YER067C-A S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YER067C-A_S288C   1   MTQPLICAYRMCFVIDKYHSIFMCANYLNVYLERSTMVFSFLTVMPGDFI   50
YER067C-A_AWRI796   1   MTQPLICAYRMCFVIDKYHSIFMCANYLNVYLERSTMVFSFLTVMPGDFI   50
YER067C-A_CBS7960   1   MTQPLICAYRMCFVIDKYHSIFMCANYLNVYLERSTMVFSFLTVMPGDFI   50
YER067C-A_CLIB215   1   MTQPLICAYRMCFVIDKYHSIFMCANYLNVYLERSTMVFSFLTVMPGDFI   50
YER067C-A_CLIB324   1   MTQPLICAYRMCFVIDKYHSIFMCANYLNVYLERSTMVFSFLTVMPGDFI   50
YER067C-A_EC1118   1   MTQPLICAYRMCFVIDKYHSIFMCANYLNVYLERSTMVFSFLTVMPGDFI   50
YER067C-A_EC9-8   1   MTQPLICAYRMCFVIDKYHSIFMCANYLNVYLERSTMVFSFLTVMPGDFI   50
YER067C-A_FostersB   1   MTQPLICAYRMCFVIDKXHSIFMCANYLNVYLERSTMVFSFLTVMPGDFI   50
YER067C-A_FostersO   1   MTQPLICAYRMCFVIDKXHSIFMCANYLNVYLERSTMVFSFLTVMPGDFI   50
YER067C-A_JAY291   1   MTQPLICAYRMCFVIDKYHSIFMCANYLNVYLERSTMVFSFLTVMPGDFI   50
YER067C-A_Kyokai7   1   MTQPLICAYRMCFVIDKHHSIFMCANYLNVYLERSTMVFSFLTVMPGDFI   50
YER067C-A_LalvinQA23   1   MTQPLICAYRMCFVIDKYHSIFMCANYLNVYLERSTMVFSFLTVMPGDFI   50
YER067C-A_M22   1   MTQPLICAYRMCFVIDKYHSIFMCANYLNVYLERSTMVFSFLTVMPGDFI   50
YER067C-A_PW5   1   MTQPLICAYRMCFVIDKYHSIFMCANYLNVYLERSTMVFSFLTVMPGDFI   50
YER067C-A_T7   1   MTQPLICAYRMCFVIDKYHSIFMCANYLNVYLERSTMVFSFLTVMPGDFI   50
YER067C-A_T73   1   MTQPLICAYRMCFVIDKYHSIFMCANYLNVYLERSTMVFSFLTVMPGDFI   50
YER067C-A_UC5   1   MTQPLICAYRMCFVIDKHHSIFMCANYLNVYLERSTMVFSFLTVMPGDFI   50
YER067C-A_VL3   1   MTQPLICAYRMCFVIDKYHSIFMCANYLNVYLERSTMVFSFLTVMPGDFI   50
YER067C-A_Vin13   1   MTQPLICAYRMCFVIDKYHSIFMCANYLNVYLERSTMVFSFLTVMPGDFI   50
YER067C-A_YJM269   1   MTQPLICAYRMCFVIDKYHSIFMCANYLNVYLERSTMVFSFLTVMPGDFI   50
YER067C-A_YJM789   1   MTQPLICAYRMCFVIDKYHSIFMCANYLNVYLERSTMVFSFLTVMPGDFI   50
YER067C-A_ZTW1   1   MTQPLICAYRMCFVIDKHHSIFMCANYLNVYLERSTMVFSFLTVMPGDFI   50
         

