YEL074W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YEL074W_S288C   1   ---MDLRSALEKTNIIKSYKLHFLIRYTTSRFEVKEPFLAYLHMARQKDK   47
YEL074W_BY4742   1   ---MDLRSALEKTNIIKSYKLHFLIRYTTSRFEVKEPFLAYLHMARQKDK   47
YEL074W_EC9-8   1   --------MLTFTCILIGRTHTDATVYHLN---------LPYSHIPLHDP   33
YEL074W_FostersB   1   --------MLTFTCIXXXXYXHXXYSIPLN---------XTYSHIPLHDP   33
YEL074W_FostersO   1   -------------------------------------------MARQTDX   7
YEL074W_Kyokai7   1   --------MLTFTCILMGRTHTDATVYHLN---------LPYSHIPLHDP   33
YEL074W_LalvinQA23   1   --------MLTFTCILIGRTHTDATVYHLN---------LPYSHIPLHDP   33
YEL074W_M22   1   --------MLTFTCILIGRTHTDATIYHLN---------LPYSHIPLHDP   33
YEL074W_SEY6210   1   ---MDLRSALEKTNIIKSYKLHFLIRYTTSRFEVKEPFLAYLHMARQKDK   47
YEL074W_YPH499   1   ---MDLRSALEKTNIIKSYKLHFLIRYTTSRFEVKEPFLAYLHMARQKDK   47
YEL074W_YPS128   1   KNHHQNHLNIKIFYLSTSRNKHFDLKYEYYHGVIN----LKVPMARQTDN   46
         

YEL074W_S288C   48   LLPKCITPPNKKADPFTNDVSSYFTHTHTHTPCSPSLVYTYVNTTEKSPS   97
YEL074W_BY4742   48   LLPKCITPPNKKADPFTNDVSSYFTHTHTHTPCSPSLVYTYVNTTEKSPS   97
YEL074W_EC9-8   34   LLHHILTTEFVYTYVNTTEKSPSKSPKHKNILPFNFTK------------   71
YEL074W_FostersB   34   LXHXILTTXXXYTYXNTTEKSPSKSPKHKNILPFNFTK------------   71
YEL074W_FostersO   8   LXXKCITPPNKKTDPFTNDVSSYFTHTHTHTPCSPSLVYTYVNTTEKSPS   57
YEL074W_Kyokai7   34   LLHHILTTEFVYTYVNTTEKSPSKSPKHKNILPFNFTK------------   71
YEL074W_LalvinQA23   34   LLHHILTTEFVCTYVNTTEKSPSKSPKHKNILPFNFTK------------   71
YEL074W_M22   34   LLHHILTTEFVCTYVNTTEKSPSKSPKHKNILPFNFTK------------   71
YEL074W_SEY6210   48   LLPKCITPPNKKADPFTNDVSSYFTHTHTHTPCSPSLVYTYVNTTEKSPS   97
YEL074W_YPH499   48   LLPKCITPPNKKADPFTNDVSSYFTHTHTHTPCSPSLVYTYVNTTEKSPS   97
YEL074W_YPS128   47   LPSKCITPPNKKTDPFTNDVSSYFTHTHTHTPCSPSL-------------   83
         

YEL074W_S288C   98   KSPKHKNILPFNFTK   112
YEL074W_BY4742   98   KSPKHKNILPFNFTK   112
YEL074W_EC9-8   
   ---------------   
YEL074W_FostersB   
   ---------------   
YEL074W_FostersO   58   KSPKHKNILPFNFTK   72
YEL074W_Kyokai7   
   ---------------   
YEL074W_LalvinQA23   
   ---------------   
YEL074W_M22   
   ---------------   
YEL074W_SEY6210   98   KSPKHKNILPFNFTK   112
YEL074W_YPH499   98   KSPKHKNILPFNFTK   112
YEL074W_YPS128   
   ---------------   
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YEL074W_S288C from SGD:

YEL074W_S288C [source=SGD]  Length: 113  Wed Sep 20 11:30:06 2017  Type: P  Check: 9586  ..

       1  MDLRSALEKT NIIKSYKLHF LIRYTTSRFE VKEPFLAYLH MARQKDKLLP

      51  KCITPPNKKA DPFTNDVSSY FTHTHTHTPC SPSLVYTYVN TTEKSPSKSP

     101  KHKNILPFNF TK*

Protein Sequence for YEL074W_BY4742 from Stanford:

YEL074W_BY4742 [source=Stanford]  Length: 113  Wed Sep 20 11:30:06 2017  Type: P  Check: 9586  ..

