FRQ1/YDR373W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YDR373W_S288C   1   MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVK   50
YDR373W_AWRI1631   1   MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVK   50
YDR373W_AWRI796   1   MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVK   50
YDR373W_BY4741   1   MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVK   50
YDR373W_BY4742   1   MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVK   50
YDR373W_CEN.PK   1   MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVK   50
YDR373W_CLIB324   1   MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVK   50
YDR373W_D273-10B   1   MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVK   50
YDR373W_DBVPG6044   1   MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVK   50
YDR373W_EC1118   1   MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVK   50
YDR373W_EC9-8   1   MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVK   50
YDR373W_FL100   1   MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVK   50
YDR373W_FY1679   1   MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVK   50
YDR373W_FostersB   1   MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVK   50
YDR373W_FostersO   1   MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVK   50
YDR373W_JAY291   1   MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVK   50
YDR373W_JK9-3d   1   MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVK   50
YDR373W_K11   1   MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVK   50
YDR373W_Kyokai7   1   MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVK   50
YDR373W_L1528   1   MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVK   50
YDR373W_LalvinQA23   1   MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVK   50
YDR373W_PW5   1   MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVK   50
YDR373W_RM11-1a   1   MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVK   50
YDR373W_RedStar   1   MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVK   50
YDR373W_SEY6210   1   MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVK   50
YDR373W_SK1   1   MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVK   50
YDR373W_T7   1   MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVK   50
YDR373W_VL3   1   MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVK   50
YDR373W_Vin13   1   MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVK   50
YDR373W_W303   1   MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVK   50
YDR373W_X2180-1A   1   MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVK   50
YDR373W_Y10   1   MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVK   50
YDR373W_Y55   1   MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVK   50
YDR373W_YJM339   1   MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVK   50
YDR373W_YJM789   1   MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVK   50
YDR373W_YPH499   1   MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVK   50
YDR373W_YPS128   1   MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVK   50
YDR373W_YPS163   1   MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVK   50
YDR373W_ZTW1   1   MGAKTSKLSKDDLTCLKQSTYFDRREIQQWHKGFLRDCPSGQLAREDFVK   50
         

