PEX3/YDR329C S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YDR329C_S288C   1   MAPNQRSRSLLQRHRGKVLISLTGIAALFTTGSVVVFFVKRWLYKQQLRI   50
YDR329C_AWRI796   
   --------------------------------------------------   
YDR329C_BY4741   1   MAPNQRSRSLLQRHRGKVLISLTGIAALFTTGSVVVFFVKRWLYKQQLRI   50
YDR329C_BY4742   1   MAPNQRSRSLLQRHRGKVLISLTGIAALFTTGSVVVFFVKRWLYKQQLRI   50
YDR329C_CEN.PK   1   MAPNQRSRSLLQRHRGKVLISLTGIAALFTTGSVVVFFVKRWLYKQQLRI   50
YDR329C_CLIB324   1   MAPNQRSRSLLQRHRGKLLISLTGIAALFTTGSVVVFFVKRWLYKQQLRI   50
YDR329C_D273-10B   1   MAPNQRSRSLLQRHRGKVLISLTGIAALFTTGSVVVFFVKRWLYKQQLRI   50
YDR329C_DBVPG6044   1   MAPNQRSRSLLQRHRGKLLISLTGIAALFTTGSVVVFFVKRWLYKQQLRI   50
YDR329C_EC1118   1   MAPNQRSRSLLQRHRGKLLISLTGIAALFTTGSVVVFFVKRWLYKQQLRI   50
YDR329C_EC9-8   1   MAPNQRSRSLLQRHRGKLLISLTGIAALFTTGSVVVFFVKRWLYKQQLRI   50
YDR329C_FL100   1   MAPNQRSRSLLQRHRGKVLISLTGIAALFTTGSVVVFFVKRWLYKQQLRI   50
YDR329C_FY1679   1   MAPNQRSRSLLQRHRGKVLISLTGIAALFTTGSVVVFFVKRWLYKQQLRI   50
YDR329C_FostersB   1   MAPNQRSRSLLQRHRGKLLISLTGIAALFTTGSVVVFFVKRWLYKQQLRI   50
YDR329C_FostersO   1   MAPNQRSRSLLQRHRGKLLISLTGIAALFTTGSVVVFFVKRWLYKQQLXI   50
YDR329C_JAY291   1   MAPNQRSRSLLQRHRGKLLISLTGIAALFTTGSVVVFFVKRWLYKQQLRI   50
YDR329C_JK9-3d   1   MAPNQRSRSLLQRHRGKVLISLTGIAALFTTGSVVVFFVKRWLYKQQLRI   50
YDR329C_K11   1   MAPNQRSRSLLQRHRGKLLISLTGIAALFTTGSVVVFFVKRWLYKQQLRI   50
YDR329C_Kyokai7   1   MAPNQRSRSLLQRHRGKLLISLTGIAALFTTGSVVVFFVKRWLYKQQLRI   50
YDR329C_L1528   1   MAPNQRSRSLLQRHRGKLLISLTGIAALFTTGSVVVFFVKRWLYKQQLRI   50
YDR329C_LalvinQA23   1   MAPNQRSRSLLQRHRGKLLISLTGIAALFTTGSVVVFFVKRWLYKQQLRI   50
YDR329C_PW5   1   MAPNQRSRSLLQRHRGKLLISLTGIAALFTTGSVVVFFVKRWLYKQQLRI   50
YDR329C_RM11-1a   1   MAPNQRSRSLLQRHRGKLLISLTGIAALFTTGSVVVFFVKRWLYKQQLRI   50
YDR329C_RedStar   1   MAPNQRSRSLLQRHRGKLLISLTGIAALFTTGSVVVFFVKRWLYKQQLRI   50
YDR329C_SEY6210   1   MAPNQRSRSLLQRHRGKVLISLTGIAALFTTGSVVVFFVKRWLYKQQLRI   50
YDR329C_SK1   1   MAPNQRSRSLLQRHRGKLLISLTGIAALFTTGSVVVFFVKRWLYKQQLRI   50
YDR329C_T7   1   MAPNQRSRSLLQRHRGKLLISLTGIAALFTTGSVVVFFVKRWLYKQQLRI   50
YDR329C_UWOPS05_217_3   1   MAPNQRSRSLLQRHRGKLLISLTGIAALFTTGSVVVFFVKRWLYKQQLRI   50
YDR329C_VL3   1   MAPNQRSRSLLQRHRGKLLISLTGIAALFTTGSVVVFFVKRWLYKQQLRI   50
YDR329C_Vin13   
   --------------------------------------------------   
YDR329C_W303   1   MAPNQRSRSLLQRHRGKVLISLTGIAALFTTGSVVVFFVKRWLYKQQLRI   50
YDR329C_X2180-1A   1   MAPNQRSRSLLQRHRGKVLISLTGIAALFTTGSVVVFFVKRWLYKQQLRI   50
YDR329C_Y55   1   MAPNQRSRSLLQRHRGKLLISLTGIAALFTTGSVVVFFVKRWLYKQQLRI   50
YDR329C_YJM269   1   MAPNQRSRSLLQRHRGKLLISLTGIAALFTTGSVVVFFVKRWLYKQQLRI   50
YDR329C_YJM339   1   MAPNQRSRSLLQRHRGKLLISLTGIAALFTTGSVVVFFVKRWLYKQQLRI   50
YDR329C_YJM789   1   MAPNQRSRSLLQRHRGKVLISLTGIAALFTTGSVVVFFVKRWLYKQQLRI   50
YDR329C_YPH499   1   MAPNQRSRSLLQRHRGKVLISLTGIAALFTTGSVVVFFVKRWLYKQQLRI   50
YDR329C_YPS128   1   MAPNQRSRSLLQRHRGKLLISLTGIAALFTTGSVVVFFVKRWLYKQQLRI   50
YDR329C_ZTW1   1   MAPNQRSRSLLQRHRGKLLISLTGIAALFTTGSVVVFFVKRWLYKQQLRI   50
         

YDR329C_S288C   51   TEQHFIKEQIKRRFEQTQEDSLYTIYELLPVWRMVLNENDLNLDSIVTQL   100
YDR329C_AWRI796   1   ---------------------------------MVLNENDLNLDSIVTQL   17
YDR329C_BY4741   51   TEQHFIKEQIKRRFEQTQEDSLYTIYELLPVWRMVLNENDLNLDSIVTQL   100
