RPP2B/YDR382W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YDR382W_S288C   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_AWRI1631   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_AWRI796   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_BC187   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_BY4741   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_BY4742   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_CBS7960   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_CEN.PK   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_CLIB215   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_CLIB324   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_CLIB382   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_D273-10B   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_DBVPG6044   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_EC1118   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_EC9-8   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_FL100   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_FY1679   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_FostersB   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_FostersO   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_JAY291   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_JK9-3d   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_K11   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_Kyokai7   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_L1528   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_LalvinQA23   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEXKG   50
YDR382W_PW5   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_RM11-1a   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_RedStar   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_SEY6210   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_SK1   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_T7   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_UC5   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_UWOPS05_217_3   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_VL3   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_Vin13   1   MKYLAAYLLXVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_W303   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_X2180-1A   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_Y10   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_Y55   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_YJM269   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_YJM339   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_YJM789   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_YPH499   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_YPS128   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_YPS163   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_YS9   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
YDR382W_ZTW1   1   MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKG   50
         

YDR382W_S288C   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_AWRI1631   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_AWRI796   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_BC187   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_BY4741   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_BY4742   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_CBS7960   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_CEN.PK   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_CLIB215   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_CLIB324   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_CLIB382   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_D273-10B   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_DBVPG6044   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_EC1118   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_EC9-8   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_FL100   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_FY1679   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_FostersB   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_FostersO   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_JAY291   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_JK9-3d   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_K11   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_Kyokai7   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_L1528   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_LalvinQA23   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_PW5   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_RM11-1a   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_RedStar   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_SEY6210   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_SK1   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_T7   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_UC5   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_UWOPS05_217_3   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_VL3   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_Vin13   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_W303   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_X2180-1A   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_Y10   51   SWKKSSLKVKR--SSLLFQLVVLLLLLPVLPVLLPVVMLLKKKRKKKLRK   98
YDR382W_Y55   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_YJM269   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_YJM339   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_YJM789   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_YPH499   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_YPS128   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_YPS163   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_YS9   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
YDR382W_ZTW1   51   SLEEIIAEGQKKFATVPTGGASSAAAGAAGAAAGGDAAEEEKEEEAKEES   100
         

YDR382W_S288C   101   DDDMGFGLFD--   110
YDR382W_AWRI1631   101   DDDMGFGLFD--   110
YDR382W_AWRI796   101   DDDMGFGLFD--   110
YDR382W_BC187   101   DDDMGFGLFD--   110
YDR382W_BY4741   101   DDDMGFGLFD--   110
YDR382W_BY4742   101   DDDMGFGLFD--   110
YDR382W_CBS7960   101   DDDMGFGLFD--   110
YDR382W_CEN.PK   101   DDDMGFGLFD--   110
YDR382W_CLIB215   101   DDDMGFGLFD--   110
YDR382W_CLIB324   101   DDDMGFGLFD--   110
YDR382W_CLIB382   101   DDDMGFGLFD--   110
YDR382W_D273-10B   101   DDDMGFGLFD--   110
YDR382W_DBVPG6044   101   DDDMGFGLFD--   110
YDR382W_EC1118   101   DDDMGFGLFD--   110
YDR382W_EC9-8   101   DDDMGFGLFD--   110
YDR382W_FL100   101   DDDMGFGLFD--   110
YDR382W_FY1679   101   DDDMGFGLFD--   110
YDR382W_FostersB   101   DDDMGFGLFD--   110
YDR382W_FostersO   101   DDDMGFGLFD--   110
YDR382W_JAY291   101   DDDMGFGLFD--   110
YDR382W_JK9-3d   101   DDDMGFGLFD--   110
YDR382W_K11   101   DDDMGFGLFD--   110
YDR382W_Kyokai7   101   DDDMGFGLFD--   110
YDR382W_L1528   101   DDDMGFGLFD--   110
YDR382W_LalvinQA23   101   DDDMGFGLFD--   110
YDR382W_PW5   101   DDDMGFGLFD--   110
YDR382W_RM11-1a   101   DDDMGFGLFD--   110
YDR382W_RedStar   101   DDDMGFGLFD--   110
YDR382W_SEY6210   101   DDDMGFGLFD--   110
YDR382W_SK1   101   DDDMGFGLFD--   110
YDR382W_T7   101   DDDMGFGLFD--   110
YDR382W_UC5   101   DDDMGFGLFD--   110
YDR382W_UWOPS05_217_3   101   DDDMGFGLFD--   110
YDR382W_VL3   101   DDDMGFGLFD--   110
YDR382W_Vin13   101   DDDMGFGLFD--   110
YDR382W_W303   101   DDDMGFGLFD--   110
YDR382W_X2180-1A   101   DDDMGFGLFD--   110
YDR382W_Y10   99   NLMMTWVLVYSI   110
YDR382W_Y55   101   DDDMGFGLFD--   110
YDR382W_YJM269   101   DDDMGFGLFD--   110
YDR382W_YJM339   101   DDDMGFGLFD--   110
YDR382W_YJM789   101   DDDMGFGLFD--   110
YDR382W_YPH499   101   DDDMGFGLFD--   110
YDR382W_YPS128   101   DDDMGFGLFD--   110
YDR382W_YPS163   101   DDDMGFGLFD--   110
YDR382W_YS9   101   DDDMGFGLFD--   110
YDR382W_ZTW1   101   DDDMGFGLFD--   110
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YDR382W_S288C from SGD:

YDR382W_S288C [source=SGD]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_AWRI1631 from AWRI:

YDR382W_AWRI1631 [source=AWRI]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_AWRI796 from AWRI:

YDR382W_AWRI796 [source=AWRI]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_BC187 from Stanford:

YDR382W_BC187 [source=Stanford]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_BY4741 from Stanford:

YDR382W_BY4741 [source=Stanford]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_BY4742 from Stanford:

YDR382W_BY4742 [source=Stanford]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_CBS7960 from WashU:

YDR382W_CBS7960 [source=WashU]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_CEN.PK from Stanford:

YDR382W_CEN.PK [source=Stanford]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_CLIB215 from WashU:

YDR382W_CLIB215 [source=WashU]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_CLIB324 from WashU:

YDR382W_CLIB324 [source=WashU]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_CLIB382 from WashU:

YDR382W_CLIB382 [source=WashU]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_D273-10B from Stanford:

YDR382W_D273-10B [source=Stanford]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_DBVPG6044 from Stanford:

YDR382W_DBVPG6044 [source=Stanford]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_EC1118 from Genoscope:

YDR382W_EC1118 [source=Genoscope]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_EC9-8 from ASinica:

YDR382W_EC9-8 [source=ASinica]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_FL100 from Stanford:

YDR382W_FL100 [source=Stanford]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_FY1679 from Stanford:

YDR382W_FY1679 [source=Stanford]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_FostersB from AWRI:

YDR382W_FostersB [source=AWRI]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_FostersO from AWRI:

YDR382W_FostersO [source=AWRI]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_JAY291 from Duke:

YDR382W_JAY291 [source=Duke]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_JK9-3d from Stanford:

YDR382W_JK9-3d [source=Stanford]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_K11 from Stanford:

YDR382W_K11 [source=Stanford]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_Kyokai7 from NRIB:

YDR382W_Kyokai7 [source=NRIB]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_L1528 from Stanford:

YDR382W_L1528 [source=Stanford]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_LalvinQA23 from AWRI:

YDR382W_LalvinQA23 [source=AWRI]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 6199  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEXKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_PW5 from WashU:

YDR382W_PW5 [source=WashU]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_RM11-1a from Stanford:

YDR382W_RM11-1a [source=Stanford]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_RedStar from Stanford:

YDR382W_RedStar [source=Stanford]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_SEY6210 from Stanford:

YDR382W_SEY6210 [source=Stanford]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_SK1 from Stanford:

YDR382W_SK1 [source=Stanford]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_T7 from WashU:

YDR382W_T7 [source=WashU]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_UC5 from WashU:

YDR382W_UC5 [source=WashU]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_UWOPS05_217_3 from Stanford:

YDR382W_UWOPS05_217_3 [source=Stanford]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_VL3 from AWRI:

YDR382W_VL3 [source=AWRI]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_Vin13 from AWRI:

YDR382W_Vin13 [source=AWRI]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5503  ..

       1  MKYLAAYLLX VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_W303 from Stanford:

YDR382W_W303 [source=Stanford]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_X2180-1A from Stanford:

YDR382W_X2180-1A [source=Stanford]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_Y10 from WashU:

YDR382W_Y10 [source=WashU]  Length: 110  Wed Oct 18 11:52:54 2017  Type: P  Check: 8807  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SWKKSSLKVK RSSLLFQLVV LLLLLPVLPV LLPVVMLLKK KRKKKLRKNL

     101  MMTWVLVYSI

Protein Sequence for YDR382W_Y55 from Stanford:

YDR382W_Y55 [source=Stanford]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_YJM269 from WashU:

YDR382W_YJM269 [source=WashU]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_YJM339 from Stanford:

YDR382W_YJM339 [source=Stanford]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_YJM789 from Stanford:

YDR382W_YJM789 [source=Stanford]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_YPH499 from Stanford:

YDR382W_YPH499 [source=Stanford]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_YPS128 from Stanford:

YDR382W_YPS128 [source=Stanford]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_YPS163 from Stanford:

YDR382W_YPS163 [source=Stanford]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_YS9 from Stanford:

YDR382W_YS9 [source=Stanford]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *

Protein Sequence for YDR382W_ZTW1 from Zhejiang:

YDR382W_ZTW1 [source=Zhejiang]  Length: 111  Wed Oct 18 11:52:54 2017  Type: P  Check: 5383  ..

       1  MKYLAAYLLL VQGGNAAPSA ADIKAVVESV GAEVDEARIN ELLSSLEGKG

      51  SLEEIIAEGQ KKFATVPTGG ASSAAAGAAG AAAGGDAAEE EKEEEAKEES

     101  DDDMGFGLFD *