YDR373W_S288C   51   IYKQFFPFGSPEDFANHLFTVFDKDNNGFIHFEEFITVLSTTSRGTLEEK   100
YDR373W_AWRI1631   51   IYKQFFPFGSPEDFANHLFTVFDKDNNGFIHFEEFITVLSTTSRGTLEEK   100
YDR373W_AWRI796   51   IYKQFFPFGSPEDFANHLFTVFDKDNNGFIHFEEFITVLSTTSRGTLEEK   100
YDR373W_BY4741   51   IYKQFFPFGSPEDFANHLFTVFDKDNNGFIHFEEFITVLSTTSRGTLEEK   100
YDR373W_BY4742   51   IYKQFFPFGSPEDFANHLFTVFDKDNNGFIHFEEFITVLSTTSRGTLEEK   100
YDR373W_CEN.PK   51   IYKQFFPFGSPEDFANHLFTVFDKDNNGFIHFEEFITVLSTTSRGTLEEK   100
YDR373W_CLIB324   51   IYKQFFPFGSPEDFANHLFTVFDKDNNGFIHFEEFITVLSTTSRGTLEEK   100
YDR373W_D273-10B   51   IYKQFFPFGSPEDFANHLFTVFDKDNNGFIHFEEFITVLSTTSRGTLEEK   100
YDR373W_DBVPG6044   51   IYKQFFPFGSPEDFANHLFTVFDKDNNGFIHFEEFITVLSTTSRGTLEEK   100
YDR373W_EC1118   51   IYKQFFPFGSPEDFANHLFTVFDKDNNGFIHFEEFITVLSTTSRGTLEEK   100
YDR373W_EC9-8   51   IYKQFFPFGSPEDFANHLFTVFDKDNNGFIHFEEFITVLSTTSRGTLEEK   100
YDR373W_FL100   51   IYKQFFPFGSPEDFANHLFTVFDKDNNGFIHFEEFITVLSTTSRGTLEEK   100
YDR373W_FY1679   51   IYKQFFPFGSPEDFANHLFTVFDKDNNGFIHFEEFITVLSTTSRGTLEEK   100
YDR373W_FostersB   51   IYKQFFPFGSPEDFANHLFTVFDKDNNGFIHFEEFITVLSTTSRGTLEEK   100
YDR373W_FostersO   51   IYKQFFPFGSPEDFANHLXTVFDKDNNGFIHFEEFITVLSTTSRGTLEEK   100
YDR373W_JAY291   51   IYKQFFPFGSPEDFANHLFTVFDKDNNGFIHFEEFITVLSTTSRGTLEEK   100
YDR373W_JK9-3d   51   IYKQFFPFGSPEDFANHLFTVFDKDNNGFIHFEEFITVLSTTSRGTLEEK   100
YDR373W_K11   51   IYKQFFPFGSPEDFANHLFTVFDKDNNGFIHFEEFITVLSTTSRGTLEEK   100
YDR373W_Kyokai7   51   IYKQFFPFGSPEDFANHLFTVFDKDNNGFIHFEEFITVLSTTSRGTLEEK   100
YDR373W_L1528   51   IYKQFFPFGSPEDFANHLFTVFDKDNNGFIHFEEFITVLSTTSRGTLEEK   100
YDR373W_LalvinQA23   51   IYKQFFPFGSPEDFANHLXTVFDKDNNGFIHFEEFITVLSTTSRGTLEEK   100
YDR373W_PW5   51   IYKQFFPFGSPEDFANHLFTVFDKDNNGFIHFEEFITVLSTTSRGTLEEK   100
YDR373W_RM11-1a   51   IYKQFFPFGSPEDFANHLFTVFDKDNNGFIHFEEFITVLSTTSRGTLEEK   100
YDR373W_RedStar   51   IYKQFFPFGSPEDFANHLFTVFDKDNNGFIHFEEFITVLSTTSRGTLEEK   100
YDR373W_SEY6210   51   IYKQFFPFGSPEDFANHLFTVFDKDNNGFIHFEEFITVLSTTSRGTLEEK   100
YDR373W_SK1   51   IYKQFFPFGSPEDFANHLFTVFDKDNNGFIHFEEFITVLSTTSRGTLEEK   100
YDR373W_T7   51   IYKQFFPFGSPEDFANHLFTVFDKDNNGFIHFEEFITVLSTTSRGTLEEK   100
YDR373W_VL3   51   IYKQFFPFGSPEDFANHLFTVFDKDNNGFIHFEEFITVLSTTSRGTLEEK   100
YDR373W_Vin13   51   IYKQFFPFGSPEDFANHLXTVFDKDNNGFIHFEEFITVLSTTSRGTLEEK   100
YDR373W_W303   51   IYKQFFPFGSPEDFANHLFTVFDKDNNGFIHFEEFITVLSTTSRGTLEEK   100
YDR373W_X2180-1A   51   IYKQFFPFGSPEDFANHLFTVFDKDNNGFIHFEEFITVLSTTSRGTLEEK   100
YDR373W_Y10   51   IYKQFFPFGSPEDFANHLFTVFDKDNNGFIHFEEFITVLSTTSRGTLEEK   100
YDR373W_Y55   51   IYKQFFPFGSPEDFANHLFTVFDKDNNGFIHFEEFITVLSTTSRGTLEEK   100
YDR373W_YJM339   51   IYKQFFPFGSPEDFANHLFTVFDKDNNGFIHFEEFITVLSTTSRGTLEEK   100
YDR373W_YJM789   51   IYKQFFPFGSPEDFANHLFTVFDKDNNGFIHFEEFITVLSTTSRGTLEEK   100
YDR373W_YPH499   51   IYKQFFPFGSPEDFANHLFTVFDKDNNGFIHFEEFITVLSTTSRGTLEEK   100
YDR373W_YPS128   51   IYKQFFPFGSPEDFANHLFTVFDKDNNGFIHFEEFITVLSTTSRGTLEEK   100
YDR373W_YPS163   51   IYKQFFPFGSPEDFANHLFTVFDKDNNGFIHFEEFITVLSTTSRGTLEEK   100
YDR373W_ZTW1   51   IYKQFFPFGSPEDFANHLFTVFDKDNNGFIHFEEFITVLSTTSRGTLEEK   100
         

YDR373W_S288C   101   LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVK   150
YDR373W_AWRI1631   101   LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVK   150
YDR373W_AWRI796   101   LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVK   150
YDR373W_BY4741   101   LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVK   150
YDR373W_BY4742   101   LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVK   150
YDR373W_CEN.PK   101   LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVK   150
YDR373W_CLIB324   101   LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVK   150
YDR373W_D273-10B   101   LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVK   150
YDR373W_DBVPG6044   101   LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVK   150
YDR373W_EC1118   101   LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVK   150
YDR373W_EC9-8   101   LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVK   150
YDR373W_FL100   101   LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVK   150
YDR373W_FY1679   101   LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVK   150
YDR373W_FostersB   101   LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVK   150
YDR373W_FostersO   101   LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVK   150
YDR373W_JAY291   101   LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVK   150
YDR373W_JK9-3d   101   LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVK   150
YDR373W_K11   101   LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVK   150
YDR373W_Kyokai7   101   LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVK   150
YDR373W_L1528   101   LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVK   150
YDR373W_LalvinQA23   101   LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVK   150
YDR373W_PW5   101   LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVK   150
YDR373W_RM11-1a   101   LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVK   150
YDR373W_RedStar   101   LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVK   150
YDR373W_SEY6210   101   LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVK   150
YDR373W_SK1   101   LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVK   150
YDR373W_T7   101   LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVK   150
YDR373W_VL3   101   LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVK   150
YDR373W_Vin13   101   LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVK   150
YDR373W_W303   101   LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVK   150
YDR373W_X2180-1A   101   LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVK   150
YDR373W_Y10   101   LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVK   150
YDR373W_Y55   101   LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVK   150
YDR373W_YJM339   101   LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVK   150
YDR373W_YJM789   101   LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVK   150
YDR373W_YPH499   101   LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVK   150
YDR373W_YPS128   101   LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVK   150
YDR373W_YPS163   101   LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVK   150
YDR373W_ZTW1   101   LSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMVTLNEDEATPEMRVK   150
         