YDR329C_BY4742   51   TEQHFIKEQIKRRFEQTQEDSLYTIYELLPVWRMVLNENDLNLDSIVTQL   100
YDR329C_CEN.PK   51   TEQHFIKEQIKRRFEQTQEDSLYTIYELLPVWRMVLNENDLNLDSIVTQL   100
YDR329C_CLIB324   51   TEQHFIKEQIKRRFEQTQEDSLYTIYELLPVWRMVLNENDLNLDSIVTQL   100
YDR329C_D273-10B   51   TEQHFIKEQIKRRFEQTQEDSLYTIYELLPVWRMVLNENDLNLDSIVTQL   100
YDR329C_DBVPG6044   51   TEQHFIKEQIKRRFEQTQEDSLYTIYELLPVWRMVLNENDLNLDSIVTQL   100
YDR329C_EC1118   51   TEQHFIKEQIKRRFEQTQEDSLYTIYELLPVWRMVLNENDLNLDSIVTQL   100
YDR329C_EC9-8   51   TEQHFIKEQIKRRFEQTQEDSLYTIYELLPVWRMVLNENDLNLDSIVTQL   100
YDR329C_FL100   51   TEQHFIKEQIKRRFEQTQEDSLYTIYELLPVWRMVLNENDLNLDSIVTQL   100
YDR329C_FY1679   51   TEQHFIKEQIKRRFEQTQEDSLYTIYELLPVWRMVLNENDLNLDSIVTQL   100
YDR329C_FostersB   51   TEQHFIKEQIKRRFEQTQEDSLYTIYELLPVWRMVLNENDLNLDSIVTQL   100
YDR329C_FostersO   51   TEQHFIKEQIKRRFEQTQEDSLYTIYELLPVWRMVLNENDLNLDSIVTQL   100
YDR329C_JAY291   51   TEQHFIKEQIKRRFEQTQEDSLYTIYELLPVWRMVLNENDLNLDSIVTQL   100
YDR329C_JK9-3d   51   TEQHFIKEQIKRRFEQTQEDSLYTIYELLPVWRMVLNENDLNLDSIVTQL   100
YDR329C_K11   51   TEQHFIKEQIKRRFEQTQEDSLYTIYELLPVWRMVLNENDLNLDSIVTQL   100
YDR329C_Kyokai7   51   TEQHFIKEQIKRRFEQTQEDSLYTIYELLPVWRMVLNENDLNLDSIVTQL   100
YDR329C_L1528   51   TEQHFIKEQIKRRFEQTQEDSLYTIYELLPVWRMVLNENDLNLDSIVTQL   100
YDR329C_LalvinQA23   51   TEQHFIKEQIKRRFEQTQEDSLYTIYELLPVWRMVLNENDLNLDSIVTQL   100
YDR329C_PW5   51   TEQHFIKEQIKRRFEQTQEDSLYTIYELLPVWRMVLNENDLNLDSIVTQL   100
YDR329C_RM11-1a   51   TEQHFIKEQIKRRFEQTQEDSLYTIYELLPVWRMVLNENDLNLDSIVTQL   100
YDR329C_RedStar   51   TEQHFIKEQIKRRFEQTQEDSLYTIYELLPVWRMVLNENDLNLDSIVTQL   100
YDR329C_SEY6210   51   TEQHFIKEQIKRRFEQTQEDSLYTIYELLPVWRMVLNENDLNLDSIVTQL   100
YDR329C_SK1   51   TEQHFIKEQIKRRFEQTQEDSLYTIYELLPVWRMVLNENDLNLDSIVTQL   100
YDR329C_T7   51   TEQHFIKEQIKRRFEQTQEDSLYTIYELLPVWRMVLNENDLNLDSIVTQL   100
YDR329C_UWOPS05_217_3   51   TEQHFIKEQIKRRFEQTQEDSLYTIYELLPVWRMVLNENDLNLDSIVTQL   100
YDR329C_VL3   51   TEQHFIKEQIKRRFEQTQEDSLYTIYELLPVWRMVLNENDLNLDSIVTQL   100
YDR329C_Vin13   
   --------------------------------------------------   
YDR329C_W303   51   TEQHFIKEQIKRRFEQTQEDSLYTIYELLPVWRMVLNENDLNLDSIVTQL   100
YDR329C_X2180-1A   51   TEQHFIKEQIKRRFEQTQEDSLYTIYELLPVWRMVLNENDLNLDSIVTQL   100
YDR329C_Y55   51   TEQHFIKEQIKRRFEQTQEDSLYTIYELLPVWRMVLNENDLNLDSIVTQL   100
YDR329C_YJM269   51   TEQHFIKEQIKRRFEQTQEDSLYTIYELLPVWRMVLNENDLNLDSIVTQL   100
YDR329C_YJM339   51   TEQHFIKEQIKRRFEQTQEDSLYTIYELLPVWRMVLNENDLNLDSIVTQL   100
YDR329C_YJM789   51   TEQHFIKEQIKRRFEQTQEDSLYTIYELLPVWRMVLNENDLNLDSIVTQL   100
YDR329C_YPH499   51   TEQHFIKEQIKRRFEQTQEDSLYTIYELLPVWRMVLNENDLNLDSIVTQL   100
YDR329C_YPS128   51   TEQHFIKEQIKRRFEQTQEDSLYTIYELLPVWRMVLNENDLNLDSIVTQL   100
YDR329C_ZTW1   51   TEQHFIKEQIKRRFEQTQEDSLYTIYELLPVWRMVLNENDLNLDSIVTQL   100
         

YDR329C_S288C   101   KDQKNQLTRAKSSESRESSPLKSKAELWNELELKSLIKLVTVTYTVSSLI   150
YDR329C_AWRI796   18   KDQKNQLTRAKSSESRESSPLKSKAELWNELELKSLIKLVTVTYTVSSLI   67
YDR329C_BY4741   101   KDQKNQLTRAKSSESRESSPLKSKAELWNELELKSLIKLVTVTYTVSSLI   150
YDR329C_BY4742   101   KDQKNQLTRAKSSESRESSPLKSKAELWNELELKSLIKLVTVTYTVSSLI   150
YDR329C_CEN.PK   101   KDQKNQLTRAKSSESRESSPLKSKAELWNELELKSLIKLVTVTYTVSSLI   150
YDR329C_CLIB324   101   KDQKNQLTRAKSSESRESSPLKSKAELWNELELKSLIKLVTVTYTVSSLI   150