YER067C-A_S288C   51   KCLFLRFFVKFKLRFPNGLLNIFQKMLFNMLVQVTHELLRMRICSITNFF   100
YER067C-A_AWRI796   51   KCLFLRFFVKFKLRFPNGLLNIFQKMLFNMLVQVTHELLRMRICSITNFF   100
YER067C-A_CBS7960   51   KCLFLRFFVKFKLRFPNGLLNIFQKMLFNMLVQVTHELLRMRICSITNFF   100
YER067C-A_CLIB215   51   KCLFLRFFVKFKLRFPNGLLNIFQKMLFNMLVQVTHELLRMRICSITNFF   100
YER067C-A_CLIB324   51   KCLFLRFFVKFKLRFPNGLLNIFQKMLFNMLVQVTHELLRMRICSITNFF   100
YER067C-A_EC1118   51   KCLFLRFFVKFKLRFPNGLLNIFQKMLFNMLVQVTHELLRMRICSITNFF   100
YER067C-A_EC9-8   51   KCLFLRFFVKFKLRFPNGLLNIFQKMLFNMLVQVTHELLRMRICSITNFF   100
YER067C-A_FostersB   51   KCLFLRFFVKFKLRFPNGLLNIFQKMLFNMLVQVTHELLRMRICSITNFF   100
YER067C-A_FostersO   51   KCLFLRFFVKFKLRFPNGLLNIFQKMLFNMLVQVTHELLRMRICSITNFF   100
YER067C-A_JAY291   51   KCLFLRFFVKFKLRFPNGLLNIFQKMLFNMLVQVTHELLRMRICSITNFF   100
YER067C-A_Kyokai7   51   KCLFLRFFVKFKLRFPNGLLNIFQKMLFNMLVQVTHELLRMRICSITNFF   100
YER067C-A_LalvinQA23   51   KCLFLRFFVKFKLRFPNGLLNIFQKMLFNMLVQVTHELLRMRICSITNFF   100
YER067C-A_M22   51   KCLFLRFFVKFKLRFPNGLLNIFQKMLFNMLVQVTHELLRMRICSITNFF   100
YER067C-A_PW5   51   KCLFLRFFVKFKLRFPNGLLNIFQKMLFNMLVQVTHELLRMRICSITNFF   100
YER067C-A_T7   51   KCLFLRFFVKFKLRFPNGLLNIFQKMLFNMLVQVTHELLRMRICSITNFF   100
YER067C-A_T73   51   KCLFLRFFVKFKLRFPNGLLNIFQKMLFNMLVQVTHELLRMRICSITNFF   100
YER067C-A_UC5   51   KCLFLRFFVKFKLRFPNGLLNIFQKMLFNMLVQVTHELLRMRICSITNFF   100
YER067C-A_VL3   51   KCLFLRFFVKFKLRFPNGLLNIFQKMLFNMLVQVTHELLRMRICSITNFF   100
YER067C-A_Vin13   51   KCLFLRFFVKFKLRFPNGLLNIFQKMLFNMLVQVTHELLRMRICSITNFF   100
YER067C-A_YJM269   51   KCLFLRFFVKFKLRFPNGLLNIFQKMLFNMLVQVTHELLRMRICSITNFF   100
YER067C-A_YJM789   51   KCLFLRFFVKFKLRFPNGLLNIFQKMLFNMLVQVTHELLRMRICSITNFF   100
YER067C-A_ZTW1   51   KCLFLRFFVKFKLRFPNGLLNIFQKMLFNMLVQVTHELLRMRICSITNFF   100
         