YDR373W_S288C   151   KIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDGLI   190
YDR373W_AWRI1631   151   KIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDGLI   190
YDR373W_AWRI796   151   KIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDGLI   190
YDR373W_BY4741   151   KIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDGLI   190
YDR373W_BY4742   151   KIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDGLI   190
YDR373W_CEN.PK   151   KIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDGLI   190
YDR373W_CLIB324   151   KIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDGLI   190
YDR373W_D273-10B   151   KIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDGLI   190
YDR373W_DBVPG6044   151   KIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDGLI   190
YDR373W_EC1118   151   KIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDGLI   190
YDR373W_EC9-8   151   KIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDGLI   190
YDR373W_FL100   151   KIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDGLI   190
YDR373W_FY1679   151   KIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDGLI   190
YDR373W_FostersB   151   KIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDGLI   190
YDR373W_FostersO   151   KIXKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDGLI   190
YDR373W_JAY291   151   KIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDGLI   190
YDR373W_JK9-3d   151   KIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDGLI   190
YDR373W_K11   151   KIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDGLI   190
YDR373W_Kyokai7   151   KIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDGLI   190
YDR373W_L1528   151   KIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDGLI   190
YDR373W_LalvinQA23   151   KIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDGLI   190
YDR373W_PW5   151   KIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDGLI   190
YDR373W_RM11-1a   151   KIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDGLI   190
YDR373W_RedStar   151   KIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDGLI   190
YDR373W_SEY6210   151   KIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDGLI   190
YDR373W_SK1   151   KIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDGLI   190
YDR373W_T7   151   KIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDGLI   190
YDR373W_VL3   151   KIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDGLI   190
YDR373W_Vin13   151   KIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDGLI   190
YDR373W_W303   151   KIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDGLI   190
YDR373W_X2180-1A   151   KIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDGLI   190
YDR373W_Y10   151   KIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDGLI   190
YDR373W_Y55   151   KIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDGLI   190
YDR373W_YJM339   151   KIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDGLI   190
YDR373W_YJM789   151   KIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDGLI   190
YDR373W_YPH499   151   KIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDGLI   190
YDR373W_YPS128   151   KIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDGLI   190
YDR373W_YPS163   151   KIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDGLI   190
YDR373W_ZTW1   151   KIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNLYDGLI   190
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YDR373W_S288C from SGD:

YDR373W_S288C [source=SGD]  Length: 191  Fri Nov 24 19:57:27 2017  Type: P  Check: 9487  ..

       1  MGAKTSKLSK DDLTCLKQST YFDRREIQQW HKGFLRDCPS GQLAREDFVK

      51  IYKQFFPFGS PEDFANHLFT VFDKDNNGFI HFEEFITVLS TTSRGTLEEK

     101  LSWAFELYDL NHDGYITFDE MLTIVASVYK MMGSMVTLNE DEATPEMRVK

     151  KIFKLMDKNE DGYITLDEFR EGSKVDPSII GALNLYDGLI *


Protein Sequence for YDR373W_AWRI1631 from AWRI:

YDR373W_AWRI1631 [source=AWRI]  Length: 191  Fri Nov 24 19:57:27 2017  Type: P  Check: 9487  ..

       1  MGAKTSKLSK DDLTCLKQST YFDRREIQQW HKGFLRDCPS GQLAREDFVK

      51  IYKQFFPFGS PEDFANHLFT VFDKDNNGFI HFEEFITVLS TTSRGTLEEK

     101  LSWAFELYDL NHDGYITFDE MLTIVASVYK MMGSMVTLNE DEATPEMRVK

     151  KIFKLMDKNE DGYITLDEFR EGSKVDPSII GALNLYDGLI *


Protein Sequence for YDR373W_AWRI796 from AWRI:

YDR373W_AWRI796 [source=AWRI]  Length: 191  Fri Nov 24 19:57:27 2017  Type: P  Check: 9487  ..

       1  MGAKTSKLSK DDLTCLKQST YFDRREIQQW HKGFLRDCPS GQLAREDFVK

      51  IYKQFFPFGS PEDFANHLFT VFDKDNNGFI HFEEFITVLS TTSRGTLEEK

     101  LSWAFELYDL NHDGYITFDE MLTIVASVYK MMGSMVTLNE DEATPEMRVK

     151  KIFKLMDKNE DGYITLDEFR EGSKVDPSII GALNLYDGLI *


Protein Sequence for YDR373W_BY4741 from Stanford:

YDR373W_BY4741 [source=Stanford]  Length: 191  Fri Nov 24 19:57:27 2017  Type: P  Check: 9487  ..