YDR329C_D273-10B   101   KDQKNQLTRAKSSESRESSPLKSKAELWNELELKSLIKLVTVTYTVSSLI   150
YDR329C_DBVPG6044   101   KDQKNQLTRAKSSESRESSPLKSKAELWNELELKSLIKLVTVTYTVSSLI   150
YDR329C_EC1118   101   KDQKNQLTRAKSSESRESSPLKSKAELWNELELKSLIKLVTVTYTVSSLI   150
YDR329C_EC9-8   101   KDQKNQLTRAKSSESRESSPLKSKAELWNELELKSLIKLVTVTYTVSSLI   150
YDR329C_FL100   101   KDQKNQLTRAKSSESRESSPLKSKAELWNELELKSLIKLVTVTYTVSSLI   150
YDR329C_FY1679   101   KDQKNQLTRAKSSESRESSPLKSKAELWNELELKSLIKLVTVTYTVSSLI   150
YDR329C_FostersB   101   KDQKNQLTRAKSSESRESSPLKSKAELWNELELKSLIKLVTVTYTVSSLI   150
YDR329C_FostersO   101   KDQKNQLTRAKSSESRESSPLKSKAELWNELELKSLIKLVTVTYTVSSLI   150
YDR329C_JAY291   101   KDQKNQLTRAKSSESRESSPLKSKAELWNELELKSLIKLVTVTYTVSSLI   150
YDR329C_JK9-3d   101   KDQKNQLTRAKSSESRESSPLKSKAELWNELELKSLIKLVTVTYTVSSLI   150
YDR329C_K11   101   KDQKNQLTRAKSSESRESSPLKSKAELWNELELKSLIKLVTVTYTVSSLI   150
YDR329C_Kyokai7   101   KDQKNQLTRAKSSESRESSPLKSKAELWNELELKSLIKLVTVTYTVSSLI   150
YDR329C_L1528   101   KDQKNQLTRAKSSESRESSPLKSKAELWNELELKSLIKLVTVTYTVSSLI   150
YDR329C_LalvinQA23   101   KDQKNQLTRAKSSESRESSPLKSKAELWNELELKSLIKLVTVTYTVSSLI   150
YDR329C_PW5   101   KDQKNQFTRAKSSESRESSPLKSKAELWNELELKSLIKLVTVTYTVSSLI   150
YDR329C_RM11-1a   101   KDQKNQLTRAKSSESRESSPLKSKAELWNELELKSLIKLVTVTYTVSSLI   150
YDR329C_RedStar   101   KDQKNQLTRAKSSESRESSPLKSKAELWNELELKSLIKLVTVTYTVSSLI   150
YDR329C_SEY6210   101   KDQKNQLTRAKSSESRESSPLKSKAELWNELELKSLIKLVTVTYTVSSLI   150
YDR329C_SK1   101   KDQKNQLTRAKSSESRESSPLKSKAELWNELELKSLIKLVTVTYTVSSLI   150
YDR329C_T7   101   KDQKNQLTRAKSSESRESSPLKSKAELWNELELKSLIKLVTVTYTVSSLI   150
YDR329C_UWOPS05_217_3   101   KDQKNQLTRAKSSESRESSPLKSKAELWNELELKSLIKLVTVTYTVSSLI   150
YDR329C_VL3   101   KDQKNQLTRAKSSESRESSPLKSKAELWNELELKSLIKLVTVTYTVSSLI   150
YDR329C_Vin13   
   --------------------------------------------------   
YDR329C_W303   101   KDQKNQLTRAKSSESRESSPLKSKAELWNELELKSLIKLVTVTYTVSSLI   150
YDR329C_X2180-1A   101   KDQKNQLTRAKSSESRESSPLKSKAELWNELELKSLIKLVTVTYTVSSLI   150
YDR329C_Y55   101   KDQKNQLTRAKSSESRESSPLKSKAELWNELELKSLIKLVTVTYTVSSLI   150
YDR329C_YJM269   101   KDQKNQLTRAKSSESRESSPLKSKAELWNELELKSLIKLVTVTYTVSSLI   150
YDR329C_YJM339   101   KDQKNQLTRAKSSESRESSPLKSKAELWNELELKSLIKLVTVTYTVSSLI   150
YDR329C_YJM789   101   KDQKNQLTRAKSSESRESSPLKSKAELWNELELKSLIKLVTVTYTVSSLI   150
YDR329C_YPH499   101   KDQKNQLTRAKSSESRESSPLKSKAELWNELELKSLIKLVTVTYTVSSLI   150
YDR329C_YPS128   101   KDQKNQLTRAKSSESRESSPLKSKAELWNELELKSLIKLVTVTYTVSSLI   150
YDR329C_ZTW1   101   KDQKNQLTRAKSSESRESSPLKSKAELWNELELKSLIKLVTVTYTVSSLI   150
         

YDR329C_S288C   151   LLTRLQLNILTRNEYLDSAIKLTMQQENCNKLQNRFYNWVTSWWSDPEDK   200
YDR329C_AWRI796   68   LLTRLQLNILTRNEYLDSAIKLTMQQENCNKLQNRFYNWVTSWWSDPEDK   117
YDR329C_BY4741   151   LLTRLQLNILTRNEYLDSAIKLTMQQENCNKLQNRFYNWVTSWWSDPEDK   200
YDR329C_BY4742   151   LLTRLQLNILTRNEYLDSAIKLTMQQENCNKLQNRFYNWVTSWWSDPEDK   200
YDR329C_CEN.PK   151   LLTRLQLNILTRNEYLDSAIKLTMQQENCNKLQNRFYNWVTSWWSDPEDK   200
YDR329C_CLIB324   151   LLTRLQLNILTRNEYLDSAIKLTMQQENCNKLQNRFYNWVTSWWSDPEDK   200
YDR329C_D273-10B   151   LLTRLQLNILTRNEYLDSAIKLTMQQENCNKLQNRFYNWVTSWWSDPEDK   200
YDR329C_DBVPG6044   151   LLTRLQLNILTRNEYLDSAIKLTMQQENCNKLQNRFYNWVTSWWSDPEDK   200