YER067C-A_S288C   101   RVLVRLV   107
YER067C-A_AWRI796   101   RVLVRLV   107
YER067C-A_CBS7960   101   RVLVRLV   107
YER067C-A_CLIB215   101   RVLVRLV   107
YER067C-A_CLIB324   101   RVLVRLV   107
YER067C-A_EC1118   101   RVLVRLV   107
YER067C-A_EC9-8   101   RVLVRLM   107
YER067C-A_FostersB   101   RVLVRLV   107
YER067C-A_FostersO   101   RVLVRLV   107
YER067C-A_JAY291   101   RVLVRLV   107
YER067C-A_Kyokai7   101   RVLVRLV   107
YER067C-A_LalvinQA23   101   RVLVRLV   107
YER067C-A_M22   101   RVLVRLV   107
YER067C-A_PW5   101   RVLVRLV   107
YER067C-A_T7   101   RVLVRLV   107
YER067C-A_T73   101   RVLVRLV   107
YER067C-A_UC5   101   RVLVRLV   107
YER067C-A_VL3   101   RVLVRLV   107
YER067C-A_Vin13   101   RVLVRLV   107
YER067C-A_YJM269   101   RVLVRLV   107
YER067C-A_YJM789   101   RVLVRLM   107
YER067C-A_ZTW1   101   RVLVRLV   107
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YER067C-A_S288C from SGD:

YER067C-A_S288C [source=SGD]  Length: 108  Sat Sep 23 08:47:33 2017  Type: P  Check: 7577  ..

       1  MTQPLICAYR MCFVIDKYHS IFMCANYLNV YLERSTMVFS FLTVMPGDFI

      51  KCLFLRFFVK FKLRFPNGLL NIFQKMLFNM LVQVTHELLR MRICSITNFF

     101  RVLVRLV*

Protein Sequence for YER067C-A_AWRI796 from AWRI:

YER067C-A_AWRI796 [source=AWRI]  Length: 108  Sat Sep 23 08:47:33 2017  Type: P  Check: 7577  ..

       1  MTQPLICAYR MCFVIDKYHS IFMCANYLNV YLERSTMVFS FLTVMPGDFI

      51  KCLFLRFFVK FKLRFPNGLL NIFQKMLFNM LVQVTHELLR MRICSITNFF

     101  RVLVRLV*

Protein Sequence for YER067C-A_CBS7960 from WashU:

YER067C-A_CBS7960 [source=WashU]  Length: 108  Sat Sep 23 08:47:33 2017  Type: P  Check: 7577  ..

       1  MTQPLICAYR MCFVIDKYHS IFMCANYLNV YLERSTMVFS FLTVMPGDFI

      51  KCLFLRFFVK FKLRFPNGLL NIFQKMLFNM LVQVTHELLR MRICSITNFF

     101  RVLVRLV*

Protein Sequence for YER067C-A_CLIB215 from WashU:

YER067C-A_CLIB215 [source=WashU]  Length: 108  Sat Sep 23 08:47:33 2017  Type: P  Check: 7577  ..

       1  MTQPLICAYR MCFVIDKYHS IFMCANYLNV YLERSTMVFS FLTVMPGDFI

      51  KCLFLRFFVK FKLRFPNGLL NIFQKMLFNM LVQVTHELLR MRICSITNFF

     101  RVLVRLV*

Protein Sequence for YER067C-A_CLIB324 from WashU:

YER067C-A_CLIB324 [source=WashU]  Length: 108  Sat Sep 23 08:47:33 2017  Type: P  Check: 7577  ..

       1  MTQPLICAYR MCFVIDKYHS IFMCANYLNV YLERSTMVFS FLTVMPGDFI

      51  KCLFLRFFVK FKLRFPNGLL NIFQKMLFNM LVQVTHELLR MRICSITNFF

     101  RVLVRLV*

Protein Sequence for YER067C-A_EC1118 from Genoscope:

YER067C-A_EC1118 [source=Genoscope]  Length: 108  Sat Sep 23 08:47:33 2017  Type: P  Check: 7577  ..

       1  MTQPLICAYR MCFVIDKYHS IFMCANYLNV YLERSTMVFS FLTVMPGDFI

      51  KCLFLRFFVK FKLRFPNGLL NIFQKMLFNM LVQVTHELLR MRICSITNFF

     101  RVLVRLV*

Protein Sequence for YER067C-A_EC9-8 from ASinica:

YER067C-A_EC9-8 [source=ASinica]  Length: 108  Sat Sep 23 08:47:33 2017  Type: P  Check: 7127  ..

