COX15/YER141W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YER141W_S288C   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_AWRI1631   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_AWRI796   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_BC187   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_BY4741   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_BY4742   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_CBS7960   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_CEN.PK   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_CLIB215   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_CLIB324   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_D273-10B   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_DBVPG6044   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_EC1118   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_EC9-8   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_FL100   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_FY1679   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_FostersB   
   --------------------------------------------------   
YER141W_FostersO   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_JAY291   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_JK9-3d   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_K11   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_Kyokai7   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_L1528   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_LalvinQA23   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_M22   
   --------------------------------------------------   
YER141W_PW5   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_RM11-1a   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_RedStar   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_SEY6210   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_SK1   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_T7   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_T73   
   --------------------------------------------------   
YER141W_UC5   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_UWOPS05_217_3   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_VL3   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_Vin13   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_W303   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_X2180-1A   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_Y55   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_YJM269   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_YJM339   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_YJM789   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRSISTIRQQIRKTQLYNFK   50
YER141W_YPH499   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_YPS128   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_YPS163   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_YS9   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
YER141W_ZTW1   1   MLFRNIEVGRQAAKLLTRTSSRLAWQSIGASRNISTIRQQIRKTQLYNFK   50
         

YER141W_S288C   51   KTVSIRPFSLSSPVFKPHVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_AWRI1631   51   KTVSIRPFSLSSPVFKPHVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_AWRI796   51   KTVSIRPFSLSSPVFKPHVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_BC187   51   KTVSIRPFSLSSPVFKPHVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_BY4741   51   KTVSIRPFSLSSPVFKPHVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_BY4742   51   KTVSIRPFSLSSPVFKPHVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_CBS7960   51   KTVSIRPFSLSSPVFKPRVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_CEN.PK   51   KTVSIRPFSLSSPVFKPHVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_CLIB215   51   KTVSIRPFSLSSPVFKPHVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_CLIB324   51   KTVSIRPFSLSSPVFKPRVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_D273-10B   51   KTVSIRPFSLSSPVFKPHVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_DBVPG6044   51   KTVSIRPFSLSSPVFKPHVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_EC1118   51   KTVSIRPFSLSSPVFKPHVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_EC9-8   51   KTVSIRPFSLSSPVFKPHVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_FL100   51   KTVSIRPFSLSSPVFKPHVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_FY1679   51   KTVSIRPFSLSSPVFKPHVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_FostersB   
   --------------------------------------------------   
YER141W_FostersO   51   KTVSIRPFSLSSPVFKPHVASESNPIESRLKTSKNVAYWLIGTXGLVFGI   100
YER141W_JAY291   51   KTVSIRPFSLSSPVFKPRVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_JK9-3d   51   KTVSIRPFSLSSPVFKPHVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_K11   51   KTVSIRPFSLSSPVFKPRVASEANPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_Kyokai7   51   KTVSIRPFSLSSPVFKPRVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_L1528   51   KTVSIRPFSLSSPVFKPHVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_LalvinQA23   51   KTVSIRPFSLSSPVFKPHVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_M22   
   --------------------------------------------------   
YER141W_PW5   51   KTVSIRPFSLSSPVFKPHVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_RM11-1a   51   KTVSIRPFSLSSPVFKPHVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_RedStar   51   KTVSIRPFSLSSPVFKPHVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_SEY6210   51   KTVSIRPFSLSSPVFKPHVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_SK1   51   KTVSIRPFSLSSPVFKPHVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_T7   51   KTVSIRPFSLSSPVFKPHVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_T73   
   --------------------------------------------------   
YER141W_UC5   51   KTVSIRPFSLSSPVFKPRVASEANPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_UWOPS05_217_3   51   KTVSIRPFSLSSPVFKPHVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_VL3   51   KTVSIRPFSLSSPVFKPHVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_Vin13   51   KTVSIRPFSLSSPVFKPHVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_W303   51   KTVSIRPFSLSSPVFKPHVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_X2180-1A   51   KTVSIRPFSLSSPVFKPHVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_Y55   51   KTVSIRPFSLSSPVFKPHVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_YJM269   51   KTVSIRPFSLSSPVFKPRVASEANPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_YJM339   51   KTVSIRPFSLSSPVFKPHVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_YJM789   51   KTVSIRPFSLSSPVFKPHVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_YPH499   51   KTVSIRPFSLSSPVFKPHVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_YPS128   51   KTVSIRPFSLSSPVFKPHVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_YPS163   51   KTVSIRPFSLSSPVFKPHVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_YS9   51   KTVSIRPFSLSSPVFKPHVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
YER141W_ZTW1   51   KTVSIRPFSLSSPVFKPRVASESNPIESRLKTSKNVAYWLIGTSGLVFGI   100
         