       1  MGAKTSKLSK DDLTCLKQST YFDRREIQQW HKGFLRDCPS GQLAREDFVK

      51  IYKQFFPFGS PEDFANHLFT VFDKDNNGFI HFEEFITVLS TTSRGTLEEK

     101  LSWAFELYDL NHDGYITFDE MLTIVASVYK MMGSMVTLNE DEATPEMRVK

     151  KIFKLMDKNE DGYITLDEFR EGSKVDPSII GALNLYDGLI *


Protein Sequence for YDR373W_BY4742 from Stanford:

YDR373W_BY4742 [source=Stanford]  Length: 191  Fri Nov 24 19:57:27 2017  Type: P  Check: 9487  ..

       1  MGAKTSKLSK DDLTCLKQST YFDRREIQQW HKGFLRDCPS GQLAREDFVK

      51  IYKQFFPFGS PEDFANHLFT VFDKDNNGFI HFEEFITVLS TTSRGTLEEK

     101  LSWAFELYDL NHDGYITFDE MLTIVASVYK MMGSMVTLNE DEATPEMRVK

     151  KIFKLMDKNE DGYITLDEFR EGSKVDPSII GALNLYDGLI *


Protein Sequence for YDR373W_CEN.PK from Stanford:

YDR373W_CEN.PK [source=Stanford]  Length: 191  Fri Nov 24 19:57:27 2017  Type: P  Check: 9487  ..

       1  MGAKTSKLSK DDLTCLKQST YFDRREIQQW HKGFLRDCPS GQLAREDFVK

      51  IYKQFFPFGS PEDFANHLFT VFDKDNNGFI HFEEFITVLS TTSRGTLEEK

     101  LSWAFELYDL NHDGYITFDE MLTIVASVYK MMGSMVTLNE DEATPEMRVK

     151  KIFKLMDKNE DGYITLDEFR EGSKVDPSII GALNLYDGLI *


Protein Sequence for YDR373W_CLIB324 from WashU:

YDR373W_CLIB324 [source=WashU]  Length: 191  Fri Nov 24 19:57:27 2017  Type: P  Check: 9487  ..

       1  MGAKTSKLSK DDLTCLKQST YFDRREIQQW HKGFLRDCPS GQLAREDFVK

      51  IYKQFFPFGS PEDFANHLFT VFDKDNNGFI HFEEFITVLS TTSRGTLEEK

     101  LSWAFELYDL NHDGYITFDE MLTIVASVYK MMGSMVTLNE DEATPEMRVK

     151  KIFKLMDKNE DGYITLDEFR EGSKVDPSII GALNLYDGLI *


Protein Sequence for YDR373W_D273-10B from Stanford:

YDR373W_D273-10B [source=Stanford]  Length: 191  Fri Nov 24 19:57:27 2017  Type: P  Check: 9487  ..

       1  MGAKTSKLSK DDLTCLKQST YFDRREIQQW HKGFLRDCPS GQLAREDFVK

      51  IYKQFFPFGS PEDFANHLFT VFDKDNNGFI HFEEFITVLS TTSRGTLEEK

     101  LSWAFELYDL NHDGYITFDE MLTIVASVYK MMGSMVTLNE DEATPEMRVK

     151  KIFKLMDKNE DGYITLDEFR EGSKVDPSII GALNLYDGLI *


Protein Sequence for YDR373W_DBVPG6044 from Stanford:

YDR373W_DBVPG6044 [source=Stanford]  Length: 191  Fri Nov 24 19:57:27 2017  Type: P  Check: 9487  ..

       1  MGAKTSKLSK DDLTCLKQST YFDRREIQQW HKGFLRDCPS GQLAREDFVK

      51  IYKQFFPFGS PEDFANHLFT VFDKDNNGFI HFEEFITVLS TTSRGTLEEK

     101  LSWAFELYDL NHDGYITFDE MLTIVASVYK MMGSMVTLNE DEATPEMRVK

     151  KIFKLMDKNE DGYITLDEFR EGSKVDPSII GALNLYDGLI *


Protein Sequence for YDR373W_EC1118 from Genoscope:

YDR373W_EC1118 [source=Genoscope]  Length: 191  Fri Nov 24 19:57:27 2017  Type: P  Check: 9487  ..

       1  MGAKTSKLSK DDLTCLKQST YFDRREIQQW HKGFLRDCPS GQLAREDFVK

      51  IYKQFFPFGS PEDFANHLFT VFDKDNNGFI HFEEFITVLS TTSRGTLEEK

     101  LSWAFELYDL NHDGYITFDE MLTIVASVYK MMGSMVTLNE DEATPEMRVK

     151  KIFKLMDKNE DGYITLDEFR EGSKVDPSII GALNLYDGLI *


Protein Sequence for YDR373W_EC9-8 from ASinica:

YDR373W_EC9-8 [source=ASinica]  Length: 191  Fri Nov 24 19:57:27 2017  Type: P  Check: 9487  ..

