YEL020C-B S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YEL020C-B_S288C   1   MMHVCSLLVSFDVVKSLTQSVKHLSTRLEYKRMKSFICFCSTTFWNSCCS   50
YEL020C-B_AWRI1631   1   MMHVCSLLVSFDVVKSLTQSVKHLSTRLEYKRMKSFICFCSTTFWNSCCS   50
YEL020C-B_AWRI796   1   MMHVCSLLVSFDVVKSLTQSVKHLSTRLEYKRMKSFICFCSTTFWNSCCS   50
YEL020C-B_CBS7960   1   MMHVCSLLVSFDVVKSLTQSVKHLSTRLEYKRMKSFICFCSTTFWNSCCS   50
YEL020C-B_CLIB215   1   MMHVCSLLVSFDVVKSLTQSVKHLSTRLEYKRMKSFICFCSTTFWNSCCS   50
YEL020C-B_CLIB324   1   MMHVCSLLVSFDVVKSLTQSVKHLSTRLEYKRMKSFICFCSTTFWNSCCS   50
YEL020C-B_CLIB382   1   MMHVCSLLVSFDVVKSLTQSVKHLSTRLEYKRMKSFICFCSTTFWNSCCS   50
YEL020C-B_EC1118   1   MMHVCSLLVSFDVVKSLTQSVKHLSTRLEYKRMKSFICFCSTTFWNSCCS   50
YEL020C-B_EC9-8   1   MMHVCSLLVSFDVVKSLTQSVKHLSTRLEYKRMKSFICFCSTTFWNSCCS   50
YEL020C-B_FostersB   1   MMHVCSLLVSFDVVKSLTQSVKHLSTRLEYKRMKSFICFCSTTFWNSCCS   50
YEL020C-B_FostersO   1   MMHVCSLLVSFDVVKSLTQSVKHLSTRLEYKRMKSFICFCSTTFWNSCCS   50
YEL020C-B_JAY291   1   MMHVCSLLVSFDVVKSLTQSVKHLSTRLEYKRMKSFICFCSTTFWNSCCS   50
YEL020C-B_Kyokai7   1   MMHVCSLLVSFDVVKSLTQSVKHLSTRLEYKRMKSFICFCSTTFWNSCCS   50
YEL020C-B_LalvinQA23   1   MMHVCSLLVSFDVVKSLTQSVKHLSTRLEYKRMKSFICFCSTTFWNSCCS   50
YEL020C-B_M22   1   MMHVCSLLVSFDVVKSLTQSVKHLSTRLEYKRMKSFICFCSTTFWNSCCS   50
YEL020C-B_PW5   1   MMHVCSLLVSFDVVKSLTQSVKHLSTRLEYKRMKSFICFCSTTFWNSCCS   50
YEL020C-B_T7   1   MMHVCSLLVSFDVVKSLTQSVKHLSTRLEYKRMKSFICFCSTTFWNSCCS   50
YEL020C-B_T73   1   MMHVCSLLVSFDVVKSLTQSVKHLSTRLEYKRMKSFICFCSTTFWNSCCS   50
YEL020C-B_UC5   1   MMHVCSLLVSFDVVKSLTQSVKHLSTRLEYKRMKSFICFCSTTFWNSCCS   50
YEL020C-B_VL3   1   MMHVCSLLVSFDVVKSLTQSVKHLSTRLEYKRMKSFICFCSTTFWNSCCS   50
YEL020C-B_Vin13   1   --MFCSLLVSFDVVKSLTQSVKHLSTRLEYKRMKSFICFCSTTFWNSCCS   48
YEL020C-B_YJM269   1   MMHVCSLLVSFDVVKSLTQSVKHLSTRLEYKRMKSFICFCSTTFWNSCCS   50
YEL020C-B_YJM789   1   MMHVCSLLVSFDVVKSLTQSVKHLSTRLEYKRMKSFICFCSTTFWNSCCS   50
YEL020C-B_ZTW1   1   MMHVCSLLVSFDVVKSLTQSVKHLSTRLEYKRMKSFICFCSTTFWNSCCS   50
         