YDR329C_EC1118   151   LLTRLQLNILTRNEYLDSAIKLTMQQENCNKLQNRFYNWVTSWWSDPEDK   200
YDR329C_EC9-8   151   LLTRLQLNILTRNEYLDSAIKLTMQQENCNKLQNRFYNWVTSWWSDPEDK   200
YDR329C_FL100   151   LLTRLQLNILTRNEYLDSAIKLTMQQENCNKLQNRFYNWVTSWWSDPEDK   200
YDR329C_FY1679   151   LLTRLQLNILTRNEYLDSAIKLTMQQENCNKLQNRFYNWVTSWWSDPEDK   200
YDR329C_FostersB   151   LLTRLQLNILTRNEYLDSAIKLTMQQENCNKLQNRFYNWVTSWWSDPEDK   200
YDR329C_FostersO   151   LLTRLQLNILTRNEYLDSAIKXTMQQENCNKLQNRFYNWVTSWWSDPEDK   200
YDR329C_JAY291   151   LLTRLQLNILTRNEYLDSAIKLTMQQENCNKLQNRFYNWVTSWWSDPEDK   200
YDR329C_JK9-3d   151   LLTRLQLNILTRNEYLDSAIKLTMQQENCNKLQNRFYNWVTSWWSDPEDK   200
YDR329C_K11   151   LLTRLQLNILTRNEYLDSAIKLTMQQENCNKLQNRFYNWVTSWWSDPEDK   200
YDR329C_Kyokai7   151   LLTRLQLNILTRNEYLDSAIKLTMQQENCNKLQNRFYNWVTSWWSDPEDK   200
YDR329C_L1528   151   LLTRLQLNILTRNEYLDSAIKLTMQQENCNKLQNRFYNWVTSWWSDPEDK   200
YDR329C_LalvinQA23   151   LLTRLQLNILTRNEYLDSAIKLTMQQENCNKLQNRFYNWVTSWWSDPEDK   200
YDR329C_PW5   151   LLTRLQLNILTRNEYLDSAIKLTMQQENCNKLQNRFYNWVTSWWSDPEDK   200
YDR329C_RM11-1a   151   LLTRLQLNILTRNEYLDSAIKLTMQQENCNKLQNRFYNWVTSWWSDPEDK   200
YDR329C_RedStar   151   LLTRLQLNILTRNEYLDSAIKLTMQQENCNKLQNRFYNWVTSWWSDPEDK   200
YDR329C_SEY6210   151   LLTRLQLNILTRNEYLDSAIKLTMQQENCNKLQNRFYNWVTSWWSDPEDK   200
YDR329C_SK1   151   LLTRLQLNILTRNEYLDSAIKLTMQQENCNKLQNRFYNWVTSWWSDPEDK   200
YDR329C_T7   151   LLTRLQLNILTRNEYLDSAIKLTMQQENCNKLQNRFYNWVTSWWSDPEDK   200
YDR329C_UWOPS05_217_3   151   LLTRLQLNILTRNEYLDSAIKLTMQQENCNKLQNRFYNWVTSWWSDPEDK   200
YDR329C_VL3   151   LLTRLQLNILTRNEYLDSAIKLTMQQENCNKLQNRFYNWVTSWWSDPEDK   200
YDR329C_Vin13   1   -----------------------MQQENCNKLQNRFYNWVTSWWSDPEDK   27
YDR329C_W303   151   LLTRLQLNILTRNEYLDSAIKLTMQQENCNKLQNRFYNWVTSWWSDPEDK   200
YDR329C_X2180-1A   151   LLTRLQLNILTRNEYLDSAIKLTMQQENCNKLQNRFYNWVTSWWSDPEDK   200
YDR329C_Y55   151   LLTRLQLNILTRNEYLDSAIKLTMQQENCNKLQNRFYNWVTSWWSDPEDK   200
YDR329C_YJM269   151   LLTRLQLNILTRNEYLDSAIKLTMQQENCNKLQNRFYNWVTSWWSDPEDK   200
YDR329C_YJM339   151   LLTRLQLNILTRNEYLDSAIKLTMQQENCNKLQNRFYNWVTSWWSDPEDK   200
YDR329C_YJM789   151   LLTRLQLNILTRNEYLDSAIKLTMQQENCNKLQNRFYNWVTSWWSDPEDK   200
YDR329C_YPH499   151   LLTRLQLNILTRNEYLDSAIKLTMQQENCNKLQNRFYNWVTSWWSDPEDK   200
YDR329C_YPS128   151   LLTRLQLNILTRNEYLNSAIKLTMQQENCNKLQNRFYNWVTSWWSDPEDK   200
YDR329C_ZTW1   151   LLTRLQLNILTRNEYLDSAIKLTMQQENCNKLQNRFYNWVTSWWSDPEDK   200
         

YDR329C_S288C   201   ADDAMVMAAKKSKKEGQEVYINEQAFLSLSWWILNKGWLSYNEIITNQIE   250
YDR329C_AWRI796   118   ADDAMVMAAKKSKKEGQEVYINEQAFLSLSWWILNKGWLSYNEIITNQIE   167
YDR329C_BY4741   201   ADDAMVMAAKKSKKEGQEVYINEQAFLSLSWWILNKGWLSYNEIITNQIE   250
YDR329C_BY4742   201   ADDAMVMAAKKSKKEGQEVYINEQAFLSLSWWILNKGWLSYNEIITNQIE   250
YDR329C_CEN.PK   201   ADDAMVMAAKKSKKEGQEVYINEQAFLSLSWWILNKGWLSYNEIITNQIE   250
YDR329C_CLIB324   201   ADDAMVMAAKKSKKEGQEVYINEQAFLSLSWWILNKGWLSYNEIITNQIE   250
YDR329C_D273-10B   201   ADDAMVMAAKKSKKEGQEVYINEQAFLSLSWWILNKGWLSYNEIITNQIE   250
YDR329C_DBVPG6044   201   ADDAMVMAAKKSKKEGQEVYINEQAFLSLSWWILNKGWLSYNEIITNQIE   250
YDR329C_EC1118   201   ADDAMVMAAKKSKKEGQEVYINEQAFISLSWWILNKGWLSYNEIITNQIE   250
YDR329C_EC9-8   201   ADDAMVMAAKKSKKEGQEVYINEQAFLSLSWWILNKGWLSYNEIITNQIE   250