YER141W_S288C   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_AWRI1631   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_AWRI796   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_BC187   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_BY4741   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_BY4742   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_CBS7960   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_CEN.PK   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_CLIB215   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_CLIB324   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_D273-10B   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_DBVPG6044   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_EC1118   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_EC9-8   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_FL100   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_FY1679   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_FostersB   1   ----------------------------MNQKEWEEEFIKYKESPEFKLL   22
YER141W_FostersO   101   VVLGGLTRLTESGXSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_JAY291   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_JK9-3d   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_K11   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_Kyokai7   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_L1528   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_LalvinQA23   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_M22   
   --------------------------------------------------   
YER141W_PW5   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_RM11-1a   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_RedStar   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_SEY6210   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_SK1   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_T7   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_T73   
   --------------------------------------------------   
YER141W_UC5   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_UWOPS05_217_3   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_VL3   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_Vin13   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_W303   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_X2180-1A   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_Y55   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_YJM269   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_YJM339   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_YJM789   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_YPH499   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_YPS128   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_YPS163   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_YS9   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
YER141W_ZTW1   101   VVLGGLTRLTESGLSITEWKPVTGTLPPMNQKEWEEEFIKYKESPEFKLL   150
         

YER141W_S288C   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_AWRI1631   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_AWRI796   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_BC187   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_BY4741   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_BY4742   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_CBS7960   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_CEN.PK   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_CLIB215   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_CLIB324   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_D273-10B   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_DBVPG6044   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_EC1118   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_EC9-8   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_FL100   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_FY1679   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_FostersB   23   NSHXDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   72
YER141W_FostersO   151   NSHXDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKNFRPCQ--   198
YER141W_JAY291   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_JK9-3d   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_K11   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_Kyokai7   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_L1528   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_LalvinQA23   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_M22   
   --------------------------------------------------   
YER141W_PW5   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_RM11-1a   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_RedStar   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_SEY6210   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_SK1   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_T7   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_T73   1   --------------MEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   36
YER141W_UC5   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_UWOPS05_217_3   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_VL3   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_Vin13   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_W303   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_X2180-1A   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_Y55   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_YJM269   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_YJM339   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_YJM789   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_YPH499   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_YPS128   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_YPS163   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_YS9   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
YER141W_ZTW1   151   NSHIDLDEFKFIFFMEWIHRLWGRAIGAVFILPAVYFAVSKKTSGHVNKR   200
         

YER141W_S288C   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_AWRI1631   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_AWRI796   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_BC187   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_BY4741   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_BY4742   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_CBS7960   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_CEN.PK   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_CLIB215   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_CLIB324   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_D273-10B   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_DBVPG6044   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_EC1118   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_EC9-8   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_FL100   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_FY1679   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_FostersB   73   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   122
YER141W_FostersO   
   --------------------------------------------------   
YER141W_JAY291   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_JK9-3d   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_K11   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_Kyokai7   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_L1528   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_LalvinQA23   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_M22   
   --------------------------------------------------   
YER141W_PW5   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_RM11-1a   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_RedStar   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_SEY6210   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_SK1   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_T7   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_T73   37   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   86
YER141W_UC5   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_UWOPS05_217_3   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_VL3   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_Vin13   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_W303   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_X2180-1A   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_Y55   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_YJM269   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_YJM339   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_YJM789   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_YPH499   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_YPS128   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_YPS163   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_YS9   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
YER141W_ZTW1   201   LFGLAGLLGLQGFVGWWMVKSGLDQEQLDARKSKPTVSQYRLTTHLGTAF   250
         