YEL020C-B_S288C   51   LEFNASIFTVLSYCS   65
YEL020C-B_AWRI1631   51   LEFNASIFTVLSYCS   65
YEL020C-B_AWRI796   51   LEFNASIFTVLSYCS   65
YEL020C-B_CBS7960   51   LEFNASIFTVLSYCS   65
YEL020C-B_CLIB215   51   LEFNASIFTVLSYCS   65
YEL020C-B_CLIB324   51   LEFNASIFTVLSYCS   65
YEL020C-B_CLIB382   51   LEFNASIFTVLSYCS   65
YEL020C-B_EC1118   51   LEFNASIFTVLSYCS   65
YEL020C-B_EC9-8   51   LEFNASIFTVLSYCS   65
YEL020C-B_FostersB   51   LEFNASIFTVLSYCS   65
YEL020C-B_FostersO   51   LEFNASIFTVLSYCS   65
YEL020C-B_JAY291   51   LEFNASIFTVLSYCS   65
YEL020C-B_Kyokai7   51   LEFNASIFTVLSYCS   65
YEL020C-B_LalvinQA23   51   LEFNASIFTVLSYCS   65
YEL020C-B_M22   51   LEFNASIFTVLSYCS   65
YEL020C-B_PW5   51   LEFNASIFTVLSYCS   65
YEL020C-B_T7   51   LEFNASIFTVLSYCS   65
YEL020C-B_T73   51   LEFNASIFTVLSYCS   65
YEL020C-B_UC5   51   LEFNASIFTVLSYCS   65
YEL020C-B_VL3   51   LEFNASIFTVLSYCS   65
YEL020C-B_Vin13   49   LEFNASIFTVLSYCS   63
YEL020C-B_YJM269   51   LEFNASIFTVLSYCS   65
YEL020C-B_YJM789   51   LEFNASIFTVLSYCS   65
YEL020C-B_ZTW1   51   LEFNASIFTVLSYCS   65
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YEL020C-B_S288C from SGD:

YEL020C-B_S288C [source=SGD]  Length: 66  Sun Sep 24 01:38:30 2017  Type: P  Check: 9768  ..

       1  MMHVCSLLVS FDVVKSLTQS VKHLSTRLEY KRMKSFICFC STTFWNSCCS

      51  LEFNASIFTV LSYCS*

Protein Sequence for YEL020C-B_AWRI1631 from AWRI:

YEL020C-B_AWRI1631 [source=AWRI]  Length: 66  Sun Sep 24 01:38:30 2017  Type: P  Check: 9768  ..

       1  MMHVCSLLVS FDVVKSLTQS VKHLSTRLEY KRMKSFICFC STTFWNSCCS

      51  LEFNASIFTV LSYCS*

Protein Sequence for YEL020C-B_AWRI796 from AWRI:

YEL020C-B_AWRI796 [source=AWRI]  Length: 66  Sun Sep 24 01:38:30 2017  Type: P  Check: 9768  ..

       1  MMHVCSLLVS FDVVKSLTQS VKHLSTRLEY KRMKSFICFC STTFWNSCCS

      51  LEFNASIFTV LSYCS*

Protein Sequence for YEL020C-B_CBS7960 from WashU:

YEL020C-B_CBS7960 [source=WashU]  Length: 66  Sun Sep 24 01:38:30 2017  Type: P  Check: 9768  ..

       1  MMHVCSLLVS FDVVKSLTQS VKHLSTRLEY KRMKSFICFC STTFWNSCCS

      51  LEFNASIFTV LSYCS*

Protein Sequence for YEL020C-B_CLIB215 from WashU:

YEL020C-B_CLIB215 [source=WashU]  Length: 66  Sun Sep 24 01:38:30 2017  Type: P  Check: 9768  ..

