FLO8/YER109C S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YER109C_S288C   1   MSYKVNSSYPDSIPPTEQPYMASQYKQDLQSNIAMATNSEQQRQQQQQQQ   50
YER109C_AWRI1631   1   MSYKVNSSYPDSIPPTEQPYMASQYKQDLQSNIAMATNSEQQRQQQQQQQ   50
YER109C_AWRI796   
   --------------------------------------------------   
YER109C_BC187   1   MSYKVNSSYPDSIPPTEQPYMASQYKQDLQSNIAMATNSEQQRQQQQQQQ   50
YER109C_BY4741   
   --------------------------------------------------   
YER109C_BY4742   
   --------------------------------------------------   
YER109C_CBS7960   1   MSYKVNSSYPDSIPPTEQPYMASQYKQDLQSNIAMATNSEQQRQQQQQQQ   50
YER109C_CEN.PK   1   MSYKVNSSYPDSIPPTEQPYMASQYKQDLQSNIAMATNSEQQRQQQQ---   47
YER109C_CLIB324   1   MSYKVNSSYPDSIPPTEQPYMASQYKQDLQSNIAMATNSEQQRQQQQQQQ   50
YER109C_D273-10B   
   --------------------------------------------------   
YER109C_DBVPG6044   1   MSYKVNSSYPDSIPPTEQPYMASQYKQDLQSNIAMATNSEQQRQQQQ---   47
YER109C_EC1118   1   MSYKVNSSYPDSIPPTEQPYMASQYKQDLQSNIAMATNSEQQRQQQQQQQ   50
YER109C_FL100   1   MSYKVNSSYPDSIPPTEQPYMASQYKQDLQSNIAMATNSEQQRQQQQQQQ   50
YER109C_FY1679   
   --------------------------------------------------   
YER109C_FostersB   1   MSYKVNSSYPDSIPPTEQPYMASQYKQDLQSNIAMATNSEQQRQQQQQQQ   50
YER109C_FostersO   
   --------------------------------------------------   
YER109C_JAY291   1   MSYKVNSSYPDSIPPTEQPYMASQYKQDLQSNIAMATNSEQQRQQQQQQQ   50
YER109C_JK9-3d   
   --------------------------------------------------   
YER109C_K11   1   MSYKVNSSYPDSIPPTEQPYMASQYKQDLQSNIAMATNSEQQRQQQQQQQ   50
YER109C_Kyokai7   1   MSYKVNSSYPDSIPPTEQPYMASQYKQDLQSNIAMATNSEQQRQQQQQQQ   50
YER109C_L1528   1   MSYKVNSSYPDSIPPTEQPYMASQYKQDLQSNIAMATNSEQQRQQQQQQQ   50
YER109C_LalvinQA23   
   --------------------------------------------------   
YER109C_M22   1   MSYKVNSSYPDSIPPTEQPYMASQYKQDLQSNIAMATNSEQQRQQQQQQQ   50
YER109C_PW5   1   MSYKVNSSYPDSIPPTEQPYMASQYKQDLQSNIAMATNSEQQRQQQQQQ-   49
YER109C_RM11-1a   
   --------------------------------------------------   
YER109C_SEY6210   
   --------------------------------------------------   
YER109C_SK1   1   MSYKVNSSYPDSIPPTEQPYMASQYKQDLQSNIAMATNSEQQRQQQQQQQ   50
YER109C_T7   1   MSYKVNSSYPDSIPPTEQPYMASQYKQDLQSNIAMATNSEQQRQQQQQQQ   50
YER109C_T73   
   --------------------------------------------------   
YER109C_UC5   1   MSYKVNSSYPDSIPPTEQPYMASQYKQDLQSNIAMATNSEQQRQQQQQQQ   50
YER109C_UWOPS05_217_3   1   ---MSYKVNSSYPDSIPPTEQPYMASQYKQDLQSNIAMATNSEQQRQQQQ   47
YER109C_VL3   1   MSYKVNSSYPDSIPPTEQPYMASQYKQDLQSNIAMATNSEQQRQQQQQQQ   50
YER109C_Vin13   1   MSYKVNSSYPDSIPPTEQPYMASQYKQDLQSNIAMATNSEQQRQQQQQQQ   50
YER109C_W303   
   --------------------------------------------------   
YER109C_X2180-1A   
   --------------------------------------------------   
YER109C_Y10   1   MSYKVNSSYPDSIPPTEQPYMASQYKQDLQSNIAMATNSEQQRQQQQQQQ   50
YER109C_Y55   1   MSYKVNSSYPDSIPPTEQPYMASQYKQDLQSNIAMATNSEQQRQQQQ---   47
YER109C_YJM269   1   MSYKVNSSYPDSIPPTEQPYMASQYKQDLQSNIAMATNSEQQRQQQQQQQ   50
YER109C_YJM339   1   MSYKVNSSYPDSIPPTEQPYMASQYKQDLQSNIAMATNSEQQRQQQQQQQ   50
YER109C_YJM789   1   MSYKVNSSYPDSIPPTEQPYMASQYKQDLQSNIAMATNSEQQRQQQQQQQ   50
YER109C_YPH499   
   --------------------------------------------------   
YER109C_YPS128   1   MSYKVNSSYPDSIPPTEQPYMASQYKQDLQSNIAMATNSEQQRQQQQQQQ   50
YER109C_YPS163   1   MSYKVNSSYPDSIPPTEQPYMASQYKQDLQSNIAMATNSEQQRQQQQQQQ   50
YER109C_YS9   1   MSYKVNSSYPDSIPPTEQPYMASQYKQDLQSNIAMATNSEQQRQQQQQQQ   50
YER109C_ZTW1   1   MSYKVNSSYPDSIPPTEQPYMASQYKQDLQSNIAMATNSEQQRQQQQQQQ   50
         

YER109C_S288C   51   QQQQQW---INQPTAENSDLKEKMNCKNTLNEYIFDFLTKSSLKNTAAAF   97
YER109C_AWRI1631   51   QQQQQ---WINQPTAENSDLKEKMNCKNTLNEYIFDFLTKSSLKNTAAAF   97
YER109C_AWRI796   
   --------------------------------------------------   
YER109C_BC187   51   QQQQQ---WINQPTAENSDLKEKMNCKNTLNEYIFDFLMKSSLKNTAAAF   97
YER109C_BY4741   
   --------------------------------------------------   
YER109C_BY4742   
   --------------------------------------------------   
YER109C_CBS7960   51   QQQQQ---WINQPTAENSDLKEKMNCKNTLNEYIFDFLTKSSLKNTAAAF   97
YER109C_CEN.PK   48   --------WINQPTAENSDLKEKMNCKNTLNEYIFDFLTKSSLKNTAAAF   89
YER109C_CLIB324   51   QQQQQ---WINQPTAENSDLKEKMNCKNTLNEYIFDFLTKSSLKNTAAAF   97
YER109C_D273-10B   
   --------------------------------------------------   
YER109C_DBVPG6044   48   --------WINQPTAENSDLKEKMNCKNTLNEYIFDFLTKSSLKNTAAAF   89
YER109C_EC1118   51   QQQQQ---WINQPTAENSDLKEKMNCKNTLNEYIFDFLTKSSLKNTAAAF   97
YER109C_FL100   51   QQQQQW---INQPTAENSDLKEKMNCKNTLNEYIFDFLTKSSLKNTAAAF   97
YER109C_FY1679   
   --------------------------------------------------   
YER109C_FostersB   51   QQQQQQQ-WINQPTAENSDLKEKMNCKNTLNEYIFDFLTKSSLKNTAAAF   99
YER109C_FostersO   
   --------------------------------------------------   
YER109C_JAY291   51   QQQQQQQQWINQPTAENSDLKEKMNCKNTLNEYIFDFLTKSSLKNTAAAF   100
YER109C_JK9-3d   
   --------------------------------------------------   
YER109C_K11   51   QQQQQ---WINQPTAENSDLKEKMNCKNTLNEYIFDFLTKSSLKNTAAAF   97
YER109C_Kyokai7   51   QQQQQ---WINQPTAENSDLKEKMNCKNTLNEYIFDFLTKSSLKNTAAAF   97
YER109C_L1528   51   QQQQQ---WINQPTAENSDLKEKMNCKNTLNEYIFDFLTKSSLKNTAAAF   97