YER141W_S288C   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_AWRI1631   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_AWRI796   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_BC187   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_BY4741   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_BY4742   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_CBS7960   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_CEN.PK   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_CLIB215   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_CLIB324   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_D273-10B   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_DBVPG6044   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_EC1118   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_EC9-8   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_FL100   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_FY1679   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_FostersB   123   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   172
YER141W_FostersO   
   --------------------------------------------------   
YER141W_JAY291   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_JK9-3d   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_K11   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_Kyokai7   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_L1528   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_LalvinQA23   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_M22   1   ----------------------------------------MRKISLALLA   10
YER141W_PW5   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_RM11-1a   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_RedStar   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_SEY6210   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_SK1   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_T7   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_T73   87   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   136
YER141W_UC5   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_UWOPS05_217_3   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_VL3   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_Vin13   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_W303   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_X2180-1A   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_Y55   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_YJM269   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_YJM339   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_YJM789   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_YPH499   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_YPS128   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_YPS163   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_YS9   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
YER141W_ZTW1   251   FLYMGMLWTGLEILRECKWIKNPVQAISLFKKLDNPAIGPMRKISLALLA   300
         

YER141W_S288C   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_AWRI1631   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_AWRI796   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_BC187   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_BY4741   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_BY4742   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_CBS7960   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_CEN.PK   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_CLIB215   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_CLIB324   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_D273-10B   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_DBVPG6044   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_EC1118   301   VSFLTSMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_EC9-8   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_FL100   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_FY1679   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_FostersB   173   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   222
YER141W_FostersO   
   --------------------------------------------------   
YER141W_JAY291   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_JK9-3d   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_K11   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_Kyokai7   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_L1528   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_LalvinQA23   301   VSFLTXMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_M22   11   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   60
YER141W_PW5   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_RM11-1a   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_RedStar   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_SEY6210   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_SK1   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_T7   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_T73   137   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   186
YER141W_UC5   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_UWOPS05_217_3   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_VL3   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_Vin13   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_W303   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_X2180-1A   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_Y55   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_YJM269   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_YJM339   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_YJM789   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_YPH499   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_YPS128   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_YPS163   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_YS9   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
YER141W_ZTW1   301   VSFLTAMSGGMVAGLDAGWVYNTWPKMGERWFPSSRELMDENFCRREDKK   350
         

YER141W_S288C   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_AWRI1631   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_AWRI796   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_BC187   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_BY4741   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_BY4742   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_CBS7960   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_CEN.PK   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_CLIB215   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_CLIB324   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_D273-10B   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_DBVPG6044   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_EC1118   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_EC9-8   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_FL100   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_FY1679   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_FostersB   223   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   272
YER141W_FostersO   
   --------------------------------------------------   
YER141W_JAY291   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_JK9-3d   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_K11   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_Kyokai7   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_L1528   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_LalvinQA23   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_M22   61   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   110
YER141W_PW5   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_RM11-1a   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_RedStar   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_SEY6210   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_SK1   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_T7   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_T73   187   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   236
YER141W_UC5   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_UWOPS05_217_3   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_VL3   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_Vin13   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_W303   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_X2180-1A   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_Y55   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_YJM269   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_YJM339   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_YJM789   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_YPH499   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_YPS128   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_YPS163   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_YS9   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
YER141W_ZTW1   351   DLWWRNLLENPVTVQLVHRTCAYVAFTSVLAAHMYAIKKKAVIPRNAMTS   400
         

YER141W_S288C   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_AWRI1631   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_AWRI796   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_BC187   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_BY4741   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_BY4742   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_CBS7960   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_CEN.PK   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_CLIB215   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_CLIB324   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_D273-10B   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_DBVPG6044   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_EC1118   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_EC9-8   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_FL100   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_FY1679   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_FostersB   273   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   322
YER141W_FostersO   
   --------------------------------------------------   
YER141W_JAY291   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_JK9-3d   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_K11   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_Kyokai7   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_L1528   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_LalvinQA23   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_M22   111   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   160
YER141W_PW5   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_RM11-1a   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_RedStar   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_SEY6210   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_SK1   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_T7   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_T73   237   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   286
YER141W_UC5   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_UWOPS05_217_3   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_VL3   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_Vin13   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_W303   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_X2180-1A   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_Y55   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_YJM269   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_YJM339   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_YJM789   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_YPH499   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_YPS128   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_YPS163   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_YS9   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
YER141W_ZTW1   401   LHVMMGVVTLQATLGILTILYLVPISLASIHQAGALALLTSSLVFASQLR   450
         

