER145C_CLIB382   299   NIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTE   348
YER145C_D273-10B   299   NIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTE   348
YER145C_DBVPG6044   299   NIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTE   348
YER145C_EC1118   299   NIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPAYWIKNKKKQELTE   348
YER145C_EC9-8   299   NIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTE   348
YER145C_FL100   299   NIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTE   348
YER145C_FY1679   299   NIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTE   348
YER145C_FostersB   301   SIGWFLSLC-----------------------------------------   309
YER145C_FostersO   
   --------------------------------------------------   
YER145C_JAY291   299   NIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTE   348
YER145C_JK9-3d   299   NIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTE   348
YER145C_K11   299   NIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTE   348
YER145C_Kyokai7   299   NIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTE   348
YER145C_L1528   299   NIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTE   348
YER145C_LalvinQA23   299   NIYWLVLIIVLSLMIFEERRGHLPFTXKLTIETLEPXILDQEQEKSRS--   346
YER145C_PW5   299   NIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTE   348
YER145C_RM11-1a   299   NIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTE   348
YER145C_RedStar   299   NIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTE   348
YER145C_SEY6210   299   NIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTE   348
YER145C_SK1   299   NIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTE   348
YER145C_T7   299   NIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTE   348
YER145C_T73   299   NIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTE   348
YER145C_UC5   299   NIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTE   348
YER145C_UWOPS05_217_3   299   NIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTE   348
YER145C_VL3   299   NIYWLVLIIVLSFNDIRRKAWSLAFHQKLTIETLEPRILDQEQEKAGVDG   348
YER145C_Vin13   206   NIYWLVLIIVLSLMIFEERXGHLPFTKNLQLKHLNPGYWIKNKKKQELTE   255
YER145C_W303   299   NIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTE   348
YER145C_X2180-1A   299   NIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTE   348
YER145C_Y55   299   NIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTE   348
YER145C_YJM339   299   NIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTE   348
YER145C_YJM789   299   NIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTE   348
YER145C_YPH499   299   NIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTE   348
YER145C_YPS128   299   NIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTE   348
YER145C_YPS163   299   NIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTE   348
YER145C_YS9   299   NIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTE   348
YER145C_ZTW1   299   NIYWLVLIIVLSLMIFEERRGHLPFTKNLQLKHLNPGYWIKNKKKQELTE   348
         

YER145C_S288C   349   EQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLH   398
YER145C_AWRI1631   349   EQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLH   398
YER145C_AWRI796   349   EQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLH   398
YER145C_BC187   349   EQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLH   398
YER145C_BY4741   349   EQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLH   398
YER145C_BY4742   349   EQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLH   398
YER145C_CEN.PK   349   EQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLH   398
YER145C_CLIB382   349   EQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATYKEVLH   398
YER145C_D273-10B   349   EQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLH   398
YER145C_DBVPG6044   349   EQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLH   398
YER145C_EC1118   349   EQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLH   398
YER145C_EC9-8   349   EQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLH   398
YER145C_FL100   349   EQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLH   398
YER145C_FY1679   349   EQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLH   398
YER145C_FostersB   
   --------------------------------------------------   
YER145C_FostersO   
   --------------------------------------------------   
YER145C_JAY291   349   EQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLH   398
YER145C_JK9-3d   349   EQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLH   398
YER145C_K11   349   EQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLH   398
YER145C_Kyokai7   349   EQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLH   398
YER145C_L1528   349   EQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLH   398
YER145C_LalvinQA23   
   --------------------------------------------------   
YER145C_PW5   349   EQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLH   398
YER145C_RM11-1a   349   EQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLH   398
YER145C_RedStar   349   EQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLH   398
YER145C_SEY6210   349   EQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLH   398
YER145C_SK1   349   EQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLH   398
YER145C_T7   349   EQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLH   398
YER145C_T73   349   EQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLH   398
YER145C_UC5   349   EQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLH   398
YER145C_UWOPS05_217_3   349   EQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLH   398
YER145C_VL3   349   RAKETTVCQDGEXQLQ----------------------------------   364
YER145C_Vin13   256   EQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLH   305
YER145C_W303   349   EQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLH   398
YER145C_X2180-1A   349   EQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLH   398
YER145C_Y55   349   EQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLH   398
YER145C_YJM339   349   DQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLH   398
YER145C_YJM789   349   DQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLH   398
YER145C_YPH499   349   EQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLH   398
YER145C_YPS128   349   EQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLH   398
YER145C_YPS163   349   EQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLH   398
YER145C_YS9   349   EQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLH   398
YER145C_ZTW1   349   EQKRQLFAKMENINFNEDGEINVQENYELPEQTTSHSSSQNVATDKEVLH   398
         