YER109C_LalvinQA23   1   ------------------------------MSTYLXFLTKSSLKNTAAAF   20
YER109C_M22   51   QQQQQ---WINQPTAENSDLKEKMNCKNTLNEYIFDFLTKSSLKNTAAAF   97
YER109C_PW5   50   ----QQQQWINPPTAENSDLKEKMNSKNTLNEYIFDFLTKSSLKNTAAAF   95
YER109C_RM11-1a   
   --------------------------------------------------   
YER109C_SEY6210   
   --------------------------------------------------   
YER109C_SK1   51   QQQQQW---INQPTAENSDLKEKMNCKNTLNEYIFDFLTKSSLKNTAAAF   97
YER109C_T7   51   QQQQQ---WINQPTAENSDLKEKMNCKNTLNEYIFDFLTKSSLKNTAAAF   97
YER109C_T73   1   -----------------------MNCKNTLNEYIFDFLTKSSLKNTAAAF   27
YER109C_UC5   51   QQQQQ---WINQPTAENSDLKEKMNCKNTLNEYIFDFLTKSSLKNTAAAF   97
YER109C_UWOPS05_217_3   48   QQQQQQQQWINQPTAENSDLKEKMNCKNTLNEYIFDFLTKSSLKNTAAAF   97
YER109C_VL3   51   QQQQQ---WINQPTAENSDLKEKMNCKNTLNEYIFDFLTKSSLKNTAAAF   97
YER109C_Vin13   51   QQQQQ---WINQPTAENSDLKEKMNCKNTLNEYIFDFLTKSSLKNTAAAF   97
YER109C_W303   
   --------------------------------------------------   
YER109C_X2180-1A   
   --------------------------------------------------   
YER109C_Y10   51   QQQQQ---WINQPTAENSDLKEKMNCKNTLNEYIFDFLTKSSLKNTAAAF   97
YER109C_Y55   48   --------WINQPTAENSDLKEKMNCKNTLNEYIFDFLTKSSLKNTAAAF   89
YER109C_YJM269   51   QQQ---QQWINQPTAENSDLKEKMNCKNTLNEYIFDFLTKSSLKNTAAAF   97
YER109C_YJM339   51   QQQQQ---WINQPTAENSDLKEKMNCKNTLNEYIFDFLTKSSLKNTAAAF   97
YER109C_YJM789   51   QQQQQ---WINQPTAENSDLKEKMNCKNTLNEYIFDFLTKSSLKNTAAAF   97
YER109C_YPH499   
   --------------------------------------------------   
YER109C_YPS128   51   QQQQQ--QWINQPTAENSDLKEKMNCKNTLNEYIFDFLTKSSLKNTAAAF   98
YER109C_YPS163   51   QQQQQ--QWINQPTAENSDLKEKMNCKNTLNEYIFDFLTKSSLKNTAAAF   98
YER109C_YS9   51   QQQQQ---WINQPTAENSDLKEKMNCKNTLNEYIFDFLTKSSLKNTAAAF   97
YER109C_ZTW1   51   QQQQQ---WINQPTAENSDLKEKMNCKNTLNEYIFDFLTKSSLKNTAAAF   97
         

YER109C_S288C   98   AQDAHLDRDKGQNPVDGPKSKENNGNQNTFSKVVDTPQGFLYEWQ-IFWD   146
YER109C_AWRI1631   98   AQDAHLDRDKGQNPIDGPKSKENNGNQNTFSKVVDTPQGFLYEWWQIFWD   147
YER109C_AWRI796   
   --------------------------------------------------   
YER109C_BC187   98   AQDAHLDRDKGQNPVDGPKSKENNGNQNTFSKVVDTPQGFLYEWWQIFWD   147
YER109C_BY4741   
   --------------------------------------------------   
YER109C_BY4742   
   --------------------------------------------------   
YER109C_CBS7960   98   AQDAHLDRDKGQNPVDGPKSKENNGNQNTFSRVVDTPQGFLYEWWQIFWD   147
YER109C_CEN.PK   90   AQDAHLDRDKGQNPIDGPKSKENNGNQNTFSKVVDTPQGFLYEWWQIFWD   139
YER109C_CLIB324   98   AQDAHLDRDKGQNPVDGPKSKENNGNQNTFSRVVDTPQGFLYEWWQIFWD   147
YER109C_D273-10B   
   --------------------------------------------------   
YER109C_DBVPG6044   90   AQDAHLDRDKGQNPIDGPKSKENNGNQNTFSKVVDTPQGFLYEWWQIFWD   139
YER109C_EC1118   98   AQDAHLDRDKGQNPIDGPKSKENNGNQNTFSKVVDTPQGFLYEWWQIFWD   147
YER109C_FL100   98   AQDAHLDRDKGQNPVDGPKSKENNGNQNTFSKVVDTPQGFLYEWWQIFWD   147
YER109C_FY1679   
   --------------------------------------------------   
YER109C_FostersB   100   AQDAHLDRDKGQNPIDXPKSKENNGNQNTFSKVVDTPQGFLYEWWQIFWD   149
YER109C_FostersO   
   --------------------------------------------------   
YER109C_JAY291   101   AQDAHLDRDKGQNPIDGPKSKENNGNQNTFSKVVDTPQGFLYEWWQIFWD   150
YER109C_JK9-3d   
   --------------------------------------------------   
YER109C_K11   98   AQDAHLDRDKGQNPIDGPKSKENNGNQNTFSKVVDTPQGFLYEWWQIFWD   147
YER109C_Kyokai7   98   AQDAHLDRDKGQNPIDGPKSKENNGNQNTFSKVVDTPQGFLYEWWQIFWD   147
YER109C_L1528   98   AQDAHLDRDKGQNPVDGPKSKENNGNQNTFSKVVDTPQGFLYEWWQIFWD   147
YER109C_LalvinQA23   21   AQDAHLDRDKGQNPIDGPKSKENNGNQNTFSKVVDTPQGFLYEWWQIFWD   70
YER109C_M22   98   AQDAHLDRDKGQNPIDGPKSKENNGNQNTFSKVVDTPQGFLYEWWQIFWD   147
YER109C_PW5   96   AQDAHLDRDKGQNPIDGPKSKENNGNQNTFSKVVDTPQGFLYEWWQIFWD   145
YER109C_RM11-1a   
   --------------------------------------------------   
YER109C_SEY6210   
   --------------------------------------------------   
YER109C_SK1   98   AQDAHLDRDKGQNPVDGPKSKENNGNQNTFSKVVDTPQGFLYEWWQIFWD   147
YER109C_T7   98   AQDAHLDRDKGQNPIDGPKSKENNGNQNTFSKVVDTPQGFLYEWWQIFWD   147
YER109C_T73   28   AQDAHLDRDKGQNPVDGPKSKENNGNQNTFSRVVDTPQGFLYEWWQIFWD   77
YER109C_UC5   98   AQDAHLDRDKGQNPIDGPKSKENNGNQNTFSKVVDTPQGFLYEWWQIFWD   147
YER109C_UWOPS05_217_3   98   AQDAHLDRDKGQNPIDGPKSKENNGNQNTFSKVVDTPQGFLYEWWQIFWD   147
YER109C_VL3   98   AQDAHLDRDKGQNPIDGPKSKENNGNQNTFSKVVDTPQGFLYEWWQIFWD   147
YER109C_Vin13   98   AQDAHLDRDKGQNPXDGPKSKENNGNQNTFSKVVDTPQGFLYEWWQIFWD   147
YER109C_W303   
   --------------------------------------------------   
YER109C_X2180-1A   
   --------------------------------------------------   
YER109C_Y10   98   AQDAHLDRDKGQNPVDGPKSKENNGNQNTFSKVVDTPQGFLYEWWQIFWD   147
YER109C_Y55   90   AQDAHLDRDKGQNPIDGPKSKENNGNQNTFSKVVDTPQGFLYEWWQIFWD   139
YER109C_YJM269   98   AQDAHLDRDKGQNPIDGPKSKENNGNQNTFSKVVDTPQGFLYEWWQIFWD   147
YER109C_YJM339   98   AQDAHLDRDKGQNPVDGPKSKENNGNQNTFSKVVDTPQGFLYEWWQIFWD   147
YER109C_YJM789   98   AQDAHLDRDKGQNPVDGPKSKENNGNQNTFSKVVDTPQGFLYEWWQIFWD   147
YER109C_YPH499   
   --------------------------------------------------   