YER141W_S288C   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_AWRI1631   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_AWRI796   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_BC187   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_BY4741   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_BY4742   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_CBS7960   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_CEN.PK   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_CLIB215   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_CLIB324   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_D273-10B   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_DBVPG6044   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_EC1118   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_EC9-8   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_FL100   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_FY1679   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_FostersB   323   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   358
YER141W_FostersO   
   ------------------------------------   
YER141W_JAY291   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_JK9-3d   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_K11   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_Kyokai7   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_L1528   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_LalvinQA23   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_M22   161   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   196
YER141W_PW5   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_RM11-1a   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_RedStar   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_SEY6210   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_SK1   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_T7   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_T73   287   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   322
YER141W_UC5   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_UWOPS05_217_3   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_VL3   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_Vin13   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_W303   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_X2180-1A   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_Y55   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_YJM269   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_YJM339   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_YJM789   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_YPH499   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_YPS128   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_YPS163   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_YS9   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
YER141W_ZTW1   451   KPRAPMRNVIITLPHSSKVTSGKILSEASKLASKPL   486
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YER141W_S288C from SGD:

YER141W_S288C [source=SGD]  Length: 487  Mon Oct 23 06:38:32 2017  Type: P  Check: 1427  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPHVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_AWRI1631 from AWRI:

YER141W_AWRI1631 [source=AWRI]  Length: 487  Mon Oct 23 06:38:32 2017  Type: P  Check: 1427  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPHVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_AWRI796 from AWRI:

YER141W_AWRI796 [source=AWRI]  Length: 487  Mon Oct 23 06:38:32 2017  Type: P  Check: 1427  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPHVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_BC187 from Stanford:

YER141W_BC187 [source=Stanford]  Length: 487  Mon Oct 23 06:38:32 2017  Type: P  Check: 1427  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPHVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_BY4741 from Stanford:

YER141W_BY4741 [source=Stanford]  Length: 487  Mon Oct 23 06:38:32 2017  Type: P  Check: 1427  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPHVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_BY4742 from Stanford:

YER141W_BY4742 [source=Stanford]  Length: 487  Mon Oct 23 06:38:32 2017  Type: P  Check: 1427  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPHVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_CBS7960 from WashU:

YER141W_CBS7960 [source=WashU]  Length: 487  Mon Oct 23 06:38:32 2017  Type: P  Check: 1537  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPRVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_CEN.PK from Stanford:

YER141W_CEN.PK [source=Stanford]  Length: 487  Mon Oct 23 06:38:32 2017  Type: P  Check: 1427  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPHVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_CLIB215 from WashU:

YER141W_CLIB215 [source=WashU]  Length: 487  Mon Oct 23 06:38:32 2017  Type: P  Check: 1427  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPHVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_CLIB324 from WashU:

YER141W_CLIB324 [source=WashU]  Length: 487  Mon Oct 23 06:38:32 2017  Type: P  Check: 1537  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPRVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_D273-10B from Stanford:

YER141W_D273-10B [source=Stanford]  Length: 487  Mon Oct 23 06:38:32 2017  Type: P  Check: 1427  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPHVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_DBVPG6044 from Stanford:

YER141W_DBVPG6044 [source=Stanford]  Length: 487  Mon Oct 23 06:38:32 2017  Type: P  Check: 1427  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPHVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_EC1118 from Genoscope:

YER141W_EC1118 [source=Genoscope]  Length: 487  Mon Oct 23 06:38:32 2017  Type: P  Check: 1805  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPHVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTSMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_EC9-8 from ASinica:

YER141W_EC9-8 [source=ASinica]  Length: 487  Mon Oct 23 06:38:32 2017  Type: P  Check: 1427  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPHVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_FL100 from Stanford:

YER141W_FL100 [source=Stanford]  Length: 487  Mon Oct 23 06:38:33 2017  Type: P  Check: 1427  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPHVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_FY1679 from Stanford:

YER141W_FY1679 [source=Stanford]  Length: 487  Mon Oct 23 06:38:33 2017  Type: P  Check: 1427  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPHVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_FostersB from AWRI:

YER141W_FostersB [source=AWRI]  Length: 359  Mon Oct 23 06:38:33 2017  Type: P  Check: 1557  ..