       1  MGAKTSKLSK DDLTCLKQST YFDRREIQQW HKGFLRDCPS GQLAREDFVK

      51  IYKQFFPFGS PEDFANHLFT VFDKDNNGFI HFEEFITVLS TTSRGTLEEK

     101  LSWAFELYDL NHDGYITFDE MLTIVASVYK MMGSMVTLNE DEATPEMRVK

     151  KIFKLMDKNE DGYITLDEFR EGSKVDPSII GALNLYDGLI *


Protein Sequence for YDR373W_FL100 from Stanford:

YDR373W_FL100 [source=Stanford]  Length: 191  Fri Nov 24 19:57:27 2017  Type: P  Check: 9487  ..

       1  MGAKTSKLSK DDLTCLKQST YFDRREIQQW HKGFLRDCPS GQLAREDFVK

      51  IYKQFFPFGS PEDFANHLFT VFDKDNNGFI HFEEFITVLS TTSRGTLEEK

     101  LSWAFELYDL NHDGYITFDE MLTIVASVYK MMGSMVTLNE DEATPEMRVK

     151  KIFKLMDKNE DGYITLDEFR EGSKVDPSII GALNLYDGLI *


Protein Sequence for YDR373W_FY1679 from Stanford:

YDR373W_FY1679 [source=Stanford]  Length: 191  Fri Nov 24 19:57:27 2017  Type: P  Check: 9487  ..

       1  MGAKTSKLSK DDLTCLKQST YFDRREIQQW HKGFLRDCPS GQLAREDFVK

      51  IYKQFFPFGS PEDFANHLFT VFDKDNNGFI HFEEFITVLS TTSRGTLEEK

     101  LSWAFELYDL NHDGYITFDE MLTIVASVYK MMGSMVTLNE DEATPEMRVK

     151  KIFKLMDKNE DGYITLDEFR EGSKVDPSII GALNLYDGLI *


Protein Sequence for YDR373W_FostersB from AWRI:

YDR373W_FostersB [source=AWRI]  Length: 191  Fri Nov 24 19:57:27 2017  Type: P  Check: 9487  ..

       1  MGAKTSKLSK DDLTCLKQST YFDRREIQQW HKGFLRDCPS GQLAREDFVK

      51  IYKQFFPFGS PEDFANHLFT VFDKDNNGFI HFEEFITVLS TTSRGTLEEK

     101  LSWAFELYDL NHDGYITFDE MLTIVASVYK MMGSMVTLNE DEATPEMRVK

     151  KIFKLMDKNE DGYITLDEFR EGSKVDPSII GALNLYDGLI *


Protein Sequence for YDR373W_FostersO from AWRI:

YDR373W_FostersO [source=AWRI]  Length: 191  Fri Nov 24 19:57:27 2017  Type: P  Check: 405  ..

       1  MGAKTSKLSK DDLTCLKQST YFDRREIQQW HKGFLRDCPS GQLAREDFVK

      51  IYKQFFPFGS PEDFANHLXT VFDKDNNGFI HFEEFITVLS TTSRGTLEEK

     101  LSWAFELYDL NHDGYITFDE MLTIVASVYK MMGSMVTLNE DEATPEMRVK

     151  KIXKLMDKNE DGYITLDEFR EGSKVDPSII GALNLYDGLI *


Protein Sequence for YDR373W_JAY291 from Duke:

YDR373W_JAY291 [source=Duke]  Length: 191  Fri Nov 24 19:57:27 2017  Type: P  Check: 9487  ..

       1  MGAKTSKLSK DDLTCLKQST YFDRREIQQW HKGFLRDCPS GQLAREDFVK

      51  IYKQFFPFGS PEDFANHLFT VFDKDNNGFI HFEEFITVLS TTSRGTLEEK

     101  LSWAFELYDL NHDGYITFDE MLTIVASVYK MMGSMVTLNE DEATPEMRVK

     151  KIFKLMDKNE DGYITLDEFR EGSKVDPSII GALNLYDGLI *


Protein Sequence for YDR373W_JK9-3d from Stanford:

YDR373W_JK9-3d [source=Stanford]  Length: 191  Fri Nov 24 19:57:27 2017  Type: P  Check: 9487  ..

       1  MGAKTSKLSK DDLTCLKQST YFDRREIQQW HKGFLRDCPS GQLAREDFVK

      51  IYKQFFPFGS PEDFANHLFT VFDKDNNGFI HFEEFITVLS TTSRGTLEEK

     101  LSWAFELYDL NHDGYITFDE MLTIVASVYK MMGSMVTLNE DEATPEMRVK

     151  KIFKLMDKNE DGYITLDEFR EGSKVDPSII GALNLYDGLI *


Protein Sequence for YDR373W_K11 from Stanford:

YDR373W_K11 [source=Stanford]  Length: 191  Fri Nov 24 19:57:27 2017  Type: P  Check: 9487  ..