YDR329C_FL100   201   ADDAMVMAAKKSKKEGQEVYINEQAFLSLSWWILNKGWLSYNEIITNQIE   250
YDR329C_FY1679   201   ADDAMVMAAKKSKKEGQEVYINEQAFLSLSWWILNKGWLSYNEIITNQIE   250
YDR329C_FostersB   201   ADDAMVMAXKKVKERRPGSVY-----------------------------   221
YDR329C_FostersO   201   ADDAMVMAAKKSKKEGQEVYINEQXFLSLSWWILNKGWLSYNEIITNQIE   250
YDR329C_JAY291   201   ADDAMVMAAKKSKKEGQEVYINEQAFLSLSWWILNKGWLSYNEIITNQIE   250
YDR329C_JK9-3d   201   ADDAMVMAAKKSKKEGQEVYINEQAFLSLSWWILNKGWLSYNEIITNQIE   250
YDR329C_K11   201   ADDAMVMTAKKSKKEGQEVYINEQAFLSLSWWILNKGWLSYNEIITNQIE   250
YDR329C_Kyokai7   201   ADDAMVMTAKKSKKEGQEVYINEQAFLSLSWWILNKGWLSYNEIITNQIE   250
YDR329C_L1528   201   ADDAMVMAAKKSKKEGQEVYINEQAFLSLSWWILNKGWLSYNEIITNQIE   250
YDR329C_LalvinQA23   201   ADDAMVMAAKKSKKEGQEVYINEQAFXSLSWVDS----------------   234
YDR329C_PW5   201   ADDAMVMAAKKSKKEGQEVYINEQAFLSLSWWILNKGWLSYNEIITNQIE   250
YDR329C_RM11-1a   201   ADDAMVMAAKKSKKEGQEVYINEQAFLSLSWWILNKGWLSYNEIITNQIE   250
YDR329C_RedStar   201   ADDAMVMAAKKSKKEGQEVYINEQAFLSLSWWILNKGWLSYNEIITNQIE   250
YDR329C_SEY6210   201   ADDAMVMAAKKSKKEGQEVYINEQAFLSLSWWILNKGWLSYNEIITNQIE   250
YDR329C_SK1   201   ADDAMVMAAKKSKKEGQEVYINEQAFLSLSWWILNKGWLSYNEIITNQIE   250
YDR329C_T7   201   ADDAMVMVAKKSKKEGQEVYINEQAFLSLSWWILNKGWLSYNEIITNQIE   250
YDR329C_UWOPS05_217_3   201   ADDAMVVAAKKSKKEGQEVYINEQAFLSLSWWILNKGWLSYNEIITNQIE   250
YDR329C_VL3   201   ADDAMVMAAKKSKKEGQEVYINEQAFLSLSWWILNKGWLSYNEIITNQIE   250
YDR329C_Vin13   28   ADDAMVMAAKKSKKEGQEVYINEQAFXSLSWWILNKGWLSYNEIITNQIE   77
YDR329C_W303   201   ADDAMVMAAKKSKKEGQEVYINEQAFLSLSWWILNKGWLSYNEIITNQIE   250
YDR329C_X2180-1A   201   ADDAMVMAAKKSKKEGQEVYINEQAFLSLSWWILNKGWLSYNEIITNQIE   250
YDR329C_Y55   201   ADDAMVMAAKKSKKEGQEVYINEQAFLSLSWWILNKGWLSYNEIITNQIE   250
YDR329C_YJM269   201   ADDAMVMAAKKSKKEGQEVYINEQAFLSLSWWILNKGWLSYNEIITNQIE   250
YDR329C_YJM339   201   ADDAMVMAAKKSKKEGQEVYINEQAFLSLSWWILNKGWLSYNEIITNQIE   250
YDR329C_YJM789   201   ADDAMVMAAKKSKKEGQEVYINEQAFLSLSWWILNKGWLSYNEIITNQIE   250
YDR329C_YPH499   201   ADDAMVMAAKKSKKEGQEVYINEQAFLSLSWWILNKGWLSYNEIITNQIE   250
YDR329C_YPS128   201   ADDAMVMAAKKSKKEGQEVYINEQAFLSLSWWILNKGWLSYNEIITNQIE   250
YDR329C_ZTW1   201   ADDAMVMAAKKSKKEGQEVYINEQAFLSLSWWILNKGWLSYNEIITNQIE   250
         

YDR329C_S288C   251   IEFDGIHPRDTLTLEEFSSRLTNIFRNTNSQIFQQNNNNLTSILLPKDSS   300
YDR329C_AWRI796   168   IEFDGIHPRDTLTLEEFSSRLTNIFRNTNSQIFQQNNNNLTSILLPKDSS   217
YDR329C_BY4741   251   IEFDGIHPRDTLTLEEFSSRLTNIFRNTNSQIFQQNNNNLTSILLPKDSS   300
YDR329C_BY4742   251   IEFDGIHPRDTLTLEEFSSRLTNIFRNTNSQIFQQNNNNLTSILLPKDSS   300
YDR329C_CEN.PK   251   IEFDGIHPRDTLTLEEFSSRLTNIFRNTNSQIFQQNNNNLTSILLPKDSS   300
YDR329C_CLIB324   251   IEFDGIHPRDTLTLEEFSSRLTNIFRNTNSQIFQQNNNNLTSILLPKDSS   300
YDR329C_D273-10B   251   IEFDGIHPRDTLTLEEFSSRLTNIFRNTNSQIFQQNNNNLTSILLPKDSS   300
YDR329C_DBVPG6044   251   IEFDGIHPRDTLTLEEFSSRLTNIFRNTNSQIFQQNNNNLTSILLPKDSS   300
YDR329C_EC1118   251   IEFDGIHPRDTLTLEEFSSRLTNIFRNTNSQIFQQNNNNLTSILLPKDSS   300
YDR329C_EC9-8   251   IEFDGIHPRDTLTLEEFSSRLTNIFRNTNSQIFQQNNNNLTSILLPKDSS   300
YDR329C_FL100   251   IEFDGIHPRDTLTLEEFSSRLTNIFRNTNSQIFQQNNNNLTSILLPKDSS   300
YDR329C_FY1679   251   IEFDGIHPRDTLTLEEFSSRLTNIFRNTNSQIFQQNNNNLTSILLPKDSS   300
YDR329C_FostersB   
   --------------------------------------------------   