       1  MNQKEWEEEF IKYKESPEFK LLNSHXDLDE FKFIFFMEWI HRLWGRAIGA

      51  VFILPAVYFA VSKKTSGHVN KRLFGLAGLL GLQGFVGWWM VKSGLDQEQL

     101  DARKSKPTVS QYRLTTHLGT AFFLYMGMLW TGLEILRECK WIKNPVQAIS

     151  LFKKLDNPAI GPMRKISLAL LAVSFLTAMS GGMVAGLDAG WVYNTWPKMG

     201  ERWFPSSREL MDENFCRRED KKDLWWRNLL ENPVTVQLVH RTCAYVAFTS

     251  VLAAHMYAIK KKAVIPRNAM TSLHVMMGVV TLQATLGILT ILYLVPISLA

     301  SIHQAGALAL LTSSLVFASQ LRKPRAPMRN VIITLPHSSK VTSGKILSEA

     351  SKLASKPL*

Protein Sequence for YER141W_FostersO from AWRI:

YER141W_FostersO [source=AWRI]  Length: 199  Mon Oct 23 06:38:33 2017  Type: P  Check: 3378  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPHVA SESNPIESRL KTSKNVAYWL IGTXGLVFGI

     101  VVLGGLTRLT ESGXSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHXDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKNFRPCQ*


Protein Sequence for YER141W_JAY291 from Duke:

YER141W_JAY291 [source=Duke]  Length: 487  Mon Oct 23 06:38:33 2017  Type: P  Check: 1537  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPRVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_JK9-3d from Stanford:

YER141W_JK9-3d [source=Stanford]  Length: 487  Mon Oct 23 06:38:33 2017  Type: P  Check: 1427  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPHVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_K11 from Stanford:

YER141W_K11 [source=Stanford]  Length: 487  Mon Oct 23 06:38:33 2017  Type: P  Check: 1249  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPRVA SEANPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_Kyokai7 from NRIB:

YER141W_Kyokai7 [source=NRIB]  Length: 487  Mon Oct 23 06:38:33 2017  Type: P  Check: 1537  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPRVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_L1528 from Stanford:

YER141W_L1528 [source=Stanford]  Length: 487  Mon Oct 23 06:38:33 2017  Type: P  Check: 1427  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPHVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_LalvinQA23 from AWRI:

YER141W_LalvinQA23 [source=AWRI]  Length: 487  Mon Oct 23 06:38:33 2017  Type: P  Check: 1910  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPHVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTXMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_M22 from WashU:

YER141W_M22 [source=WashU]  Length: 197  Mon Oct 23 06:38:33 2017  Type: P  Check: 6332  ..

       1  MRKISLALLA VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD

      51  ENFCRREDKK DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK

     101  AVIPRNAMTS LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT

     151  SSLVFASQLR KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*


Protein Sequence for YER141W_PW5 from WashU:

YER141W_PW5 [source=WashU]  Length: 487  Mon Oct 23 06:38:33 2017  Type: P  Check: 1427  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPHVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_RM11-1a from Stanford:

YER141W_RM11-1a [source=Stanford]  Length: 487  Mon Oct 23 06:38:33 2017  Type: P  Check: 1427  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPHVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_RedStar from Stanford:

YER141W_RedStar [source=Stanford]  Length: 487  Mon Oct 23 06:38:33 2017  Type: P  Check: 1427  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPHVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_SEY6210 from Stanford:

YER141W_SEY6210 [source=Stanford]  Length: 487  Mon Oct 23 06:38:33 2017  Type: P  Check: 1427  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPHVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_SK1 from Stanford:

YER141W_SK1 [source=Stanford]  Length: 487  Mon Oct 23 06:38:33 2017  Type: P  Check: 1427  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPHVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_T7 from WashU:

YER141W_T7 [source=WashU]  Length: 487  Mon Oct 23 06:38:33 2017  Type: P  Check: 1427  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPHVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_T73 from WashU:

YER141W_T73 [source=WashU]  Length: 323  Mon Oct 23 06:38:33 2017  Type: P  Check: 729  ..