YER109C_YPS128   99   AQDAHLDRDKGQNPIDGPKSKENNGNQNTFSKVVDTPQGFLYEWWQIFWD   148
YER109C_YPS163   99   AQDAHLDRDKGQNPIDGPKSKENNGNQNTFSKVVDTPQGFLYEWWQIFWD   148
YER109C_YS9   98   AQDAHLDRDKGQNPIDGPKSKENNGNQNTFSKVVDTPQGFLYEWWQIFWD   147
YER109C_ZTW1   98   AQDAHLDRDKGQNPVDGPKSKENNGNQNTFSKVVDTPQGFLYEWWQIFWD   147
         

YER109C_S288C   147   IFNTSSSRGGSEFAQQYYQLVLQEQRQEQIYRSLAVHAARLQHDAERRGE   196
YER109C_AWRI1631   148   IFNTSSSRGGSEFAQQYYQLVLQEQRQEQIYRSLAVHAARLQHDAERRGE   197
YER109C_AWRI796   
   --------------------------------------------------   
YER109C_BC187   148   IFNTSSSRGGSEFAQQYYQLVLQEQRQEQIYRSLAVHAARLQHDAERRGE   197
YER109C_BY4741   
   --------------------------------------------------   
YER109C_BY4742   
   --------------------------------------------------   
YER109C_CBS7960   148   IFNTSSSRGGSEFAQQYYQLVLQEQRQEQIYRSLAVHAARLQHDAERRGE   197
YER109C_CEN.PK   140   IFNTSSSRGGSEFAQQYYQLVLQEQRQEQIYRSLAAHAARLQHDAERRGE   189
YER109C_CLIB324   148   IFNTSSSRGGSEFAQQYYQLVLQEQRQEQIYRSLAVHAARLQHDAERRGE   197
YER109C_D273-10B   
   --------------------------------------------------   
YER109C_DBVPG6044   140   IFNTSSSRGGSEFAQQYYQLVLQEQRQEQIYRSLAAHAARLQHDAERRGE   189
YER109C_EC1118   148   IFNTSSSRGGSEFAQQYYQLVLQEQRQEQIYRSLAVHAARLQHDAERRGE   197
YER109C_FL100   148   IFNTSSSRGGSEFAQQYYQLVLQEQRQEQIYRSLAVHAARLQHDAERRGE   197
YER109C_FY1679   
   --------------------------------------------------   
YER109C_FostersB   150   IFNTSSSRGGSEFAQQYYQLVLQEQRQEQIYRSLAVHAARLQHDAERRGE   199
YER109C_FostersO   
   --------------------------------------------------   
YER109C_JAY291   151   IFNTSSSRGGSEFAQQYYQLVLQEQRQEQIYRSLAVHAARLQHDAERRGE   200
YER109C_JK9-3d   
   --------------------------------------------------   
YER109C_K11   148   IFNTSSSRGGSEFAQQYYQLVLQEQRQEQIYRSLAVHAARLQHDAERRGG   197
YER109C_Kyokai7   148   IFNTSSSRGGSEFAQQYYQLVLQEQRQEQIYRSLAVHAARLQHDAERRGG   197
YER109C_L1528   148   IFNTSSSRGGSEFAQQYYQLVLQEQRQEQIYRSLAVHAARLQHDAERRGE   197
YER109C_LalvinQA23   71   IFNTSSSRGGSEFXQQYYQLVLQEQRQEQIYRSLAVHAARLQHDAERRGE   120
YER109C_M22   148   IFNTSSSRGGSEFAQQYYQLVLQEQRQEQIYRSLAVHAARLQHDAERRGE   197
YER109C_PW5   146   IFNTSSSRGGSEFAQQYYQLVLQEQRQEQIYRSLAVHAARLQHDAERRGE   195
YER109C_RM11-1a   
   --------------------------------------------------   
YER109C_SEY6210   
   --------------------------------------------------   
YER109C_SK1   148   IFNTSSSRGGSEFAQQYYQLVLQEQRQEQIYRSLAVHAARLQHDAERRGE   197
YER109C_T7   148   IFNTSSSRGGSEFAQQYYQLVLQEQRQEQIYRSLAVHAARLQHDAERRGE   197
YER109C_T73   78   IFNTSSSRGGSEFAQQYYQLVLQEQRQEQIYRSLAVHAARLQHDAERRGE   127
YER109C_UC5   148   IFNTSSSRGGSEFAQQYYQLVLQEQRQEQIYRSLAVHAARLQHDAERRGG   197
YER109C_UWOPS05_217_3   148   IFNTSSSRGGSEFAQQYYQLVLQEQRQEQMYRSLAVHAARLQHDAERRGE   197
YER109C_VL3   148   IFNTSSSRGGSEFAQQYYQLVLQEQRQEQIYRSLAVHAARLQHDAERRGE   197
YER109C_Vin13   148   IFNTSSSRGGSEFAQQYYQLVLQEQRQEQIYRSLAVHAARLQHDAERRGE   197
YER109C_W303   
   --------------------------------------------------   
YER109C_X2180-1A   
   --------------------------------------------------   
YER109C_Y10   148   IFNTSSSRGGSEFAQQYYQLVLQEQRQEQIYRSLAVHAARLQHDAERRGE   197
YER109C_Y55   140   IFNTSSSRGGSEFAQQYYQLVLQEQRQEQIYRSLAAHAARLQHDAERRGE   189
YER109C_YJM269   148   IFNTSSSRSGSEFAQQYYQLVLQEQRQEQIYRSLAVHAARLQHDAERRGE   197
YER109C_YJM339   148   IFNTSSSRGGSEFAQQYYQLVLQEQRQEQIYRSLAVHAARLQHDAERRGE   197
YER109C_YJM789   148   IFNTSSSRGGSEFAQQYYQLVLQEQRQEQIYRSLAVHAARLQHDAERRGE   197
YER109C_YPH499   
   --------------------------------------------------   
YER109C_YPS128   149   IFNTSSSRGGSEFAQQYYQLVLQEQRQEQIYRSLAVHAARLQHDAERRGE   198
YER109C_YPS163   149   IFNTSSSRGGSEFAQQYYQLVLQEQRQEQIYRSLAVHAARLQHDAERRGE   198
YER109C_YS9   148   IFNTSSSRGGSEFAQQYYQLVLQEQRQEQIYRSLAVHAARLQHDAERRGE   197
YER109C_ZTW1   148   IFNTSSSRGGSEFAQQYYQLVLQEQRQEQIYRSLAVHAARLQHDAERRGE   197
         

YER109C_S288C   197   YSNEDIDPMHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   246
YER109C_AWRI1631   198   YSNEDIDPMHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   247
YER109C_AWRI796   
   --------------------------------------------------   
YER109C_BC187   198   YSNEDIDPMHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   247
YER109C_BY4741   1   --------MHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   42
YER109C_BY4742   1   --------MHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   42
YER109C_CBS7960   198   YSNEDIDPMHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   247
YER109C_CEN.PK   190   YSNEDIDPMHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   239
YER109C_CLIB324   198   YSNEDIDPMHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   247
YER109C_D273-10B   1   --------MHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   42
YER109C_DBVPG6044   190   YSNEDIDPMHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   239
YER109C_EC1118   198   YSNEDIDPMHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   247
YER109C_FL100   198   YSNEDIDPMHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   247
YER109C_FY1679   1   --------MHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   42
