SOM1/YEL059C-A S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YEL059C-A_S288C   1   MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAEYVCSPFKR   50
YEL059C-A_AWRI796   1   MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAEYVCSPFKR   50
YEL059C-A_CLIB215   1   MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAEYVCSPFKR   50
YEL059C-A_CLIB324   1   MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAEYVCSPFKR   50
YEL059C-A_FostersO   1   MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAEYVXSPFKR   50
YEL059C-A_Kyokai7   1   MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAEYVCSPFKR   50
YEL059C-A_PW5   1   MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAEYVCSPFKR   50
YEL059C-A_UC5   1   MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAEYVCSPFKR   50
YEL059C-A_YJM269   1   MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAEYVCSPFKR   50
YEL059C-A_YJM789   1   MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAEYVCSPFKR   50
YEL059C-A_ZTW1   1   MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAEYVCSPFKR   50
         

YEL059C-A_S288C   51   LFEHCIAPDKSATNYEVTDTYTNS   74
YEL059C-A_AWRI796   51   LFEHCIAPDKSATNYEVTDTYTNS   74
YEL059C-A_CLIB215   51   LFEHCIAPDKSATNYEVTDTYTNS   74
YEL059C-A_CLIB324   51   LFEHCIAPDKSATNYEVTDTYTNS   74
YEL059C-A_FostersO   51   LFEHCIAPDKSATNYEVTDXYTNS   74
YEL059C-A_Kyokai7   51   LFEHCIAPDESATNYEVTDTYTNS   74
YEL059C-A_PW5   51   LFEHCIAPDKSATNYEVTDTYTNS   74
YEL059C-A_UC5   51   LFEHCIAPDESATNYEVTDTYTNS   74
YEL059C-A_YJM269   51   LFEHCIAPDKSATNYEVTDTYTNS   74
YEL059C-A_YJM789   51   LFEHCIAPDKSATNYEVTDTYTNS   74
YEL059C-A_ZTW1   51   LFEHCIAPDKSATNYEVTDTYTNS   74
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YEL059C-A_S288C from SGD:

YEL059C-A_S288C [source=SGD]  Length: 75  Wed Sep 20 05:37:32 2017  Type: P  Check: 6831  ..

       1  MAPPTTIRTR DQALAPLATL DSQTNCRLKE LVQWECQFKG AEYVCSPFKR

      51  LFEHCIAPDK SATNYEVTDT YTNS*

Protein Sequence for YEL059C-A_AWRI796 from AWRI:

YEL059C-A_AWRI796 [source=AWRI]  Length: 75  Wed Sep 20 05:37:32 2017  Type: P  Check: 6831  ..

       1  MAPPTTIRTR DQALAPLATL DSQTNCRLKE LVQWECQFKG AEYVCSPFKR

      51  LFEHCIAPDK SATNYEVTDT YTNS*

Protein Sequence for YEL059C-A_CLIB215 from WashU:

YEL059C-A_CLIB215 [source=WashU]  Length: 75  Wed Sep 20 05:37:32 2017  Type: P  Check: 6831  ..

       1  MAPPTTIRTR DQALAPLATL DSQTNCRLKE LVQWECQFKG AEYVCSPFKR

      51  LFEHCIAPDK SATNYEVTDT YTNS*

Protein Sequence for YEL059C-A_CLIB324 from WashU:

YEL059C-A_CLIB324 [source=WashU]  Length: 75  Wed Sep 20 05:37:32 2017  Type: P  Check: 6831  ..

       1  MAPPTTIRTR DQALAPLATL DSQTNCRLKE LVQWECQFKG AEYVCSPFKR

      51  LFEHCIAPDK SATNYEVTDT YTNS*

Protein Sequence for YEL059C-A_FostersO from AWRI:

YEL059C-A_FostersO [source=AWRI]  Length: 75  Wed Sep 20 05:37:32 2017  Type: P  Check: 7828  ..

       1  MAPPTTIRTR DQALAPLATL DSQTNCRLKE LVQWECQFKG AEYVXSPFKR

      51  LFEHCIAPDK SATNYEVTDX YTNS*

Protein Sequence for YEL059C-A_Kyokai7 from NRIB:

YEL059C-A_Kyokai7 [source=NRIB]  Length: 75  Wed Sep 20 05:37:32 2017  Type: P  Check: 6813  ..

       1  MAPPTTIRTR DQALAPLATL DSQTNCRLKE LVQWECQFKG AEYVCSPFKR

      51  LFEHCIAPDE SATNYEVTDT YTNS*

Protein Sequence for YEL059C-A_PW5 from WashU:

YEL059C-A_PW5 [source=WashU]  Length: 75  Wed Sep 20 05:37:32 2017  Type: P  Check: 6831  ..

       1  MAPPTTIRTR DQALAPLATL DSQTNCRLKE LVQWECQFKG AEYVCSPFKR

      51  LFEHCIAPDK SATNYEVTDT YTNS*

Protein Sequence for YEL059C-A_UC5 from WashU:

YEL059C-A_UC5 [source=WashU]  Length: 75  Wed Sep 20 05:37:32 2017  Type: P  Check: 6813  ..

       1  MAPPTTIRTR DQALAPLATL DSQTNCRLKE LVQWECQFKG AEYVCSPFKR

      51  LFEHCIAPDE SATNYEVTDT YTNS*

Protein Sequence for YEL059C-A_YJM269 from WashU:

YEL059C-A_YJM269 [source=WashU]  Length: 75  Wed Sep 20 05:37:32 2017  Type: P  Check: 6831  ..

       1  MAPPTTIRTR DQALAPLATL DSQTNCRLKE LVQWECQFKG AEYVCSPFKR

      51  LFEHCIAPDK SATNYEVTDT YTNS*

Protein Sequence for YEL059C-A_YJM789 from Stanford:

YEL059C-A_YJM789 [source=Stanford]  Length: 75  Wed Sep 20 05:37:32 2017  Type: P  Check: 6831  ..

       1  MAPPTTIRTR DQALAPLATL DSQTNCRLKE LVQWECQFKG AEYVCSPFKR

      51  LFEHCIAPDK SATNYEVTDT YTNS*

Protein Sequence for YEL059C-A_ZTW1 from Zhejiang:

YEL059C-A_ZTW1 [source=Zhejiang]  Length: 75  Wed Sep 20 05:37:32 2017  Type: P  Check: 6831  ..

       1  MAPPTTIRTR DQALAPLATL DSQTNCRLKE LVQWECQFKG AEYVCSPFKR

      51  LFEHCIAPDK SATNYEVTDT YTNS*