       1  MGAKTSKLSK DDLTCLKQST YFDRREIQQW HKGFLRDCPS GQLAREDFVK

      51  IYKQFFPFGS PEDFANHLFT VFDKDNNGFI HFEEFITVLS TTSRGTLEEK

     101  LSWAFELYDL NHDGYITFDE MLTIVASVYK MMGSMVTLNE DEATPEMRVK

     151  KIFKLMDKNE DGYITLDEFR EGSKVDPSII GALNLYDGLI *


Protein Sequence for YDR373W_Kyokai7 from NRIB:

YDR373W_Kyokai7 [source=NRIB]  Length: 191  Fri Nov 24 19:57:27 2017  Type: P  Check: 9487  ..

       1  MGAKTSKLSK DDLTCLKQST YFDRREIQQW HKGFLRDCPS GQLAREDFVK

      51  IYKQFFPFGS PEDFANHLFT VFDKDNNGFI HFEEFITVLS TTSRGTLEEK

     101  LSWAFELYDL NHDGYITFDE MLTIVASVYK MMGSMVTLNE DEATPEMRVK

     151  KIFKLMDKNE DGYITLDEFR EGSKVDPSII GALNLYDGLI *


Protein Sequence for YDR373W_L1528 from Stanford:

YDR373W_L1528 [source=Stanford]  Length: 191  Fri Nov 24 19:57:27 2017  Type: P  Check: 9487  ..

       1  MGAKTSKLSK DDLTCLKQST YFDRREIQQW HKGFLRDCPS GQLAREDFVK

      51  IYKQFFPFGS PEDFANHLFT VFDKDNNGFI HFEEFITVLS TTSRGTLEEK

     101  LSWAFELYDL NHDGYITFDE MLTIVASVYK MMGSMVTLNE DEATPEMRVK

     151  KIFKLMDKNE DGYITLDEFR EGSKVDPSII GALNLYDGLI *


Protein Sequence for YDR373W_LalvinQA23 from AWRI:

YDR373W_LalvinQA23 [source=AWRI]  Length: 191  Fri Nov 24 19:57:27 2017  Type: P  Check: 9703  ..

       1  MGAKTSKLSK DDLTCLKQST YFDRREIQQW HKGFLRDCPS GQLAREDFVK

      51  IYKQFFPFGS PEDFANHLXT VFDKDNNGFI HFEEFITVLS TTSRGTLEEK

     101  LSWAFELYDL NHDGYITFDE MLTIVASVYK MMGSMVTLNE DEATPEMRVK

     151  KIFKLMDKNE DGYITLDEFR EGSKVDPSII GALNLYDGLI *


Protein Sequence for YDR373W_PW5 from WashU:

YDR373W_PW5 [source=WashU]  Length: 191  Fri Nov 24 19:57:27 2017  Type: P  Check: 9487  ..

       1  MGAKTSKLSK DDLTCLKQST YFDRREIQQW HKGFLRDCPS GQLAREDFVK

      51  IYKQFFPFGS PEDFANHLFT VFDKDNNGFI HFEEFITVLS TTSRGTLEEK

     101  LSWAFELYDL NHDGYITFDE MLTIVASVYK MMGSMVTLNE DEATPEMRVK

     151  KIFKLMDKNE DGYITLDEFR EGSKVDPSII GALNLYDGLI *


Protein Sequence for YDR373W_RM11-1a from Stanford:

YDR373W_RM11-1a [source=Stanford]  Length: 191  Fri Nov 24 19:57:27 2017  Type: P  Check: 9487  ..

       1  MGAKTSKLSK DDLTCLKQST YFDRREIQQW HKGFLRDCPS GQLAREDFVK

      51  IYKQFFPFGS PEDFANHLFT VFDKDNNGFI HFEEFITVLS TTSRGTLEEK

     101  LSWAFELYDL NHDGYITFDE MLTIVASVYK MMGSMVTLNE DEATPEMRVK

     151  KIFKLMDKNE DGYITLDEFR EGSKVDPSII GALNLYDGLI *


Protein Sequence for YDR373W_RedStar from Stanford:

YDR373W_RedStar [source=Stanford]  Length: 191  Fri Nov 24 19:57:27 2017  Type: P  Check: 9487  ..

       1  MGAKTSKLSK DDLTCLKQST YFDRREIQQW HKGFLRDCPS GQLAREDFVK

      51  IYKQFFPFGS PEDFANHLFT VFDKDNNGFI HFEEFITVLS TTSRGTLEEK

     101  LSWAFELYDL NHDGYITFDE MLTIVASVYK MMGSMVTLNE DEATPEMRVK

     151  KIFKLMDKNE DGYITLDEFR EGSKVDPSII GALNLYDGLI *


Protein Sequence for YDR373W_SEY6210 from Stanford:

YDR373W_SEY6210 [source=Stanford]  Length: 191  Fri Nov 24 19:57:27 2017  Type: P  Check: 9487  ..