       1  MTQPLICAYR MCFVIDKYHS IFMCANYLNV YLERSTMVFS FLTVMPGDFI

      51  KCLFLRFFVK FKLRFPNGLL NIFQKMLFNM LVQVTHELLR MRICSITNFF

     101  RVLVRLM*

Protein Sequence for YER067C-A_FostersB from AWRI:

YER067C-A_FostersB [source=AWRI]  Length: 108  Sat Sep 23 08:47:33 2017  Type: P  Check: 7559  ..

       1  MTQPLICAYR MCFVIDKXHS IFMCANYLNV YLERSTMVFS FLTVMPGDFI

      51  KCLFLRFFVK FKLRFPNGLL NIFQKMLFNM LVQVTHELLR MRICSITNFF

     101  RVLVRLV*

Protein Sequence for YER067C-A_FostersO from AWRI:

YER067C-A_FostersO [source=AWRI]  Length: 108  Sat Sep 23 08:47:33 2017  Type: P  Check: 7559  ..

       1  MTQPLICAYR MCFVIDKXHS IFMCANYLNV YLERSTMVFS FLTVMPGDFI

      51  KCLFLRFFVK FKLRFPNGLL NIFQKMLFNM LVQVTHELLR MRICSITNFF

     101  RVLVRLV*

Protein Sequence for YER067C-A_JAY291 from Duke:

YER067C-A_JAY291 [source=Duke]  Length: 108  Sat Sep 23 08:47:33 2017  Type: P  Check: 7577  ..

       1  MTQPLICAYR MCFVIDKYHS IFMCANYLNV YLERSTMVFS FLTVMPGDFI

      51  KCLFLRFFVK FKLRFPNGLL NIFQKMLFNM LVQVTHELLR MRICSITNFF

     101  RVLVRLV*

Protein Sequence for YER067C-A_Kyokai7 from NRIB:

YER067C-A_Kyokai7 [source=NRIB]  Length: 108  Sat Sep 23 08:47:33 2017  Type: P  Check: 7271  ..

       1  MTQPLICAYR MCFVIDKHHS IFMCANYLNV YLERSTMVFS FLTVMPGDFI

      51  KCLFLRFFVK FKLRFPNGLL NIFQKMLFNM LVQVTHELLR MRICSITNFF

     101  RVLVRLV*

Protein Sequence for YER067C-A_LalvinQA23 from AWRI:

YER067C-A_LalvinQA23 [source=AWRI]  Length: 108  Sat Sep 23 08:47:33 2017  Type: P  Check: 7577  ..

       1  MTQPLICAYR MCFVIDKYHS IFMCANYLNV YLERSTMVFS FLTVMPGDFI

      51  KCLFLRFFVK FKLRFPNGLL NIFQKMLFNM LVQVTHELLR MRICSITNFF

     101  RVLVRLV*

Protein Sequence for YER067C-A_M22 from WashU:

YER067C-A_M22 [source=WashU]  Length: 108  Sat Sep 23 08:47:33 2017  Type: P  Check: 7577  ..

       1  MTQPLICAYR MCFVIDKYHS IFMCANYLNV YLERSTMVFS FLTVMPGDFI

      51  KCLFLRFFVK FKLRFPNGLL NIFQKMLFNM LVQVTHELLR MRICSITNFF

     101  RVLVRLV*

Protein Sequence for YER067C-A_PW5 from WashU:

YER067C-A_PW5 [source=WashU]  Length: 108  Sat Sep 23 08:47:33 2017  Type: P  Check: 7577  ..

       1  MTQPLICAYR MCFVIDKYHS IFMCANYLNV YLERSTMVFS FLTVMPGDFI

      51  KCLFLRFFVK FKLRFPNGLL NIFQKMLFNM LVQVTHELLR MRICSITNFF

     101  RVLVRLV*

Protein Sequence for YER067C-A_T7 from WashU:

YER067C-A_T7 [source=WashU]  Length: 108  Sat Sep 23 08:47:33 2017  Type: P  Check: 7577  ..