YDR329C_FostersO   251   IEFDGIHPRDTLTLEEFSSRLTNIFRNTNSQIFQQNNNNLTSILLPKDSS   300
YDR329C_JAY291   251   IEFDGIHPRDTLTLEEFSSRLTNIFRNTNSQIFQQNNNNLTSILLPKDSS   300
YDR329C_JK9-3d   251   IEFDGIHPRDTLTLEEFSSRLTNIFRNTNSQIFQQNNNNLTSILLPKDSS   300
YDR329C_K11   251   IEFDGIHPRDTLTLEEFSSRLTNIFRNTNSQIFQQNNNNLTSILLPKDSS   300
YDR329C_Kyokai7   251   IEFDGIHPRDTLTLEEFSSRLTNIFRNTNSQIFQQNNNNLTSILLPKDSS   300
YDR329C_L1528   251   IEFDGIHPRDTLTLEEFSSRLTNIFRNTNSQIFQQNNNNLTSILLPKDSS   300
YDR329C_LalvinQA23   
   --------------------------------------------------   
YDR329C_PW5   251   IEFDGIHPRDTLTLEEFSSRLTNIFRNTNSQIFQQNNNNLTSILLPKDSS   300
YDR329C_RM11-1a   251   IEFDGIHPRDTLTLEEFSSRLTNIFRNTNSQIFQQNNNNLTSILLPKDSS   300
YDR329C_RedStar   251   IEFDGIHPRDTLTLEEFSSRLTNIFRNTNSQIFQQNNNNLTSILLPKDSS   300
YDR329C_SEY6210   251   IEFDGIHPRDTLTLEEFSSRLTNIFRNTNSQIFQQNNNNLTSILLPKDSS   300
YDR329C_SK1   251   IEFDGIHPRDTLTLEEFSSRLTNIFRNTNSQIFQQNNNNLTSILLPKDSS   300
YDR329C_T7   251   IEFDGIHPRDTLTLEEFSSRLTNIFRNTNSQIFQQNNNNLTSILLPKDSS   300
YDR329C_UWOPS05_217_3   251   IEFDGIHPRDTLTLEEFSSRLTNIFRNTNSQIFQQNNNNLTSILLPKDSS   300
YDR329C_VL3   251   IEFDGIHPRDTLTLEEFSSRLTNIFRNTNSQIFQQNNNNLTSILLPKDSS   300
YDR329C_Vin13   78   IEFDGIHPRDTLTLEEFSSRLTNIFRNTNSQIFQQNNNNLTSILLPKDSS   127
YDR329C_W303   251   IEFDGIHPRDTLTLEEFSSRLTNIFRNTNSQIFQQNNNNLTSILLPKDSS   300
YDR329C_X2180-1A   251   IEFDGIHPRDTLTLEEFSSRLTNIFRNTNSQIFQQNNNNLTSILLPKDSS   300
YDR329C_Y55   251   IEFDGIHPRDTLTLEEFSSRLTNIFRNTNSQIFQQNNNNLTSILLPKDSS   300
YDR329C_YJM269   251   IEFDGIHPRDTLTLEEFSSRLTNIFRNTNSQIFQQNNNNLTSILLPKDSS   300
YDR329C_YJM339   251   IEFDGIHPRDTLTLEEFSSRLTNIFRNTNSQIFQQNNNNLTSILLPKDSS   300
YDR329C_YJM789   251   IEFDGIHPRDTLTLEEFSSRLTNIFRNTNSQIFQQNNNNLTSILLPKDSS   300
YDR329C_YPH499   251   IEFDGIHPRDTLTLEEFSSRLTNIFRNTNSQIFQQNNNNLTSILLPKDSS   300
YDR329C_YPS128   251   IEFDGIHPRDTLTLEEFSSRLTNIFRNTNSQIFQQNNNSLTSILLPKDSS   300
YDR329C_ZTW1   251   IEFDGIHPRDTLTLEEFSSRLTNIFRNTNSQIFQQNNNNLTSILLPKDSS   300
         

YDR329C_S288C   301   GQEFLLSQTLDADALTSFHSNTLVFNQLVNELTQCIESTATSIVLESLIN   350
YDR329C_AWRI796   218   GQEFLLSQTLDADALTSFHSNTLVFNQLVNELTQCIESTATSIVLESLIN   267
YDR329C_BY4741   301   GQEFLLSQTLDADALTSFHSNTLVFNQLVNELTQCIESTATSIVLESLIN   350
YDR329C_BY4742   301   GQEFLLSQTLDADALTSFHSNTLVFNQLVNELTQCIESTATSIVLESLIN   350
YDR329C_CEN.PK   301   GQEFLLSQTLDADALTSFHSNTLVFNQLVNELTQCIESTATSIVLESLIN   350
YDR329C_CLIB324   301   GQEFLLSQTLDADALTSFHSNTLVFNQLVNELTQCIESTATSIVLESLIN   350
YDR329C_D273-10B   301   GQEFLLSQTLDADALTSFHSNTLVFNQLVNELTQCIESTATSIVLESLIN   350
YDR329C_DBVPG6044   301   GQEFLLSQTLDADALTSFHSNTLVFNQLVNELTQCIESTATSIVLESLIN   350
YDR329C_EC1118   301   GQEFLLSQTLDADALTSFHSNTLVFNQLVNELTQCIESTATSIVLESLIN   350
YDR329C_EC9-8   301   GQEFLLSQTLDADALTSFHSNTLVFNQLVNELTQCIESTATSIVLESLIN   350
YDR329C_FL100   301   GQEFLLSQTLDADALTSFHSNTLVFNQLVNELTQCIESTATSIVLESLIN   350
YDR329C_FY1679   301   GQEFLLSQTLDADALTSFHSNTLVFNQLVNELTQCIESTATSIVLESLIN   350
YDR329C_FostersB   
   --------------------------------------------------   
YDR329C_FostersO   301   GQEFLLSQTLDADALTSFHSNTLVFNQLVNELTQCIESTATXIVLESLIN   350
YDR329C_JAY291   301   GQEFLLSQTLDADALTSFHSNTLVFNQLVNELTQCIESTATSIVLESLIN   350