       1  MGAKTSKLSK DDLTCLKQST YFDRREIQQW HKGFLRDCPS GQLAREDFVK

      51  IYKQFFPFGS PEDFANHLFT VFDKDNNGFI HFEEFITVLS TTSRGTLEEK

     101  LSWAFELYDL NHDGYITFDE MLTIVASVYK MMGSMVTLNE DEATPEMRVK

     151  KIFKLMDKNE DGYITLDEFR EGSKVDPSII GALNLYDGLI *


Protein Sequence for YDR373W_SK1 from Stanford:

YDR373W_SK1 [source=Stanford]  Length: 191  Fri Nov 24 19:57:27 2017  Type: P  Check: 9487  ..

       1  MGAKTSKLSK DDLTCLKQST YFDRREIQQW HKGFLRDCPS GQLAREDFVK

      51  IYKQFFPFGS PEDFANHLFT VFDKDNNGFI HFEEFITVLS TTSRGTLEEK

     101  LSWAFELYDL NHDGYITFDE MLTIVASVYK MMGSMVTLNE DEATPEMRVK

     151  KIFKLMDKNE DGYITLDEFR EGSKVDPSII GALNLYDGLI *


Protein Sequence for YDR373W_T7 from WashU:

YDR373W_T7 [source=WashU]  Length: 191  Fri Nov 24 19:57:27 2017  Type: P  Check: 9487  ..

       1  MGAKTSKLSK DDLTCLKQST YFDRREIQQW HKGFLRDCPS GQLAREDFVK

      51  IYKQFFPFGS PEDFANHLFT VFDKDNNGFI HFEEFITVLS TTSRGTLEEK

     101  LSWAFELYDL NHDGYITFDE MLTIVASVYK MMGSMVTLNE DEATPEMRVK

     151  KIFKLMDKNE DGYITLDEFR EGSKVDPSII GALNLYDGLI *


Protein Sequence for YDR373W_VL3 from AWRI:

YDR373W_VL3 [source=AWRI]  Length: 191  Fri Nov 24 19:57:27 2017  Type: P  Check: 9487  ..

       1  MGAKTSKLSK DDLTCLKQST YFDRREIQQW HKGFLRDCPS GQLAREDFVK

      51  IYKQFFPFGS PEDFANHLFT VFDKDNNGFI HFEEFITVLS TTSRGTLEEK

     101  LSWAFELYDL NHDGYITFDE MLTIVASVYK MMGSMVTLNE DEATPEMRVK

     151  KIFKLMDKNE DGYITLDEFR EGSKVDPSII GALNLYDGLI *


Protein Sequence for YDR373W_Vin13 from AWRI:

YDR373W_Vin13 [source=AWRI]  Length: 191  Fri Nov 24 19:57:27 2017  Type: P  Check: 9703  ..

       1  MGAKTSKLSK DDLTCLKQST YFDRREIQQW HKGFLRDCPS GQLAREDFVK

      51  IYKQFFPFGS PEDFANHLXT VFDKDNNGFI HFEEFITVLS TTSRGTLEEK

     101  LSWAFELYDL NHDGYITFDE MLTIVASVYK MMGSMVTLNE DEATPEMRVK

     151  KIFKLMDKNE DGYITLDEFR EGSKVDPSII GALNLYDGLI *


Protein Sequence for YDR373W_W303 from Stanford:

YDR373W_W303 [source=Stanford]  Length: 191  Fri Nov 24 19:57:27 2017  Type: P  Check: 9487  ..

       1  MGAKTSKLSK DDLTCLKQST YFDRREIQQW HKGFLRDCPS GQLAREDFVK

      51  IYKQFFPFGS PEDFANHLFT VFDKDNNGFI HFEEFITVLS TTSRGTLEEK

     101  LSWAFELYDL NHDGYITFDE MLTIVASVYK MMGSMVTLNE DEATPEMRVK

     151  KIFKLMDKNE DGYITLDEFR EGSKVDPSII GALNLYDGLI *


Protein Sequence for YDR373W_X2180-1A from Stanford:

YDR373W_X2180-1A [source=Stanford]  Length: 191  Fri Nov 24 19:57:27 2017  Type: P  Check: 9487  ..

       1  MGAKTSKLSK DDLTCLKQST YFDRREIQQW HKGFLRDCPS GQLAREDFVK

      51  IYKQFFPFGS PEDFANHLFT VFDKDNNGFI HFEEFITVLS TTSRGTLEEK

     101  LSWAFELYDL NHDGYITFDE MLTIVASVYK MMGSMVTLNE DEATPEMRVK

     151  KIFKLMDKNE DGYITLDEFR EGSKVDPSII GALNLYDGLI *


Protein Sequence for YDR373W_Y10 from WashU:

YDR373W_Y10 [source=WashU]  Length: 191  Fri Nov 24 19:57:27 2017  Type: P  Check: 9487  ..

       1  MGAKTSKLSK DDLTCLKQST YFDRREIQQW HKGFLRDCPS GQLAREDFVK

      51  IYKQFFPFGS PEDFANHLFT VFDKDNNGFI HFEEFITVLS TTSRGTLEEK

     101  LSWAFELYDL NHDGYITFDE MLTIVASVYK MMGSMVTLNE DEATPEMRVK

     151  KIFKLMDKNE DGYITLDEFR EGSKVDPSII GALNLYDGLI *


Protein Sequence for YDR373W_Y55 from Stanford:

YDR373W_Y55 [source=Stanford]  Length: 191  Fri Nov 24 19:57:27 2017  Type: P  Check: 9487  ..