       1  MTQPLICAYR MCFVIDKYHS IFMCANYLNV YLERSTMVFS FLTVMPGDFI

      51  KCLFLRFFVK FKLRFPNGLL NIFQKMLFNM LVQVTHELLR MRICSITNFF

     101  RVLVRLV*

Protein Sequence for YER067C-A_T73 from WashU:

YER067C-A_T73 [source=WashU]  Length: 108  Sat Sep 23 08:47:33 2017  Type: P  Check: 7577  ..

       1  MTQPLICAYR MCFVIDKYHS IFMCANYLNV YLERSTMVFS FLTVMPGDFI

      51  KCLFLRFFVK FKLRFPNGLL NIFQKMLFNM LVQVTHELLR MRICSITNFF

     101  RVLVRLV*

Protein Sequence for YER067C-A_UC5 from WashU:

YER067C-A_UC5 [source=WashU]  Length: 108  Sat Sep 23 08:47:33 2017  Type: P  Check: 7271  ..

       1  MTQPLICAYR MCFVIDKHHS IFMCANYLNV YLERSTMVFS FLTVMPGDFI

      51  KCLFLRFFVK FKLRFPNGLL NIFQKMLFNM LVQVTHELLR MRICSITNFF

     101  RVLVRLV*

Protein Sequence for YER067C-A_VL3 from AWRI:

YER067C-A_VL3 [source=AWRI]  Length: 108  Sat Sep 23 08:47:33 2017  Type: P  Check: 7577  ..

       1  MTQPLICAYR MCFVIDKYHS IFMCANYLNV YLERSTMVFS FLTVMPGDFI

      51  KCLFLRFFVK FKLRFPNGLL NIFQKMLFNM LVQVTHELLR MRICSITNFF

     101  RVLVRLV*

Protein Sequence for YER067C-A_Vin13 from AWRI:

YER067C-A_Vin13 [source=AWRI]  Length: 108  Sat Sep 23 08:47:33 2017  Type: P  Check: 7577  ..

       1  MTQPLICAYR MCFVIDKYHS IFMCANYLNV YLERSTMVFS FLTVMPGDFI

      51  KCLFLRFFVK FKLRFPNGLL NIFQKMLFNM LVQVTHELLR MRICSITNFF

     101  RVLVRLV*

Protein Sequence for YER067C-A_YJM269 from WashU:

YER067C-A_YJM269 [source=WashU]  Length: 108  Sat Sep 23 08:47:33 2017  Type: P  Check: 7577  ..

       1  MTQPLICAYR MCFVIDKYHS IFMCANYLNV YLERSTMVFS FLTVMPGDFI

      51  KCLFLRFFVK FKLRFPNGLL NIFQKMLFNM LVQVTHELLR MRICSITNFF

     101  RVLVRLV*

Protein Sequence for YER067C-A_YJM789 from Stanford:

YER067C-A_YJM789 [source=Stanford]  Length: 108  Sat Sep 23 08:47:33 2017  Type: P  Check: 7127  ..

       1  MTQPLICAYR MCFVIDKYHS IFMCANYLNV YLERSTMVFS FLTVMPGDFI

      51  KCLFLRFFVK FKLRFPNGLL NIFQKMLFNM LVQVTHELLR MRICSITNFF

     101  RVLVRLM*

Protein Sequence for YER067C-A_ZTW1 from Zhejiang:

YER067C-A_ZTW1 [source=Zhejiang]  Length: 108  Sat Sep 23 08:47:33 2017  Type: P  Check: 7271  ..

       1  MTQPLICAYR MCFVIDKHHS IFMCANYLNV YLERSTMVFS FLTVMPGDFI

      51  KCLFLRFFVK FKLRFPNGLL NIFQKMLFNM LVQVTHELLR MRICSITNFF

     101  RVLVRLV*