YDR329C_JK9-3d   301   GQEFLLSQTLDADALTSFHSNTLVFNQLVNELTQCIESTATSIVLESLIN   350
YDR329C_K11   301   GQEFLLSQTLDADALTSFHSNTLVFNQLVNELTQCIESTATSIVLESLIN   350
YDR329C_Kyokai7   301   GQEFLLSQTLDADALTSFHSNTLVFNQLVNELTQCIESTATSIVLESLIN   350
YDR329C_L1528   301   GQEFLLSQTLDADALTSFHSNTLVFNQLVNELTQCIESTATSIVLESLIN   350
YDR329C_LalvinQA23   
   --------------------------------------------------   
YDR329C_PW5   301   GQEFLLSQTLDADALTSFHSNTLVFNQLVNELTQCIESTATSIVLESLIN   350
YDR329C_RM11-1a   301   GQEFLLSQTLDADALTSFHSNTLVFNQLVNELTQCIESTATSIVLESLIN   350
YDR329C_RedStar   301   GQEFLLSQTLDADALTSFHSNTLVFNQLVNELTQCIESTATSIVLESLIN   350
YDR329C_SEY6210   301   GQEFLLSQTLDADALTSFHSNTLVFNQLVNELTQCIESTATSIVLESLIN   350
YDR329C_SK1   301   GQEFLLSQTLDADALTSFHSNTLVFNQLVNELTQCIESTATSIVLESLIN   350
YDR329C_T7   301   GQEFLLSQTLDADALTSFHSNTLVFNQLVNELTQCIESTATSIVLESLIN   350
YDR329C_UWOPS05_217_3   301   GQEFLLSQTLDADALTSFHSNTLVFNQLVNELTQSIESTATSIVLESLIN   350
YDR329C_VL3   301   GQEFLLSQTLDADALTSFHSNTLVFNQLVNELTQCIESTATSIVLESLIN   350
YDR329C_Vin13   128   GQEFLLSQTLDADALTSFHSNTLVFNQLVNELTQCIESTATSIVLESLIN   177
YDR329C_W303   301   GQEFLLSQTLDADALTSFHSNTLVFNQLVNELTQCIESTATSIVLESLIN   350
YDR329C_X2180-1A   301   GQEFLLSQTLDADALTSFHSNTLVFNQLVNELTQCIESTATSIVLESLIN   350
YDR329C_Y55   301   GQEFLLSQTLDADALTSFHSNTLVFNQLVNELTQCIESTATSIVLESLIN   350
YDR329C_YJM269   301   GQEFLLSQTLDADALTSFHSNTLVFNQLVNELTQCIESTATSIVLESLIN   350
YDR329C_YJM339   301   GQEFLLSQTLDADALTSFHSNTLVFNQLVNELTQCIESTATSIVLESLIN   350
YDR329C_YJM789   301   GQEFLLSQTLDADALTSFHSNTLVFNQLVNELTQCIESTATSIVLESLIN   350
YDR329C_YPH499   301   GQEFLLSQTLDADALTSFHSNTLVFNQLVNELTQCIESTATSIVLESLIN   350
YDR329C_YPS128   301   GQEFLLSQTLDADALTSFHSNTLVFNQLVNELTQCIESTATSIVLESLIN   350
YDR329C_ZTW1   301   GQEFLLSQTLDADALTSFHSNTLVFNQLVNELTQCIESTATSIVLESLIN   350
         

YDR329C_S288C   351   ESFHFIMNKVGIKTIAKKK-PGQEDQQQYQMAVFAMSMKDCCQEMLQTTA   399
YDR329C_AWRI796   268   ESFHFIMNKGRHKDNSQEKNLGQEDQQQYQMAVFAMSMKDCCQEMLQTTA   317
YDR329C_BY4741   351   ESFHFIMNKVGIKTIAKKK-PGQEDQQQYQMAVFAMSMKDCCQEMLQTTA   399
YDR329C_BY4742   351   ESFHFIMNKVGIKTIAKKK-PGQEDQQQYQMAVFAMSMKDCCQEMLQTTA   399
YDR329C_CEN.PK   351   ESFHFIMNKVGIKTIAKKK-PGQEDQQQYQMAVFAMSMKDCCQEMLQTTA   399
YDR329C_CLIB324   351   ESFHFIMNKVGIKTIAKKK-PGQEDQQQYQMAVFAMSMKDCCQEMLQTTA   399
YDR329C_D273-10B   351   ESFHFIMNKVGIKTIAKKK-PGQEDQQQYQMAVFAMSMKDCCQEMLQTTA   399
YDR329C_DBVPG6044   351   ESFHFIMNKVGIKTIAKKK-PGQEDQQQYQMAVFAMSMKDCCQEMLQTTA   399
YDR329C_EC1118   351   ESFHFIMNKVGIKTIAKKK-PGQEDQQQYQMAVFAMSMKDCCQEMLQTTA   399
YDR329C_EC9-8   351   ESFHFIMNKVGIKTIAKKK-PGQEDQQQYQMAVFAMSMKDCCQEMLQTTA   399
YDR329C_FL100   351   ESFHFIMNKVGIKTIAKKK-PGQEDQQQYQMAVFAMSMKDCCQEMLQTTA   399
YDR329C_FY1679   351   ESFHFIMNKVGIKTIAKKK-PGQEDQQQYQMAVFAMSMKDCCQEMLQTTA   399
YDR329C_FostersB   
   --------------------------------------------------   
YDR329C_FostersO   351   ESFHFIMNKVGIKTIAKKK-XGQEDQQQYQMAVFAMSMKDCCQEMLQTTX   399
YDR329C_JAY291   351   ESFHFIMNKVGIKTIAKKK-PGQEDQQQYQMAVFAMSMKDCCQEMLQTTA   399
YDR329C_JK9-3d   351   ESFHFIMNKVGIKTIAKKK-PGQEDQQQYQMAVFAMSMKDCCQEMLQTTA   399
YDR329C_K11   351   ESFHFIMNKVGIKTIAKKK-PGQEDQQQYQMAVFAMSMKDCCQEMLQTTA   399
YDR329C_Kyokai7   351   ESFHFIMNKVGIKTIAKKK-PGQEDQQQYQMAVFAMSMKDCCQEMLQTTA   399