       1  MDLRSALEKT NIIKSYKLHF LIRYTTSRFE VKEPFLAYLH MARQKDKLLP

      51  KCITPPNKKA DPFTNDVSSY FTHTHTHTPC SPSLVYTYVN TTEKSPSKSP

     101  KHKNILPFNF TK*

Protein Sequence for YEL074W_EC9-8 from ASinica:

YEL074W_EC9-8 [source=ASinica]  Length: 72  Wed Sep 20 11:30:06 2017  Type: P  Check: 8453  ..

       1  MLTFTCILIG RTHTDATVYH LNLPYSHIPL HDPLLHHILT TEFVYTYVNT

      51  TEKSPSKSPK HKNILPFNFT K*

Protein Sequence for YEL074W_FostersB from AWRI:

YEL074W_FostersB [source=AWRI]  Length: 72  Wed Sep 20 11:30:06 2017  Type: P  Check: 2715  ..

       1  MLTFTCIXXX XYXHXXYSIP LNXTYSHIPL HDPLXHXILT TXXXYTYXNT

      51  TEKSPSKSPK HKNILPFNFT K*

Protein Sequence for YEL074W_FostersO from AWRI:

YEL074W_FostersO [source=AWRI]  Length: 73  Wed Sep 20 11:30:06 2017  Type: P  Check: 1964  ..

       1  MARQTDXLXX KCITPPNKKT DPFTNDVSSY FTHTHTHTPC SPSLVYTYVN

      51  TTEKSPSKSP KHKNILPFNF TK*

Protein Sequence for YEL074W_Kyokai7 from NRIB:

YEL074W_Kyokai7 [source=NRIB]  Length: 72  Wed Sep 20 11:30:06 2017  Type: P  Check: 8489  ..

       1  MLTFTCILMG RTHTDATVYH LNLPYSHIPL HDPLLHHILT TEFVYTYVNT

      51  TEKSPSKSPK HKNILPFNFT K*

Protein Sequence for YEL074W_LalvinQA23 from AWRI:

YEL074W_LalvinQA23 [source=AWRI]  Length: 72  Wed Sep 20 11:30:06 2017  Type: P  Check: 7463  ..

       1  MLTFTCILIG RTHTDATVYH LNLPYSHIPL HDPLLHHILT TEFVCTYVNT

      51  TEKSPSKSPK HKNILPFNFT K*

Protein Sequence for YEL074W_M22 from WashU:

YEL074W_M22 [source=WashU]  Length: 72  Wed Sep 20 11:30:06 2017  Type: P  Check: 7229  ..

       1  MLTFTCILIG RTHTDATIYH LNLPYSHIPL HDPLLHHILT TEFVCTYVNT

      51  TEKSPSKSPK HKNILPFNFT K*

Protein Sequence for YEL074W_SEY6210 from Stanford:

YEL074W_SEY6210 [source=Stanford]  Length: 113  Wed Sep 20 11:30:06 2017  Type: P  Check: 9586  ..

       1  MDLRSALEKT NIIKSYKLHF LIRYTTSRFE VKEPFLAYLH MARQKDKLLP

      51  KCITPPNKKA DPFTNDVSSY FTHTHTHTPC SPSLVYTYVN TTEKSPSKSP

     101  KHKNILPFNF TK*

Protein Sequence for YEL074W_YPH499 from Stanford:

YEL074W_YPH499 [source=Stanford]  Length: 113  Wed Sep 20 11:30:06 2017  Type: P  Check: 9586  ..

       1  MDLRSALEKT NIIKSYKLHF LIRYTTSRFE VKEPFLAYLH MARQKDKLLP

      51  KCITPPNKKA DPFTNDVSSY FTHTHTHTPC SPSLVYTYVN TTEKSPSKSP

     101  KHKNILPFNF TK*

Protein Sequence for YEL074W_YPS128 from Stanford:

YEL074W_YPS128 [source=Stanford]  Length: 84  Wed Sep 20 11:30:06 2017  Type: P  Check: 6534  ..

       1  KNHHQNHLNI KIFYLSTSRN KHFDLKYEYY HGVINLKVP* MARQTDNLPS

      51  KCITPPNKKT DPFTNDVSSY FTHTHTHTPC SPSL