YER109C_FostersB   200   YSNEDIDPMHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   249
YER109C_FostersO   1   --------MHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   42
YER109C_JAY291   201   YSNEDIDPMHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   250
YER109C_JK9-3d   1   --------MHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   42
YER109C_K11   198   YSNEDIDPMHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNLSIP   247
YER109C_Kyokai7   198   YSNEDIDPMHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNLSIP   247
YER109C_L1528   198   YSNEDIDPMHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   247
YER109C_LalvinQA23   121   YSNEDIDPMHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   170
YER109C_M22   198   YSNEDIDPMHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   247
YER109C_PW5   196   YSNEDIDPMHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   245
YER109C_RM11-1a   1   --------MHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   42
YER109C_SEY6210   1   --------MHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   42
YER109C_SK1   198   YSNEDIDPMHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   247
YER109C_T7   198   YSNEDIDPMHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   247
YER109C_T73   128   YSNEDIDPMHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   177
YER109C_UC5   198   YSNEDIDPMHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNLSIP   247
YER109C_UWOPS05_217_3   198   YSNEDIDPMHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   247
YER109C_VL3   198   YSNEDIDPMHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   247
YER109C_Vin13   198   YSNEDIDPMHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   247
YER109C_W303   1   --------MHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   42
YER109C_X2180-1A   1   --------MHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   42
YER109C_Y10   198   YSNEDIDPMHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   247
YER109C_Y55   190   YSNEDIDPMHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   239
YER109C_YJM269   198   YSNEDIDPMHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   247
YER109C_YJM339   198   YSNEDIDPMHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   247
YER109C_YJM789   198   YSNEDIDPMHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   247
YER109C_YPH499   1   --------MHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   42
YER109C_YPS128   199   YSNEDIDPMHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   248
YER109C_YPS163   199   YSNEDIDPMHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   248
YER109C_YS9   198   YSNEDIDPMHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   247
YER109C_ZTW1   198   YSNEDIDPMHLAAMMLGNPMAPAVQMRNVNMNPIPIPMVGNPIVNNFSIP   247
         

YER109C_S288C   247   PYNNANPTTGATAVAPTAPPSGDFTNVGPTQNRSQNVTGWPVYNYPMQPT   296
YER109C_AWRI1631   248   PYNNANPTTGATAVAPTAPPSGDFTNVGPTQNRSQNVTGWPVYNYPMQPT   297
YER109C_AWRI796   
   --------------------------------------------------   
YER109C_BC187   248   PYNNANPTTGATAVAPTAPPSGDFTNVGPTQNRSQNVTGWPVYNYPMQPT   297
YER109C_BY4741   43   PYNNANPTTGATAVAPTAPPSGDFTNVGPTQNRSQNVTGWPVYNYPMQPT   92
YER109C_BY4742   43   PYNNANPTTGATAVAPTAPPSGDFTNVGPTQNRSQNVTGWPVYNYPMQPT   92
YER109C_CBS7960   248   PYNNANPTTGATAVAPTAPPSGDFTNVGPTQNRSQNVTGWPVYNYPMQPT   297
YER109C_CEN.PK   240   PYNNANPTTGATAVAPTAPPSGDFANVGPTQNRSQNVTGWPVYNYPMQPT   289
YER109C_CLIB324   248   PYNNANPTTGATAVAPTAPPSGDFTNVGPTQNRSQNVTGWPVYNYPMQPT   297
YER109C_D273-10B   43   PYNNANPTTGATAVAPTAPPSGDFTNVGPTQNRSQNVTGWPVYNYPMQPT   92
YER109C_DBVPG6044   240   PYNNANPTTGATAVAPTAPPSGDFANVGPTQNRSQNVTGWPVYNYPMQPT   289
YER109C_EC1118   248   PYNNANPTTGATAVAPTAPPSGDFTNVGPTQNRSQNVTGWPVYNYPMQPT   297
YER109C_FL100   248   PYNNANPTTGATAVAPTAPPSGDFTNVGPTQNRSQNVTGWPVYNYPMQPT   297
YER109C_FY1679   43   PYNNANPTTGATAVAPTAPPSGDFTNVGPTQNRSQNVTGWPVYNYPMQPT   92
YER109C_FostersB   250   PYNNANPTTGATAVAPTAPPSGDFANVGPTQNRSQNVTGWPVYNYPMQPT   299
YER109C_FostersO   43   PYNNANPTTGATAVAPTAPPSGDFANVGPTQNRSQNVTGWPVYNYPMQPT   92
YER109C_JAY291   251   PYNNANPTTGATAVAPTAPPSGDFTNVGPTQNRSQNVTGWPVYNYPMQPT   300
YER109C_JK9-3d   43   PYNNANPTTGATAVAPTAPPSGDFTNVGPTQNRSQNVTGWPVYNYPMQPT   92
YER109C_K11   248   PYNNANPTTGATAVAPTAPPSGDFTNVGPTQNRSQNVTGWPVYNYPMQPT   297
YER109C_Kyokai7   248   PYNNANPTTGATAVAPTAPPSGDFTNVGPTQNRSQNVTGWPVYNYPMQPT   297
YER109C_L1528   248   PYNNANPTTGATAVAPTAPPSGDFTNVGPTQNRSQNVTGWPVYNYPMQPT   297
YER109C_LalvinQA23   171   PYNNANPTTGATAVAPTAPPSGDFTNVGPTQNRSQNVTGWPVYNYPMQPT   220
YER109C_M22   248   PYNNANPTTGATAVAPTAPPSGDFTNVGPTQNRSQNVTGWPVYNYPMQPT   297
YER109C_PW5   246   PYNNANPTTGATAVAPTAPPSGDFTNVGPTQNRSQNVAGWPVYNYPMQPT   295
YER109C_RM11-1a   43   PYNNANPTTGATAVAPTAPPSGDFTNVGPTQNRSQNVTGWPVYNYPMQPT   92
YER109C_SEY6210   43   PYNNANPTTGATAVAPTAPPSGDFTNVGPTQNRSQNVTGWPVYNYPMQPT   92
YER109C_SK1   248   PYNNANPTTGATAVAPTAPPSGDFTNVGPTQNRSQNVTGWPVYNYPMQPT   297
YER109C_T7   248   PYNNANPTTGATAVAPTAPPSGDFTNVGPTQNRSQNVTGWPVYNYPMQPT   297