       1  MGAKTSKLSK DDLTCLKQST YFDRREIQQW HKGFLRDCPS GQLAREDFVK

      51  IYKQFFPFGS PEDFANHLFT VFDKDNNGFI HFEEFITVLS TTSRGTLEEK

     101  LSWAFELYDL NHDGYITFDE MLTIVASVYK MMGSMVTLNE DEATPEMRVK

     151  KIFKLMDKNE DGYITLDEFR EGSKVDPSII GALNLYDGLI *


Protein Sequence for YDR373W_YJM339 from Stanford:

YDR373W_YJM339 [source=Stanford]  Length: 191  Fri Nov 24 19:57:27 2017  Type: P  Check: 9487  ..

       1  MGAKTSKLSK DDLTCLKQST YFDRREIQQW HKGFLRDCPS GQLAREDFVK

      51  IYKQFFPFGS PEDFANHLFT VFDKDNNGFI HFEEFITVLS TTSRGTLEEK

     101  LSWAFELYDL NHDGYITFDE MLTIVASVYK MMGSMVTLNE DEATPEMRVK

     151  KIFKLMDKNE DGYITLDEFR EGSKVDPSII GALNLYDGLI *


Protein Sequence for YDR373W_YJM789 from Stanford:

YDR373W_YJM789 [source=Stanford]  Length: 191  Fri Nov 24 19:57:27 2017  Type: P  Check: 9487  ..

       1  MGAKTSKLSK DDLTCLKQST YFDRREIQQW HKGFLRDCPS GQLAREDFVK

      51  IYKQFFPFGS PEDFANHLFT VFDKDNNGFI HFEEFITVLS TTSRGTLEEK

     101  LSWAFELYDL NHDGYITFDE MLTIVASVYK MMGSMVTLNE DEATPEMRVK

     151  KIFKLMDKNE DGYITLDEFR EGSKVDPSII GALNLYDGLI *


Protein Sequence for YDR373W_YPH499 from Stanford:

YDR373W_YPH499 [source=Stanford]  Length: 191  Fri Nov 24 19:57:27 2017  Type: P  Check: 9487  ..

       1  MGAKTSKLSK DDLTCLKQST YFDRREIQQW HKGFLRDCPS GQLAREDFVK

      51  IYKQFFPFGS PEDFANHLFT VFDKDNNGFI HFEEFITVLS TTSRGTLEEK

     101  LSWAFELYDL NHDGYITFDE MLTIVASVYK MMGSMVTLNE DEATPEMRVK

     151  KIFKLMDKNE DGYITLDEFR EGSKVDPSII GALNLYDGLI *


Protein Sequence for YDR373W_YPS128 from Stanford:

YDR373W_YPS128 [source=Stanford]  Length: 191  Fri Nov 24 19:57:27 2017  Type: P  Check: 9487  ..

       1  MGAKTSKLSK DDLTCLKQST YFDRREIQQW HKGFLRDCPS GQLAREDFVK

      51  IYKQFFPFGS PEDFANHLFT VFDKDNNGFI HFEEFITVLS TTSRGTLEEK

     101  LSWAFELYDL NHDGYITFDE MLTIVASVYK MMGSMVTLNE DEATPEMRVK

     151  KIFKLMDKNE DGYITLDEFR EGSKVDPSII GALNLYDGLI *


Protein Sequence for YDR373W_YPS163 from Stanford:

YDR373W_YPS163 [source=Stanford]  Length: 191  Fri Nov 24 19:57:27 2017  Type: P  Check: 9487  ..

       1  MGAKTSKLSK DDLTCLKQST YFDRREIQQW HKGFLRDCPS GQLAREDFVK

      51  IYKQFFPFGS PEDFANHLFT VFDKDNNGFI HFEEFITVLS TTSRGTLEEK

     101  LSWAFELYDL NHDGYITFDE MLTIVASVYK MMGSMVTLNE DEATPEMRVK

     151  KIFKLMDKNE DGYITLDEFR EGSKVDPSII GALNLYDGLI *


Protein Sequence for YDR373W_ZTW1 from Zhejiang:

YDR373W_ZTW1 [source=Zhejiang]  Length: 191  Fri Nov 24 19:57:27 2017  Type: P  Check: 9487  ..

       1  MGAKTSKLSK DDLTCLKQST YFDRREIQQW HKGFLRDCPS GQLAREDFVK

      51  IYKQFFPFGS PEDFANHLFT VFDKDNNGFI HFEEFITVLS TTSRGTLEEK

     101  LSWAFELYDL NHDGYITFDE MLTIVASVYK MMGSMVTLNE DEATPEMRVK

     151  KIFKLMDKNE DGYITLDEFR EGSKVDPSII GALNLYDGLI *