YER145C_S288C   399   VKADSL   404
YER145C_AWRI1631   399   VKADSL   404
YER145C_AWRI796   399   VKADSL   404
YER145C_BC187   399   VKADSL   404
YER145C_BY4741   399   VKADSL   404
YER145C_BY4742   399   VKADSL   404
YER145C_CEN.PK   399   VKADSL   404
YER145C_CLIB382   399   VKADSL   404
YER145C_D273-10B   399   VKADSL   404
YER145C_DBVPG6044   399   VKADSL   404
YER145C_EC1118   399   VKADSL   404
YER145C_EC9-8   399   VKADSL   404
YER145C_FL100   399   VKADSL   404
YER145C_FY1679   399   VKADSL   404
YER145C_FostersB   
   ------   
YER145C_FostersO   
   ------   
YER145C_JAY291   399   VKADSL   404
YER145C_JK9-3d   399   VKADSL   404
YER145C_K11   399   VKADSL   404
YER145C_Kyokai7   399   VKADSL   404
YER145C_L1528   399   VKADSL   404
YER145C_LalvinQA23   
   ------   
YER145C_PW5   399   VKADSL   404
YER145C_RM11-1a   399   VKADSL   404
YER145C_RedStar   399   VKADSL   404
YER145C_SEY6210   399   VKADSL   404
YER145C_SK1   399   VKADSL   404
YER145C_T7   399   VKADSL   404
YER145C_T73   399   VKADSL   404
YER145C_UC5   399   VKADSL   404
YER145C_UWOPS05_217_3   399   VKADSL   404
YER145C_VL3   
   ------   
YER145C_Vin13   306   VKADSL   311
YER145C_W303   399   VKADSL   404
YER145C_X2180-1A   399   VKADSL   404
YER145C_Y55   399   VKADSL   404
YER145C_YJM339   399   VKAGSL   404
YER145C_YJM789   399   VKAGSL   404
YER145C_YPH499   399   VKADSL   404
YER145C_YPS128   399   VKADSL   404
YER145C_YPS163   399   VKADSL   404
YER145C_YS9   399   VKADSL   404
YER145C_ZTW1   399   VKADSL   404
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YER145C_S288C from SGD:

YER145C_S288C [source=SGD]  Length: 405  Wed Nov 22 14:15:12 2017  Type: P  Check: 4452  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHASA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWYFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSSMLCYNI

     301  YWLVLIIVLS LMIFEERRGH LPFTKNLQLK HLNPGYWIKN KKKQELTEEQ

     351  KRQLFAKMEN INFNEDGEIN VQENYELPEQ TTSHSSSQNV ATDKEVLHVK

     401  ADSL*

Protein Sequence for YER145C_AWRI1631 from AWRI:

YER145C_AWRI1631 [source=AWRI]  Length: 405  Wed Nov 22 14:15:12 2017  Type: P  Check: 4452  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHASA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWYFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSSMLCYNI

     301  YWLVLIIVLS LMIFEERRGH LPFTKNLQLK HLNPGYWIKN KKKQELTEEQ

     351  KRQLFAKMEN INFNEDGEIN VQENYELPEQ TTSHSSSQNV ATDKEVLHVK

     401  ADSL*

Protein Sequence for YER145C_AWRI796 from AWRI:

YER145C_AWRI796 [source=AWRI]  Length: 405  Wed Nov 22 14:15:12 2017  Type: P  Check: 4452  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHASA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWYFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSSMLCYNI

     301  YWLVLIIVLS LMIFEERRGH LPFTKNLQLK HLNPGYWIKN KKKQELTEEQ

     351  KRQLFAKMEN INFNEDGEIN VQENYELPEQ TTSHSSSQNV ATDKEVLHVK

     401  ADSL*

Protein Sequence for YER145C_BC187 from Stanford:

YER145C_BC187 [source=Stanford]  Length: 405  Wed Nov 22 14:15:12 2017  Type: P  Check: 4452  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHASA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWYFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSSMLCYNI

     301  YWLVLIIVLS LMIFEERRGH LPFTKNLQLK HLNPGYWIKN KKKQELTEEQ

     351  KRQLFAKMEN INFNEDGEIN VQENYELPEQ TTSHSSSQNV ATDKEVLHVK

     401  ADSL*

Protein Sequence for YER145C_BY4741 from Stanford:

YER145C_BY4741 [source=Stanford]  Length: 405  Wed Nov 22 14:15:12 2017  Type: P  Check: 4452  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHASA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWYFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSSMLCYNI

     301  YWLVLIIVLS LMIFEERRGH LPFTKNLQLK HLNPGYWIKN KKKQELTEEQ

     351  KRQLFAKMEN INFNEDGEIN VQENYELPEQ TTSHSSSQNV ATDKEVLHVK

     401  ADSL*

Protein Sequence for YER145C_BY4742 from Stanford:

YER145C_BY4742 [source=Stanford]  Length: 405  Wed Nov 22 14:15:12 2017  Type: P  Check: 4452  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHASA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWYFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSSMLCYNI

     301  YWLVLIIVLS LMIFEERRGH LPFTKNLQLK HLNPGYWIKN KKKQELTEEQ

     351  KRQLFAKMEN INFNEDGEIN VQENYELPEQ TTSHSSSQNV ATDKEVLHVK

     401  ADSL*

Protein Sequence for YER145C_CEN.PK from Stanford:

YER145C_CEN.PK [source=Stanford]  Length: 405  Wed Nov 22 14:15:12 2017  Type: P  Check: 4452  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHASA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWYFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSSMLCYNI

     301  YWLVLIIVLS LMIFEERRGH LPFTKNLQLK HLNPGYWIKN KKKQELTEEQ

     351  KRQLFAKMEN INFNEDGEIN VQENYELPEQ TTSHSSSQNV ATDKEVLHVK

     401  ADSL*

Protein Sequence for YER145C_CLIB382 from WashU:

YER145C_CLIB382 [source=WashU]  Length: 405  Wed Nov 22 14:15:12 2017  Type: P  Check: 5523  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHASA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWYFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSSMLCYNI

     301  YWLVLIIVLS LMIFEERRGH LPFTKNLQLK HLNPGYWIKN KKKQELTEEQ

     351  KRQLFAKMEN INFNEDGEIN VQENYELPEQ TTSHSSSQNV ATYKEVLHVK

     401  ADSL*

Protein Sequence for YER145C_D273-10B from Stanford:

YER145C_D273-10B [source=Stanford]  Length: 405  Wed Nov 22 14:15:12 2017  Type: P  Check: 4452  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHASA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWYFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSSMLCYNI

     301  YWLVLIIVLS LMIFEERRGH LPFTKNLQLK HLNPGYWIKN KKKQELTEEQ

     351  KRQLFAKMEN INFNEDGEIN VQENYELPEQ TTSHSSSQNV ATDKEVLHVK

     401  ADSL*

Protein Sequence for YER145C_DBVPG6044 from Stanford:

YER145C_DBVPG6044 [source=Stanford]  Length: 405  Wed Nov 22 14:15:12 2017  Type: P  Check: 4452  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHASA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWYFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSSMLCYNI

     301  YWLVLIIVLS LMIFEERRGH LPFTKNLQLK HLNPGYWIKN KKKQELTEEQ

     351  KRQLFAKMEN INFNEDGEIN VQENYELPEQ TTSHSSSQNV ATDKEVLHVK

     401  ADSL*

Protein Sequence for YER145C_EC1118 from Genoscope:

YER145C_EC1118 [source=Genoscope]  Length: 405  Wed Nov 22 14:15:12 2017  Type: P  Check: 4152  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHASA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWYFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSSMLCYNI

     301  YWLVLIIVLS LMIFEERRGH LPFTKNLQLK HLNPAYWIKN KKKQELTEEQ

     351  KRQLFAKMEN INFNEDGEIN VQENYELPEQ TTSHSSSQNV ATDKEVLHVK

     401  ADSL*

Protein Sequence for YER145C_EC9-8 from ASinica:

YER145C_EC9-8 [source=ASinica]  Length: 405  Wed Nov 22 14:15:12 2017  Type: P  Check: 4452  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHASA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWYFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSSMLCYNI

     301  YWLVLIIVLS LMIFEERRGH LPFTKNLQLK HLNPGYWIKN KKKQELTEEQ

     351  KRQLFAKMEN INFNEDGEIN VQENYELPEQ TTSHSSSQNV ATDKEVLHVK

     401  ADSL*

Protein Sequence for YER145C_FL100 from Stanford:

YER145C_FL100 [source=Stanford]  Length: 405  Wed Nov 22 14:15:12 2017  Type: P  Check: 4452  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHASA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWYFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSSMLCYNI

     301  YWLVLIIVLS LMIFEERRGH LPFTKNLQLK HLNPGYWIKN KKKQELTEEQ

     351  KRQLFAKMEN INFNEDGEIN VQENYELPEQ TTSHSSSQNV ATDKEVLHVK

     401  ADSL*

Protein Sequence for YER145C_FY1679 from Stanford:

YER145C_FY1679 [source=Stanford]  Length: 405  Wed Nov 22 14:15:12 2017  Type: P  Check: 4452  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHASA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWYFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSSMLCYNI

     301  YWLVLIIVLS LMIFEERRGH LPFTKNLQLK HLNPGYWIKN KKKQELTEEQ

     351  KRQLFAKMEN INFNEDGEIN VQENYELPEQ TTSHSSSQNV ATDKEVLHVK

     401  ADSL*

Protein Sequence for YER145C_FostersB from AWRI:

YER145C_FostersB [source=AWRI]  Length: 310  Wed Nov 22 14:15:12 2017  Type: P  Check: 5770  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHGSA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWYFENYRFN LASGGDASEG

     251  GDGNGSYNIR KGRFTMSIVA TQNWTMGGIS SXLCLDGRTP ATCHPCFVTT

     301  SIGWFLSLC*

Protein Sequence for YER145C_FostersO from AWRI:

YER145C_FostersO [source=AWRI]  Length: 235  Wed Nov 22 14:15:12 2017  Type: P  Check: 7323  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHXSA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LIFRRSFLSW CVVL*

Protein Sequence for YER145C_JAY291 from Duke:

YER145C_JAY291 [source=Duke]  Length: 405  Wed Nov 22 14:15:12 2017  Type: P  Check: 4452  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHASA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWYFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSSMLCYNI

     301  YWLVLIIVLS LMIFEERRGH LPFTKNLQLK HLNPGYWIKN KKKQELTEEQ

     351  KRQLFAKMEN INFNEDGEIN VQENYELPEQ TTSHSSSQNV ATDKEVLHVK

     401  ADSL*

Protein Sequence for YER145C_JK9-3d from Stanford:

YER145C_JK9-3d [source=Stanford]  Length: 405  Wed Nov 22 14:15:12 2017  Type: P  Check: 4452  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHASA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWYFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSSMLCYNI

     301  YWLVLIIVLS LMIFEERRGH LPFTKNLQLK HLNPGYWIKN KKKQELTEEQ

     351  KRQLFAKMEN INFNEDGEIN VQENYELPEQ TTSHSSSQNV ATDKEVLHVK

     401  ADSL*

Protein Sequence for YER145C_K11 from Stanford:

YER145C_K11 [source=Stanford]  Length: 405  Wed Nov 22 14:15:12 2017  Type: P  Check: 4357  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHASA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWFFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSSMLCYNI

     301  YWLVLIIVLS LMIFEERRGH LPFTKNLQLK HLNPGYWIKN KKKQELTEEQ

     351  KRQLFAKMEN INFNEDGEIN VQENYELPEQ TTSHSSSQNV ATDKEVLHVK

     401  ADSL*

Protein Sequence for YER145C_Kyokai7 from NRIB:

YER145C_Kyokai7 [source=NRIB]  Length: 405  Wed Nov 22 14:15:12 2017  Type: P  Check: 4357  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHASA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWFFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSSMLCYNI

     301  YWLVLIIVLS LMIFEERRGH LPFTKNLQLK HLNPGYWIKN KKKQELTEEQ

     351  KRQLFAKMEN INFNEDGEIN VQENYELPEQ TTSHSSSQNV ATDKEVLHVK

     401  ADSL*

Protein Sequence for YER145C_L1528 from Stanford:

YER145C_L1528 [source=Stanford]  Length: 405  Wed Nov 22 14:15:12 2017  Type: P  Check: 4452  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHASA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWYFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSSMLCYNI

     301  YWLVLIIVLS LMIFEERRGH LPFTKNLQLK HLNPGYWIKN KKKQELTEEQ

     351  KRQLFAKMEN INFNEDGEIN VQENYELPEQ TTSHSSSQNV ATDKEVLHVK

     401  ADSL*

Protein Sequence for YER145C_LalvinQA23 from AWRI:

YER145C_LalvinQA23 [source=AWRI]  Length: 347  Wed Nov 22 14:15:12 2017  Type: P  Check: 6327  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RAXYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHASA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWYFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSSMLCYNI

     301  YWLVLIIVLS LMIFEERRGH LPFTXKLTIE TLEPXILDQE QEKSRS*


Protein Sequence for YER145C_PW5 from WashU:

YER145C_PW5 [source=WashU]  Length: 405  Wed Nov 22 14:15:12 2017  Type: P  Check: 4452  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHASA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWYFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSSMLCYNI

     301  YWLVLIIVLS LMIFEERRGH LPFTKNLQLK HLNPGYWIKN KKKQELTEEQ

     351  KRQLFAKMEN INFNEDGEIN VQENYELPEQ TTSHSSSQNV ATDKEVLHVK

     401  ADSL*

Protein Sequence for YER145C_RM11-1a from Stanford:

YER145C_RM11-1a [source=Stanford]  Length: 405  Wed Nov 22 14:15:12 2017  Type: P  Check: 4452  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHASA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWYFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSSMLCYNI

     301  YWLVLIIVLS LMIFEERRGH LPFTKNLQLK HLNPGYWIKN KKKQELTEEQ

     351  KRQLFAKMEN INFNEDGEIN VQENYELPEQ TTSHSSSQNV ATDKEVLHVK

     401  ADSL*

Protein Sequence for YER145C_RedStar from Stanford:

YER145C_RedStar [source=Stanford]  Length: 405  Wed Nov 22 14:15:12 2017  Type: P  Check: 4452  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHASA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWYFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSSMLCYNI

     301  YWLVLIIVLS LMIFEERRGH LPFTKNLQLK HLNPGYWIKN KKKQELTEEQ

     351  KRQLFAKMEN INFNEDGEIN VQENYELPEQ TTSHSSSQNV ATDKEVLHVK

     401  ADSL*

Protein Sequence for YER145C_SEY6210 from Stanford:

YER145C_SEY6210 [source=Stanford]  Length: 405  Wed Nov 22 14:15:12 2017  Type: P  Check: 4452  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHASA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWYFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSSMLCYNI

     301  YWLVLIIVLS LMIFEERRGH LPFTKNLQLK HLNPGYWIKN KKKQELTEEQ

     351  KRQLFAKMEN INFNEDGEIN VQENYELPEQ TTSHSSSQNV ATDKEVLHVK

     401  ADSL*

Protein Sequence for YER145C_SK1 from Stanford:

YER145C_SK1 [source=Stanford]  Length: 405  Wed Nov 22 14:15:12 2017  Type: P  Check: 4452  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHASA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWYFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSSMLCYNI

     301  YWLVLIIVLS LMIFEERRGH LPFTKNLQLK HLNPGYWIKN KKKQELTEEQ

     351  KRQLFAKMEN INFNEDGEIN VQENYELPEQ TTSHSSSQNV ATDKEVLHVK

     401  ADSL*

Protein Sequence for YER145C_T7 from WashU:

YER145C_T7 [source=WashU]  Length: 405  Wed Nov 22 14:15:12 2017  Type: P  Check: 4452  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHASA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWYFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSSMLCYNI

     301  YWLVLIIVLS LMIFEERRGH LPFTKNLQLK HLNPGYWIKN KKKQELTEEQ

     351  KRQLFAKMEN INFNEDGEIN VQENYELPEQ TTSHSSSQNV ATDKEVLHVK

     401  ADSL*

Protein Sequence for YER145C_T73 from WashU:

YER145C_T73 [source=WashU]  Length: 405  Wed Nov 22 14:15:12 2017  Type: P  Check: 4506  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHASA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWYFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSYMLCYNI

     301  YWLVLIIVLS LMIFEERRGH LPFTKNLQLK HLNPGYWIKN KKKQELTEEQ

     351  KRQLFAKMEN INFNEDGEIN VQENYELPEQ TTSHSSSQNV ATDKEVLHVK

     401  ADSL*

Protein Sequence for YER145C_UC5 from WashU:

YER145C_UC5 [source=WashU]  Length: 405  Wed Nov 22 14:15:12 2017  Type: P  Check: 4357  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHASA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWFFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSSMLCYNI

     301  YWLVLIIVLS LMIFEERRGH LPFTKNLQLK HLNPGYWIKN KKKQELTEEQ

     351  KRQLFAKMEN INFNEDGEIN VQENYELPEQ TTSHSSSQNV ATDKEVLHVK

     401  ADSL*

Protein Sequence for YER145C_UWOPS05_217_3 from Stanford:

YER145C_UWOPS05_217_3 [source=Stanford]  Length: 405  Wed Nov 22 14:15:12 2017  Type: P  Check: 4452  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHASA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWYFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSSMLCYNI

     301  YWLVLIIVLS LMIFEERRGH LPFTKNLQLK HLNPGYWIKN KKKQELTEEQ

     351  KRQLFAKMEN INFNEDGEIN VQENYELPEQ TTSHSSSQNV ATDKEVLHVK

     401  ADSL*

Protein Sequence for YER145C_VL3 from AWRI:

YER145C_VL3 [source=AWRI]  Length: 365  Wed Nov 22 14:15:12 2017  Type: P  Check: 4297  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHASA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWYFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSSMLCYNI

     301  YWLVLIIVLS FNDIRRKAWS LAFHQKLTIE TLEPRILDQE QEKAGVDGRA

     351  KETTVCQDGE XQLQ*

Protein Sequence for YER145C_Vin13 from AWRI:

YER145C_Vin13 [source=AWRI]  Length: 312  Wed Nov 22 14:15:12 2017  Type: P  Check: 1496  ..

       1  MIATIMISMM GIPMLRMNKM QSKWRVKIAR SLVEIPHRKR DYFKIGFLSR

      51  RYAMFLLPFI TVLREGLEAV VFVAGAGITT QGSHASAYPL PVVVGLICGG

     101  LVGYLLYYGA SKSSLQIFLI LSTSILYLIS AGLFSRGAWY FENYRFNLAS

     151  GGDASEGGDG NGSYNIRKAV YHVNCCNPEL DNGWDIFNAL LGWQNTGYLS

     201  SMLCYNIYWL VLIIVLSLMI FEERXGHLPF TKNLQLKHLN PGYWIKNKKK

     251  QELTEEQKRQ LFAKMENINF NEDGEINVQE NYELPEQTTS HSSSQNVATD

     301  KEVLHVKADS L*

Protein Sequence for YER145C_W303 from Stanford:

YER145C_W303 [source=Stanford]  Length: 405  Wed Nov 22 14:15:12 2017  Type: P  Check: 4452  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHASA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWYFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSSMLCYNI

     301  YWLVLIIVLS LMIFEERRGH LPFTKNLQLK HLNPGYWIKN KKKQELTEEQ

     351  KRQLFAKMEN INFNEDGEIN VQENYELPEQ TTSHSSSQNV ATDKEVLHVK

     401  ADSL*

Protein Sequence for YER145C_X2180-1A from Stanford:

YER145C_X2180-1A [source=Stanford]  Length: 405  Wed Nov 22 14:15:12 2017  Type: P  Check: 4452  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHASA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWYFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSSMLCYNI

     301  YWLVLIIVLS LMIFEERRGH LPFTKNLQLK HLNPGYWIKN KKKQELTEEQ

     351  KRQLFAKMEN INFNEDGEIN VQENYELPEQ TTSHSSSQNV ATDKEVLHVK

     401  ADSL*

Protein Sequence for YER145C_Y55 from Stanford:

YER145C_Y55 [source=Stanford]  Length: 405  Wed Nov 22 14:15:12 2017  Type: P  Check: 4452  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHASA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWYFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSSMLCYNI

     301  YWLVLIIVLS LMIFEERRGH LPFTKNLQLK HLNPGYWIKN KKKQELTEEQ

     351  KRQLFAKMEN INFNEDGEIN VQENYELPEQ TTSHSSSQNV ATDKEVLHVK

     401  ADSL*

Protein Sequence for YER145C_YJM339 from Stanford:

YER145C_YJM339 [source=Stanford]  Length: 405  Wed Nov 22 14:15:12 2017  Type: P  Check: 4454  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHASA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWYFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSSMLCYNI

     301  YWLVLIIVLS LMIFEERRGH LPFTKNLQLK HLNPGYWIKN KKKQELTEDQ

     351  KRQLFAKMEN INFNEDGEIN VQENYELPEQ TTSHSSSQNV ATDKEVLHVK

     401  AGSL*

Protein Sequence for YER145C_YJM789 from Stanford:

YER145C_YJM789 [source=Stanford]  Length: 405  Wed Nov 22 14:15:12 2017  Type: P  Check: 4454  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHASA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWYFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSSMLCYNI

     301  YWLVLIIVLS LMIFEERRGH LPFTKNLQLK HLNPGYWIKN KKKQELTEDQ

     351  KRQLFAKMEN INFNEDGEIN VQENYELPEQ TTSHSSSQNV ATDKEVLHVK

     401  AGSL*

Protein Sequence for YER145C_YPH499 from Stanford:

YER145C_YPH499 [source=Stanford]  Length: 405  Wed Nov 22 14:15:12 2017  Type: P  Check: 4452  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHASA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWYFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSSMLCYNI

     301  YWLVLIIVLS LMIFEERRGH LPFTKNLQLK HLNPGYWIKN KKKQELTEEQ

     351  KRQLFAKMEN INFNEDGEIN VQENYELPEQ TTSHSSSQNV ATDKEVLHVK

     401  ADSL*

Protein Sequence for YER145C_YPS128 from Stanford:

YER145C_YPS128 [source=Stanford]  Length: 405  Wed Nov 22 14:15:12 2017  Type: P  Check: 4452  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHASA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWYFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSSMLCYNI

     301  YWLVLIIVLS LMIFEERRGH LPFTKNLQLK HLNPGYWIKN KKKQELTEEQ

     351  KRQLFAKMEN INFNEDGEIN VQENYELPEQ TTSHSSSQNV ATDKEVLHVK

     401  ADSL*

Protein Sequence for YER145C_YPS163 from Stanford:

YER145C_YPS163 [source=Stanford]  Length: 405  Wed Nov 22 14:15:12 2017  Type: P  Check: 4452  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHASA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWYFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSSMLCYNI

     301  YWLVLIIVLS LMIFEERRGH LPFTKNLQLK HLNPGYWIKN KKKQELTEEQ

     351  KRQLFAKMEN INFNEDGEIN VQENYELPEQ TTSHSSSQNV ATDKEVLHVK

     401  ADSL*

Protein Sequence for YER145C_YS9 from Stanford:

YER145C_YS9 [source=Stanford]  Length: 405  Wed Nov 22 14:15:12 2017  Type: P  Check: 4452  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHASA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWYFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSSMLCYNI

     301  YWLVLIIVLS LMIFEERRGH LPFTKNLQLK HLNPGYWIKN KKKQELTEEQ

     351  KRQLFAKMEN INFNEDGEIN VQENYELPEQ TTSHSSSQNV ATDKEVLHVK

     401  ADSL*

Protein Sequence for YER145C_ZTW1 from Zhejiang:

YER145C_ZTW1 [source=Zhejiang]  Length: 405  Wed Nov 22 14:15:12 2017  Type: P  Check: 4494  ..

       1  MPNKVFNVAV FFVVFRECLE AVIVISVLLS FLKQAIGEHD RALYRKLRIQ

      51  VWVGVLLGFI ICLAIGAGFI GAYYSLQKDI FGSAEDLWEG IFCMIATIMI

     101  SMMGIPMLRM NKMQSKWRVK IARSLVEIPH RKRDYFKIGF LSRRYAMFLL

     151  PFITVLREGL EAVVFVAGAG ITTQGSHGSA YPLPVVVGLI CGGLVGYLLY

     201  YGASKSSLQI FLILSTSILY LISAGLFSRG AWYFENYRFN LASGGDASEG

     251  GDGNGSYNIR KAVYHVNCCN PELDNGWDIF NALLGWQNTG YLSSMLCYNI

     301  YWLVLIIVLS LMIFEERRGH LPFTKNLQLK HLNPGYWIKN KKKQELTEEQ

     351  KRQLFAKMEN INFNEDGEIN VQENYELPEQ TTSHSSSQNV ATDKEVLHVK

     401  ADSL*