YER109C_T73   178   PYNNANPTTGATAVAPTAPPSGDFTNVGPTQNRSQNVTGWPVYNYPMQPT   227
YER109C_UC5   248   PYNNANPTTGATAVAPTAPPSGDFTNVGPTQNRSQNVTGWPVYNYPMQPT   297
YER109C_UWOPS05_217_3   248   PYNNANPTTGATAVAPTAPPSGDFANVGPTQNRSQNVTGWPVYNYPMQPT   297
YER109C_VL3   248   PYNNANPTTGXTAVAPTAPPSGDFTNVGPTQNRSQNVTGWPVYNYPMQPT   297
YER109C_Vin13   248   PYNNANPTTGATAVAPTAPPSGDFTNVGPTQNRSQNVTGWPVYNYPMQPT   297
YER109C_W303   43   PYNNANPTTGATAVAPTAPPSGDFTNVGPTQNRSQNVTGWPVYNYPMQPT   92
YER109C_X2180-1A   43   PYNNANPTTGATAVAPTAPPSGDFTNVGPTQNRSQNVTGWPVYNYPMQPT   92
YER109C_Y10   248   PYNNANPTTGATAVAPTAPPSGDFTNVGPTQNRSQNVTGWPVYNYPMQPT   297
YER109C_Y55   240   PYNNANPTTGATAVAPTAPPSGDFANVGPTQNRSQNVTGWPVYNYPMQPT   289
YER109C_YJM269   248   PYNNANPTTGATAVAPTAPPSGDFANVGPTQNRSQNVTGWPVYNYPMQPT   297
YER109C_YJM339   248   PYNNANPTTGATAVAPTAPPSGDFTNVGPTQNRSQNVTGWPVYNYPMQPT   297
YER109C_YJM789   248   PYNNANPTTGTTAVAPTAPPSGDFTNVGPTQNRSQNVTGWPVYNYPMQPT   297
YER109C_YPH499   43   PYNNANPTTGATAVAPTAPPSGDFTNVGPTQNRSQNVTGWPVYNYPMQPT   92
YER109C_YPS128   249   PYNNANPTTGATAVAPTAPPSGDFTNVGPTQNRSQNVTGWPVYNYPMQPT   298
YER109C_YPS163   249   PYNNANPTTGATAVAPTAPPSGDFTNVGPTQNRSQNVTGWPVYNYPMQPT   298
YER109C_YS9   248   PYNNANPTTGATAVAPTAPPSGDFTNVGPTQNRSQNVTGWPVYNYPMQPT   297
YER109C_ZTW1   248   PYNNANPTTGATAVAPTAPPSGDFTNVGPTQNRSQNVTGWPVYNYPMQPT   297
         

YER109C_S288C   297   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   346
YER109C_AWRI1631   298   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   347
YER109C_AWRI796   1   ----------------------------------------MSRRQNLQEV   10
YER109C_BC187   298   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   347
YER109C_BY4741   93   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   142
YER109C_BY4742   93   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   142
YER109C_CBS7960   298   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   347
YER109C_CEN.PK   290   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   339
YER109C_CLIB324   298   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   347
YER109C_D273-10B   93   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   142
YER109C_DBVPG6044   290   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   339
YER109C_EC1118   298   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   347
YER109C_FL100   298   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   347
YER109C_FY1679   93   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   142
YER109C_FostersB   300   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   349
YER109C_FostersO   93   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   142
YER109C_JAY291   301   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   350
YER109C_JK9-3d   93   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   142
YER109C_K11   298   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   347
YER109C_Kyokai7   298   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   347
YER109C_L1528   298   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   347
YER109C_LalvinQA23   221   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   270
YER109C_M22   298   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKIMHSTDKPNNVPTSKSTRS   347
YER109C_PW5   296   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTTHSTDKPNNFPTSKSTRS   345
YER109C_RM11-1a   93   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   142
YER109C_SEY6210   93   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   142
YER109C_SK1   298   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   347
YER109C_T7   298   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   347
YER109C_T73   228   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   277
YER109C_UC5   298   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   347
YER109C_UWOPS05_217_3   298   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   347
YER109C_VL3   298   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   347
YER109C_Vin13   298   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   347
YER109C_W303   93   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   142
YER109C_X2180-1A   93   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   142
YER109C_Y10   298   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKIMHSTDKPNNVPTSKSTRS   347
YER109C_Y55   290   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   339
YER109C_YJM269   298   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   347
YER109C_YJM339   298   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   347
YER109C_YJM789   298   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   347
YER109C_YPH499   93   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   142
YER109C_YPS128   299   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   348
YER109C_YPS163   299   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   348
YER109C_YS9   298   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   347
YER109C_ZTW1   298   TENPVGNPCNNNTTNNTTNNKSPVNQPKSLKTMHSTDKPNNVPTSKSTRS   347
         