       1  MMHVCSLLVS FDVVKSLTQS VKHLSTRLEY KRMKSFICFC STTFWNSCCS

      51  LEFNASIFTV LSYCS*

Protein Sequence for YEL020C-B_CLIB324 from WashU:

YEL020C-B_CLIB324 [source=WashU]  Length: 66  Sun Sep 24 01:38:30 2017  Type: P  Check: 9768  ..

       1  MMHVCSLLVS FDVVKSLTQS VKHLSTRLEY KRMKSFICFC STTFWNSCCS

      51  LEFNASIFTV LSYCS*

Protein Sequence for YEL020C-B_CLIB382 from WashU:

YEL020C-B_CLIB382 [source=WashU]  Length: 66  Sun Sep 24 01:38:30 2017  Type: P  Check: 9768  ..

       1  MMHVCSLLVS FDVVKSLTQS VKHLSTRLEY KRMKSFICFC STTFWNSCCS

      51  LEFNASIFTV LSYCS*

Protein Sequence for YEL020C-B_EC1118 from Genoscope:

YEL020C-B_EC1118 [source=Genoscope]  Length: 66  Sun Sep 24 01:38:30 2017  Type: P  Check: 9768  ..

       1  MMHVCSLLVS FDVVKSLTQS VKHLSTRLEY KRMKSFICFC STTFWNSCCS

      51  LEFNASIFTV LSYCS*

Protein Sequence for YEL020C-B_EC9-8 from ASinica:

YEL020C-B_EC9-8 [source=ASinica]  Length: 66  Sun Sep 24 01:38:30 2017  Type: P  Check: 9768  ..

       1  MMHVCSLLVS FDVVKSLTQS VKHLSTRLEY KRMKSFICFC STTFWNSCCS

      51  LEFNASIFTV LSYCS*

Protein Sequence for YEL020C-B_FostersB from AWRI:

YEL020C-B_FostersB [source=AWRI]  Length: 66  Sun Sep 24 01:38:30 2017  Type: P  Check: 9768  ..

       1  MMHVCSLLVS FDVVKSLTQS VKHLSTRLEY KRMKSFICFC STTFWNSCCS

      51  LEFNASIFTV LSYCS*

Protein Sequence for YEL020C-B_FostersO from AWRI:

YEL020C-B_FostersO [source=AWRI]  Length: 66  Sun Sep 24 01:38:30 2017  Type: P  Check: 9768  ..

       1  MMHVCSLLVS FDVVKSLTQS VKHLSTRLEY KRMKSFICFC STTFWNSCCS

      51  LEFNASIFTV LSYCS*

Protein Sequence for YEL020C-B_JAY291 from Duke:

YEL020C-B_JAY291 [source=Duke]  Length: 66  Sun Sep 24 01:38:30 2017  Type: P  Check: 9768  ..

       1  MMHVCSLLVS FDVVKSLTQS VKHLSTRLEY KRMKSFICFC STTFWNSCCS

      51  LEFNASIFTV LSYCS*

Protein Sequence for YEL020C-B_Kyokai7 from NRIB:

YEL020C-B_Kyokai7 [source=NRIB]  Length: 66  Sun Sep 24 01:38:30 2017  Type: P  Check: 9768  ..

       1  MMHVCSLLVS FDVVKSLTQS VKHLSTRLEY KRMKSFICFC STTFWNSCCS

      51  LEFNASIFTV LSYCS*

Protein Sequence for YEL020C-B_LalvinQA23 from AWRI:

YEL020C-B_LalvinQA23 [source=AWRI]  Length: 66  Sun Sep 24 01:38:30 2017  Type: P  Check: 9768  ..

       1  MMHVCSLLVS FDVVKSLTQS VKHLSTRLEY KRMKSFICFC STTFWNSCCS

      51  LEFNASIFTV LSYCS*

Protein Sequence for YEL020C-B_M22 from WashU:

YEL020C-B_M22 [source=WashU]  Length: 66  Sun Sep 24 01:38:30 2017  Type: P  Check: 9768  ..