       1  MEWIHRLWGR AIGAVFILPA VYFAVSKKTS GHVNKRLFGL AGLLGLQGFV

      51  GWWMVKSGLD QEQLDARKSK PTVSQYRLTT HLGTAFFLYM GMLWTGLEIL

     101  RECKWIKNPV QAISLFKKLD NPAIGPMRKI SLALLAVSFL TAMSGGMVAG

     151  LDAGWVYNTW PKMGERWFPS SRELMDENFC RREDKKDLWW RNLLENPVTV

     201  QLVHRTCAYV AFTSVLAAHM YAIKKKAVIP RNAMTSLHVM MGVVTLQATL

     251  GILTILYLVP ISLASIHQAG ALALLTSSLV FASQLRKPRA PMRNVIITLP

     301  HSSKVTSGKI LSEASKLASK PL*

Protein Sequence for YER141W_UC5 from WashU:

YER141W_UC5 [source=WashU]  Length: 487  Mon Oct 23 06:38:33 2017  Type: P  Check: 1249  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPRVA SEANPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_UWOPS05_217_3 from Stanford:

YER141W_UWOPS05_217_3 [source=Stanford]  Length: 487  Mon Oct 23 06:38:33 2017  Type: P  Check: 1427  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPHVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_VL3 from AWRI:

YER141W_VL3 [source=AWRI]  Length: 487  Mon Oct 23 06:38:33 2017  Type: P  Check: 1427  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPHVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_Vin13 from AWRI:

YER141W_Vin13 [source=AWRI]  Length: 487  Mon Oct 23 06:38:33 2017  Type: P  Check: 1427  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPHVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_W303 from Stanford:

YER141W_W303 [source=Stanford]  Length: 487  Mon Oct 23 06:38:33 2017  Type: P  Check: 1427  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPHVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_X2180-1A from Stanford:

YER141W_X2180-1A [source=Stanford]  Length: 487  Mon Oct 23 06:38:33 2017  Type: P  Check: 1427  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPHVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_Y55 from Stanford:

YER141W_Y55 [source=Stanford]  Length: 487  Mon Oct 23 06:38:33 2017  Type: P  Check: 1427  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPHVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_YJM269 from WashU:

YER141W_YJM269 [source=WashU]  Length: 487  Mon Oct 23 06:38:33 2017  Type: P  Check: 1249  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPRVA SEANPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_YJM339 from Stanford:

YER141W_YJM339 [source=Stanford]  Length: 487  Mon Oct 23 06:38:33 2017  Type: P  Check: 1427  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPHVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_YJM789 from Stanford:

YER141W_YJM789 [source=Stanford]  Length: 487  Mon Oct 23 06:38:33 2017  Type: P  Check: 1592  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRSISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPHVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_YPH499 from Stanford:

YER141W_YPH499 [source=Stanford]  Length: 487  Mon Oct 23 06:38:33 2017  Type: P  Check: 1427  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPHVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_YPS128 from Stanford:

YER141W_YPS128 [source=Stanford]  Length: 487  Mon Oct 23 06:38:33 2017  Type: P  Check: 1427  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPHVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_YPS163 from Stanford:

YER141W_YPS163 [source=Stanford]  Length: 487  Mon Oct 23 06:38:33 2017  Type: P  Check: 1427  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPHVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_YS9 from Stanford:

YER141W_YS9 [source=Stanford]  Length: 487  Mon Oct 23 06:38:33 2017  Type: P  Check: 1427  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPHVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*

Protein Sequence for YER141W_ZTW1 from Zhejiang:

YER141W_ZTW1 [source=Zhejiang]  Length: 487  Mon Oct 23 06:38:33 2017  Type: P  Check: 1537  ..

       1  MLFRNIEVGR QAAKLLTRTS SRLAWQSIGA SRNISTIRQQ IRKTQLYNFK

      51  KTVSIRPFSL SSPVFKPRVA SESNPIESRL KTSKNVAYWL IGTSGLVFGI

     101  VVLGGLTRLT ESGLSITEWK PVTGTLPPMN QKEWEEEFIK YKESPEFKLL

     151  NSHIDLDEFK FIFFMEWIHR LWGRAIGAVF ILPAVYFAVS KKTSGHVNKR

     201  LFGLAGLLGL QGFVGWWMVK SGLDQEQLDA RKSKPTVSQY RLTTHLGTAF

     251  FLYMGMLWTG LEILRECKWI KNPVQAISLF KKLDNPAIGP MRKISLALLA

     301  VSFLTAMSGG MVAGLDAGWV YNTWPKMGER WFPSSRELMD ENFCRREDKK

     351  DLWWRNLLEN PVTVQLVHRT CAYVAFTSVL AAHMYAIKKK AVIPRNAMTS

     401  LHVMMGVVTL QATLGILTIL YLVPISLASI HQAGALALLT SSLVFASQLR

     451  KPRAPMRNVI ITLPHSSKVT SGKILSEASK LASKPL*