YER109C_S288C   347   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNACSPNITTPGSTTSEP   396
YER109C_AWRI1631   348   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNAGSPNITTPGSTTSEP   397
YER109C_AWRI796   11   DLQPQKRRVKXKAGLVAKRRRKNNTATVSAGSTNAGSPNITTPGSTTSEP   60
YER109C_BC187   348   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNAGSPNITTPGSTTSEP   397
YER109C_BY4741   143   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNACSPNITTPGSTTSEP   192
YER109C_BY4742   143   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNACSPNITTPGSTTSEP   192
YER109C_CBS7960   348   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNAGSPNITTPGSTTSEP   397
YER109C_CEN.PK   340   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNAGSPNITTPGSTTSEP   389
YER109C_CLIB324   348   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNAGSPNITTPGSTTSEP   397
YER109C_D273-10B   143   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNACSPNITTPGSTTSEP   192
YER109C_DBVPG6044   340   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNAGSPNITTPGSTTSEP   389
YER109C_EC1118   348   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNAGSPNITTPGSATSEP   397
YER109C_FL100   348   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNACSPNITTPGSTTSEP   397
YER109C_FY1679   143   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNACSPNITTPGSTTSEP   192
YER109C_FostersB   350   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNAGSPNITTPGSTTSEP   399
YER109C_FostersO   143   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNAGSPNITTPGSTTSEP   192
YER109C_JAY291   351   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNAGSPNITTPGSTTSEP   400
YER109C_JK9-3d   143   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNACSPNITTPGSTTSEP   192
YER109C_K11   348   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNAGSPNITTPGSTTSEP   397
YER109C_Kyokai7   348   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNAGSPNITTPGSTTSEP   397
YER109C_L1528   348   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNAGSPNITTPGSTTSEP   397
YER109C_LalvinQA23   271   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNAGSPNITTPGSXTSEP   320
YER109C_M22   348   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNAGSPNITTPGSTTSEP   397
YER109C_PW5   346   RSATSKTKGKVKAGLVAKRRRKNNTATVSAGSTNAGSPNITTPGSTTSEP   395
YER109C_RM11-1a   143   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNAGSPNITTPGSTTSEP   192
YER109C_SEY6210   143   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNACSPNITTPGSTTSEP   192
YER109C_SK1   348   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNACSPNITTPGSTTSEP   397
YER109C_T7   348   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNAGSPNITTPGSTTSEP   397
YER109C_T73   278   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNAGSPNITTPGSTTSEP   327
YER109C_UC5   348   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNAGSPNITTPGSTTSEP   397
YER109C_UWOPS05_217_3   348   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNAGSPNITTPGSTTSEP   397
YER109C_VL3   348   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNAGSPNITTPGSTTSEP   397
YER109C_Vin13   348   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNAGSPNITTPGSTTSEP   397
YER109C_W303   143   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNACSPNITTPGSTTSEP   192
YER109C_X2180-1A   143   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNACSPNITTPGSTTSEP   192
YER109C_Y10   348   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNAGSPNITTPGSTTSEP   397
YER109C_Y55   340   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNAGSPNITTPGSTTSEP   389
YER109C_YJM269   348   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNAGSPNITTPGSTTSEP   397
YER109C_YJM339   348   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNAGSPNITTPGSTTSEP   397
YER109C_YJM789   348   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNAGSPNITTPGSTTSEP   397
YER109C_YPH499   143   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNACSPNITTPGSTTSEP   192
YER109C_YPS128   349   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNAGSPNITTPGSTTSEP   398
YER109C_YPS163   349   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNAGSPNITTPGSTTSEP   398
YER109C_YS9   348   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNAGSPNITTPGSTTSEP   397
YER109C_ZTW1   348   RSATSKAKGKVKAGLVAKRRRKNNTATVSAGSTNAGSPNITTPGSTTSEP   397
         

YER109C_S288C   397   AMVGSRVNKTPRSDIATNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALA   446
YER109C_AWRI1631   398   AMVGSRVNKTPRSDIATNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALA   447
YER109C_AWRI796   61   AMVGSRVNKTPRSDIATNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALA   110
YER109C_BC187   398   AMVGSRVNKTPRSDIATNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALA   447
YER109C_BY4741   193   AMVGSRVNKTPRSDIATNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALA   242
YER109C_BY4742   193   AMVGSRVNKTPRSDIATNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALA   242