       1  MMHVCSLLVS FDVVKSLTQS VKHLSTRLEY KRMKSFICFC STTFWNSCCS

      51  LEFNASIFTV LSYCS*

Protein Sequence for YEL020C-B_PW5 from WashU:

YEL020C-B_PW5 [source=WashU]  Length: 66  Sun Sep 24 01:38:30 2017  Type: P  Check: 9768  ..

       1  MMHVCSLLVS FDVVKSLTQS VKHLSTRLEY KRMKSFICFC STTFWNSCCS

      51  LEFNASIFTV LSYCS*

Protein Sequence for YEL020C-B_T7 from WashU:

YEL020C-B_T7 [source=WashU]  Length: 66  Sun Sep 24 01:38:30 2017  Type: P  Check: 9768  ..

       1  MMHVCSLLVS FDVVKSLTQS VKHLSTRLEY KRMKSFICFC STTFWNSCCS

      51  LEFNASIFTV LSYCS*

Protein Sequence for YEL020C-B_T73 from WashU:

YEL020C-B_T73 [source=WashU]  Length: 66  Sun Sep 24 01:38:30 2017  Type: P  Check: 9768  ..

       1  MMHVCSLLVS FDVVKSLTQS VKHLSTRLEY KRMKSFICFC STTFWNSCCS

      51  LEFNASIFTV LSYCS*

Protein Sequence for YEL020C-B_UC5 from WashU:

YEL020C-B_UC5 [source=WashU]  Length: 66  Sun Sep 24 01:38:30 2017  Type: P  Check: 9768  ..

       1  MMHVCSLLVS FDVVKSLTQS VKHLSTRLEY KRMKSFICFC STTFWNSCCS

      51  LEFNASIFTV LSYCS*

Protein Sequence for YEL020C-B_VL3 from AWRI:

YEL020C-B_VL3 [source=AWRI]  Length: 66  Sun Sep 24 01:38:30 2017  Type: P  Check: 9768  ..

       1  MMHVCSLLVS FDVVKSLTQS VKHLSTRLEY KRMKSFICFC STTFWNSCCS

      51  LEFNASIFTV LSYCS*

Protein Sequence for YEL020C-B_Vin13 from AWRI:

YEL020C-B_Vin13 [source=AWRI]  Length: 64  Sun Sep 24 01:38:30 2017  Type: P  Check: 8424  ..

       1  MFCSLLVSFD VVKSLTQSVK HLSTRLEYKR MKSFICFCST TFWNSCCSLE

      51  FNASIFTVLS YCS*

Protein Sequence for YEL020C-B_YJM269 from WashU:

YEL020C-B_YJM269 [source=WashU]  Length: 66  Sun Sep 24 01:38:30 2017  Type: P  Check: 9768  ..

       1  MMHVCSLLVS FDVVKSLTQS VKHLSTRLEY KRMKSFICFC STTFWNSCCS

      51  LEFNASIFTV LSYCS*

Protein Sequence for YEL020C-B_YJM789 from Stanford:

YEL020C-B_YJM789 [source=Stanford]  Length: 66  Sun Sep 24 01:38:30 2017  Type: P  Check: 9768  ..

       1  MMHVCSLLVS FDVVKSLTQS VKHLSTRLEY KRMKSFICFC STTFWNSCCS

      51  LEFNASIFTV LSYCS*

Protein Sequence for YEL020C-B_ZTW1 from Zhejiang:

YEL020C-B_ZTW1 [source=Zhejiang]  Length: 66  Sun Sep 24 01:38:30 2017  Type: P  Check: 9768  ..

       1  MMHVCSLLVS FDVVKSLTQS VKHLSTRLEY KRMKSFICFC STTFWNSCCS

      51  LEFNASIFTV LSYCS*