YER109C_CBS7960   398   AMVGSRVNKTPRSDIATNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALA   447
YER109C_CEN.PK   390   AMVGSRVNKTPRSDIATNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALV   439
YER109C_CLIB324   398   AMVGSRVNKTPRSDIATNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALA   447
YER109C_D273-10B   193   AMVGSRVNKTPRSDIATNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALA   242
YER109C_DBVPG6044   390   AMVGSRVNKTPRSDIATNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALV   439
YER109C_EC1118   398   AMVGSRVNKTPRSDIATNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALA   447
YER109C_FL100   398   AMVGSRVNKTPRSDIATNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALA   447
YER109C_FY1679   193   AMVGSRVNKTPRSDIATNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALA   242
YER109C_FostersB   400   AMVGSRVNKTPRSDIAANFRNQAIIFGEEDIYSNSKSSPSLDGASPSALV   449
YER109C_FostersO   193   AMVGSRVNKTPRSDIAXNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALV   242
YER109C_JAY291   401   AMVGSRVNKTPRSDIATNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALV   450
YER109C_JK9-3d   193   AMVGSRVNKTPRSDIATNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALA   242
YER109C_K11   398   AMVGSRVNKTPRSDIAANFRNQAIIFGEEDIYSNSKSSPSLDGASPSALV   447
YER109C_Kyokai7   398   AMVGSRVNKTPRSDIAANFRNQAIIFGEEDIYSNSKSSPSLDGASPSALV   447
YER109C_L1528   398   AMVGSRVNKTPRSDIATNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALA   447
YER109C_LalvinQA23   321   AMVGSRVNKTPRSDIATNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALA   370
YER109C_M22   398   AMVGSRVNKTPRSDIATNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALA   447
YER109C_PW5   396   AMVGSRVNKTPRSDIATNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALV   445
YER109C_RM11-1a   193   AMVGSRVNKTPRSDIATNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALA   242
YER109C_SEY6210   193   AMVGSRVNKTPRSDIATNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALA   242
YER109C_SK1   398   AMVGSRVNKTPRSDIATNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALA   447
YER109C_T7   398   AMVGSRVNKTPRSDIATNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALV   447
YER109C_T73   328   AMVGSRVNKTPRSDIATNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALA   377
YER109C_UC5   398   AMVGSRVNKTPRSDIAANFRNQAIIFGEEDIYSNSKSSPSLDGASPSALV   447
YER109C_UWOPS05_217_3   398   AMVGSRVNKTPRSDIATNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALV   447
YER109C_VL3   398   AMVGSRVNKTPRSDIATNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALA   447
YER109C_Vin13   398   AMVGSRVNKTPRSDIATNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALA   447
YER109C_W303   193   AMVGSRVNKTPRSDIATNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALA   242
YER109C_X2180-1A   193   AMVGSRVNKTPRSDIATNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALA   242
YER109C_Y10   398   AMVGSRVNKTPRSDIATNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALA   447
YER109C_Y55   390   AMVGSRVNKTPRSDIATNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALV   439
YER109C_YJM269   398   AMVGSRVNKTPRSDIAANFRNQAIIFGEEDIYSNSKSSPSLDGASPSALV   447
YER109C_YJM339   398   AMVGSRVNKTPRSDIATNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALA   447
YER109C_YJM789   398   AMVGSRVNKTPRSDIATNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALA   447
YER109C_YPH499   193   AMVGSRVNKTPRSDIATNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALA   242
YER109C_YPS128   399   AMVGSRVNKTPRSDIATNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALV   448
YER109C_YPS163   399   AMVGSRVNKTPRSDIATNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALV   448
YER109C_YS9   398   AMVGSRVNKTPRSDIATNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALA   447
YER109C_ZTW1   398   AMVGSRVNKTPRSDIATNFRNQAIIFGEEDIYSNSKSSPSLDGASPSALV   447
         

YER109C_S288C   447   SKQPTKVRKNTKKASTSAFPVESTNKLGGNSVVTGKKRSPPNTRVSRRKS   496
YER109C_AWRI1631   448   SKQPTKVRKNTKKASTSAFPVESTNKLGSNSVVTGKKRSPPNTRVSRRKS   497
YER109C_AWRI796   111   SKQPTKVRKNTKKASTSAFPVESTNKLGGNSVVTGKKRSPPNTRVSRRKS   160
YER109C_BC187   448   SKQPTKVRKNTKKASTSAFPVESTNKLGGNSVVTGKKRSPPNTRVSRRKS   497
YER109C_BY4741   243   SKQPTKVRKNTKKASTSAFPVESTNKLGGNSVVTGKKRSPPNTRVSRRKS   292
YER109C_BY4742   243   SKQPTKVRKNTKKASTSAFPVESTNKLGGNSVVTGKKRSPPNTRVSRRKS   292
YER109C_CBS7960   448   SKQPTKVRKNTKKASTSAFPVESTNKLGGNSVVTGKKRSPPNTRVSRRKS   497
YER109C_CEN.PK   440   SKQPTKVRKNTKKASTSAFPVESANKLGGNSVVTGKKRSPPNTRVLRRKS   489
YER109C_CLIB324   448   SKQPTKVRKNTKKASTSAFPVESTNKLGGNSVVTGKKRSPPNTRVSRRKS   497
YER109C_D273-10B   243   SKQPTKVRKNTKKASTSAFPVESTNKLGGNSVVTGKKRSPPNTRVSRRKS   292
YER109C_DBVPG6044   440   SKQPTKVRKNTKKASTSAFPVESANKLGGNSVVTGKKRSPPNTRVLRRKS   489
YER109C_EC1118   448   SKQPTKVRKNTKKASTSAFPVESTNKLGGNSVVTGKKRSPPNTRMSRRKS   497
YER109C_FL100   448   SKQPTKVRKNTKKASTSAFPVESTNKLGGNSVVTGKKRSPPNTRVSRRKS   497
YER109C_FY1679   243   SKQPTKVRKNTKKASTSAFPVESTNKLGGNSVVTGKKRSPPNTRVSRRKS   292
YER109C_FostersB   450   SKQPTKVRKNTKKASTSAFPVESANKLGGNSVVTGKKRSPPNTRVSRRKS   499
YER109C_FostersO   243   SKQPTKVRKNTKKASTSAFPVESXNKLGGNSXVTGKKRSPPNTRVSRRKS   292
YER109C_JAY291   451   SKQPTKVRKNTKKASTSAFPVESANKLGGNSVVTGKKRSPPNTRVSRRKS   500
YER109C_JK9-3d   243   SKQPTKVRKNTKKASTSAFPVESTNKLGGNSVVTGKKRSPPNTRVSRRKS   292
YER109C_K11   448   SKQPTKVRKNTKKASTSAFPVESANKLGGNSVVTGKKRSPPNTRVSRRKS   497
YER109C_Kyokai7   448   SKQPTKVRKNTKKASTSAFPVESANKLGGNSVVTGKKRSPPNTRVSRRKS   497
YER109C_L1528   448   SKQPTKVRKNTKKASTSAFPVESTNKLGGNSVVTGKKRSPPNTRVSRRKS   497
YER109C_LalvinQA23   371   SKQPTKVRKNTKKASTSAFPVESTNKLGGNSVVTGKKRSPPNTRXSRRKS   420
YER109C_M22   448   SKQPTKVRKNTKKASTSAFPVESTNKLGGNSVVTGKKRSPPNTRVSRRKS   497
YER109C_PW5   446   SKQPTKVRKNTKKASTSAFPVESANKLGGNSVVTGKKRSPPNTRVSRRKS   495
YER109C_RM11-1a   243   SKQPTKVRKNTKKASTSAFPVESTNKLGGNSVVTGKKRSPPNTRVSRRKS   292
YER109C_SEY6210   243   SKQPTKVRKNTKKASTSAFPVESTNKLGGNSVVTGKKRSPPNTRVSRRKS   292
YER109C_SK1   448   SKQPTKVRKNTKKASTSAFPVESTNKLGGNSVVTGKKRSPPNTRVSRRKS   497
YER109C_T7   448   SKQPTKVRKNTKKASTSAFPVESTNKLGGNSVVTGKKRSPPNTRVSRRKS   497
YER109C_T73   378   SKQPTKVRKNTKKASTSAFPVESTNKLGGNSVVTGKKRSPPNTRVSRRKS   427
YER109C_UC5   448   SKQPTKVRKNTKKASTSAFPVESANKLGGNSVVTGKKRSPPNTRVSRRKS   497
YER109C_UWOPS05_217_3   448   SKQPTKVRKNTKKASTSAFPVESTNKLGGNSVVTGKKRSPPNTRVSRRKS   497
YER109C_VL3   448   SKQPTKVRKNTKKASTSAFPVESTNKLGGNSVVTGKKRSPPNTRVSRRKS   497
YER109C_Vin13   448   SKQPTKVRKNTKKASTSAFPVESTNKLGGNSVVTGKKRSPPNTRXSRRKS   497
YER109C_W303   243   SKQPTKVRKNTKKASTSAFPVESTNKLGGNSVVTGKKRSPPNTRVSRRKS   292
YER109C_X2180-1A   243   SKQPTKVRKNTKKASTSAFPVESTNKLGGNSVVTGKKRSPPNTRVSRRKS   292
YER109C_Y10   448   SKQPTKVRKNTKKASTSAFPVESTNKLGGNSVVTGKKRSPPNTRVSRRKS   497
YER109C_Y55   440   SKQPTKVRKNTKKASTSAFPVESANKLGGNSVVTGKKRSPPNTRVLRRKS   489
YER109C_YJM269   448   SKQPTKVRKNTKKASTSAFPVESANKLGGNSVVTGKKRSPPNTRVSRRKS   497
YER109C_YJM339   448   SKQPTKVRKNTKKASTSAFPVESTNKLGGNSVVTGKKRSPPNTRVSRRKS   497
YER109C_YJM789   448   SKQPTKVRKNTKKASTSAFPVESTNKLGGNSVVTGKKRSPPNTRVSRRKS   497
YER109C_YPH499   243   SKQPTKVRKNTKKASTSAFPVESTNKLGGNSVVTGKKRSPPNTRVSRRKS   292
YER109C_YPS128   449   SKQPTKVRKNTKKASTSAFPVESTNKLGGNSVVTGKKRSPPNTRVSRRKS   498
YER109C_YPS163   449   SKQPTKVRKNTKKASTSAFPVESTNKLGGNSVVTGKKRSPPNTRVSRRKS   498
YER109C_YS9   448   SKQPTKVRKNTKKASTSAFPVESTNKLGGNSVVTGKKRSPPNTRVSRRKS   497
YER109C_ZTW1   448   SKQPTKVRKNTKKASTSAFPVESANKLGGNSVVTGKKRSPPNTRVSRRKS   497
         

YER109C_S288C   497   TPSVILNADATKDENNMLRTFSNTIAPNIHSAPPTKTANSLPFPGINLGS   546
YER109C_AWRI1631   498   TPSVILNADATKDENNMLRTFSNTIAPNIHSAPPTKTANSLPFPGINLGS   547
YER109C_AWRI796   161   TPSVILNADATKDENNMLRTFSNTIAPNIHSAPPTKTANSLPFPGINLGS   210
YER109C_BC187   498   TPSVILNADATKDENNMLRTFSNTIAPNIHSAPPTKTANSLPFPGINLGS   547
YER109C_BY4741   293   TPSVILNADATKDENNMLRTFSNTIAPNIHSAPPTKTANSLPFPGINLGS   342
YER109C_BY4742   293   TPSVILNADATKDENNMLRTFSNTIAPNIHSAPPTKTANSLPFPGINLGS   342
YER109C_CBS7960   498   TPSVILNADATKDENNMLRTFSNTIAPNIHSAPPTKTANSLPFPGINLGS   547
YER109C_CEN.PK   490   TPSVILNADATKDENNMLRTFSNTTAPNIHSAPPTKTANSLPFPGINLGS   539
YER109C_CLIB324   498   TPSVILNADATKDENNMLRTFSNTIAPNIHSAPPTKTANSLPFPGINLGS   547
YER109C_D273-10B   293   TPSVILNADATKDENNMLRTFSNTIAPNIHSAPPTKTANSLPFPGINLGS   342
YER109C_DBVPG6044   490   TPSVILNADATKDENNMLRTFSNTTAPNIHSAPPTKTANSLPFPGINLGS   539
YER109C_EC1118   498   TPSVILNADATKDENNMLRTFSNTIAPNIHSAPPTKTANSLPFPGINLGS   547
YER109C_FL100   498   TPSVILNADATKDENNMLRTFSNTIAPNIHSAPPTKTANSLPFPGINLGS   547
YER109C_FY1679   293   TPSVILNADATKDENNMLRTFSNTIAPNIHSAPPTKTANSLPFPGINLGS   342
YER109C_FostersB   500   TPSVILNADATKDENNMLRTFSNTTAPNIHSAPPTKTANSLPFPGINLGS   549
YER109C_FostersO   293   TPSVILNADATKDENNMLRTFSNTTAPNIHSAPPTKTANSLPFPGINLGS   342
YER109C_JAY291   501   TPSVILNADATKDENNMLRTFSNTTAPNIHSAPPTKTANSLPFPGINLGS   550
YER109C_JK9-3d   293   TPSVILNADATKDENNMLRTFSNTIAPNIHSAPPTKTANSLPFPGINLGS   342
YER109C_K11   498   TPSVILNADATKDENNILRTFSNTTAPNIHSAPPTKTANSLPFPGINLGS   547
YER109C_Kyokai7   498   TPSVILNADATKDENNILRTFSNTTAPNIHSAPPTKTANSLPFPGINLGS   547
YER109C_L1528   498   TPSVILNADATKDENNMLRTFSNTIAPNIHSAPPTKTANSLPFPGINLGS   547
YER109C_LalvinQA23   421   TPSVILNADATKDENNMLRTFSNTIAPNIHSAPPTKTANSLPFPGINLGS   470
YER109C_M22   498   TPSVILNADATKDENNMLRTFSNTIAPNIHSAPPTKTANSLPFPGINLGS   547
YER109C_PW5   496   TPSVILNADATKDENNMLRTFSNTTAPNIHSAPPTKTANSLPFPGINLGS   545
YER109C_RM11-1a   293   TPSVILNADATKDENNMLRTFSNTIAPNIHSAPPTKTANSLPFPGINLGS   342
YER109C_SEY6210   293   TPSVILNADATKDENNMLRTFSNTIAPNIHSAPPTKTANSLPFPGINLGS   342
YER109C_SK1   498   TPSVILNADATKDENNMLRTFSNTIAPNIHSAPPTKTANSLPFPGINLGS   547
YER109C_T7   498   TPSVILNADATKDENNMLRTFSNTTAPNIHSAPPTKTANSLPFPGINLGS   547
YER109C_T73   428   TPSVILNADATKDENNMLRTFSNTIAPNIHSAPPTKTANSLPFPGINLGS   477
YER109C_UC5   498   TPSVILNADATKDENNILRTFSNTTAPNIHSAPPTKTANSLPFPGINLGS   547
YER109C_UWOPS05_217_3   498   TPSVILNADATKDENNMLRTFSNTTAPNIHSAPPTKTANSLPFPGINLGS   547
YER109C_VL3   498   TPSVILNADATKDENNMLRTFSNTIAPNIHSAPPTKTANSLPFPGINLGS   547
YER109C_Vin13   498   TPSVILNADATKDENNMLRTFSNTIAPNIHSAPPTKTANSLPFPGINLGS   547
YER109C_W303   293   TPSVILNADATKDENNMLRTFSNTIAPNIHSAPPT