YDR329C_L1528   351   ESFHFIMNKVGIKTIAKKK-PGQEDQQQYQMAVFAMSMKDCCQEMLQTTA   399
YDR329C_LalvinQA23   
   --------------------------------------------------   
YDR329C_PW5   351   ESFHFIMNKVGIKTIAKKK-PGQEDQQQYQMAVFAMSMKDCCQEMLQTTA   399
YDR329C_RM11-1a   351   ESFHFIMNKVGIKTIAKKK-PGQEDQQQYQMAVFAMSMKDCCQEMLQTTA   399
YDR329C_RedStar   351   ESFHFIMNKVGIKTIAKKK-PGQEDQQQYQMAVFAMSMKDCCQEMLQTTA   399
YDR329C_SEY6210   351   ESFHFIMNKVGIKTIAKKK-PGQEDQQQYQMAVFAMSMKDCCQEMLQTTA   399
YDR329C_SK1   351   ESFHFIMNKVGIKTIAKKK-PGQEDQQQYQMAVFAMSMKDCCQEMLQTTA   399
YDR329C_T7   351   ESFHFIMNKVGIKTIAKKK-PGQEDQQQYQMAVFAMSMKDCCQEMLQTTA   399
YDR329C_UWOPS05_217_3   351   ESFHFIMNKVGIKTIAKKK-PGQEDQQQYQMAVFAMSMKDCCQEMLQTTA   399
YDR329C_VL3   351   ESFHFIMNKVGIKTIAKKK-----TWPRRSATVSNGSFRYVDERLLPRNA   395
YDR329C_Vin13   178   ESFHFIMNKVGIKTIAKKK-PGQEDQQQYQMAVFAMSMKDCCQEMLQTTA   226
YDR329C_W303   351   ESFHFIMNKVGIKTIAKKK-PGQEDQQQYQMAVFAMSMKDCCQEMLQTTA   399
YDR329C_X2180-1A   351   ESFHFIMNKVGIKTIAKKK-PGQEDQQQYQMAVFAMSMKDCCQEMLQTTA   399
YDR329C_Y55   351   ESFHFIMNKVGIKTIAKKK-PGQEDQQQYQMAVFAMSMKDCCQEMLQTTA   399
YDR329C_YJM269   351   ESFHFIMNKVGIKTIAKKK-PGQEDQQQYQMAVFAMSMKDCCQEMLQTTA   399
YDR329C_YJM339   351   ESFHFIMNKVGIKTIAKKK-PGQEDQQQYQMAVFAMSMKDCCQEMLQTTA   399
YDR329C_YJM789   351   ESFHFIMNKVGIKTIAKKK-PGQEDQQQYQMAVFAMSMKDCCQEMLQTTA   399
YDR329C_YPH499   351   ESFHFIMNKVGIKTIAKKK-PGQEDQQQYQMAVFAMSMKDCCQEMLQTTA   399
YDR329C_YPS128   351   ESFHFIMNKVGIKTIAKKK-PGQEDQQQYQMAVFAMSMKDCCQEMLQTTA   399
YDR329C_ZTW1   351   ESFHFIMNKVGIKTIAKKK-PGQEDQQQYQMAVFAMSMKGCCQEMLQTTA   399
         

YDR329C_S288C   400   GSSHSGSVNEYLATLDSVQPLDDLSASVYSNFGVSSSFSFKP   441
YDR329C_AWRI796   318   GSSHSGSVNEYLATLDSVQPLDDLSASVYSNFGVSSSFSFKP   359
YDR329C_BY4741   400   GSSHSGSVNEYLATLDSVQPLDDLSASVYSNFGVSSSFSFKP   441
YDR329C_BY4742   400   GSSHSGSVNEYLATLDSVQPLDDLSASVYSNFGVSSSFSFKP   441
YDR329C_CEN.PK   400   GSSHSGSVNEYLATLDSVQPLDDLSASVYSNFGVSSSFSFKP   441
YDR329C_CLIB324   400   GSSHSGSVNEYLATLDSVQPLDDLSASVYSNFGVSSSFSFKP   441
YDR329C_D273-10B   400   GSSHSGSVNEYLATLDSVQPLDDLSASVYSNFGVSSSFSFKP   441
YDR329C_DBVPG6044   400   GSSHSGSVNEYLATLDSVQPLDDLSASVYSNFGVSSSFSFKP   441
YDR329C_EC1118   400   GSSHSGSVNEYLATLDSVQPLDDLSASVYSNFGVSSSFSFKP   441
YDR329C_EC9-8   400   GSSHSGSVNEYLATLDSVQPLDDLSASVYSNFGVSSSFSFKP   441
YDR329C_FL100   400   GSSHSGSVNEYLATLDSVQPLDDLSASVYSNFGVSSSFSFKP   441
YDR329C_FY1679   400   GSSHSGSVNEYLATLDSVQPLDDLSASVYSNFGVSSSFSFKP   441
YDR329C_FostersB   
   ------------------------------------------   
YDR329C_FostersO   400   GSSHSGSVNEYLATXDSVQPLDXLSAIVYSNFGVSSSFSFKP   441
YDR329C_JAY291   400   GSSHSGSVNEYLATLDSVQPLDDLSASVYSNFGVSSSFSFKP   441
YDR329C_JK9-3d   400   GSSHSGSVNEYLATLDSVQPLDDLSASVYSNFGVSSSFSFKP   441
YDR329C_K11   400   GSSHSGSVNEYLATLDSVQPLDDLSASVYSNFGVSSSFSFKP   441
YDR329C_Kyokai7   400   GSSHSGSVNEYLATLDSVQPLDDLSASVYSNFGVSSSFSFKP   441
YDR329C_L1528   400   GSSHSGSVNEYLATLDSVQPLDDLSASVYSNFGVSSSFSFKP   441
YDR329C_LalvinQA23   
   ------------------------------------------   
YDR329C_PW5   400   GSSHSGSVNEYLATLDSVQPLDDLSASVYSNFGVSSSFSFKP   441
YDR329C_RM11-1a   400   GSSHSGSVNEYLATLDSVQPLDDLSASVYSNFGVSSSFSFKP   441
YDR329C_RedStar   400   GSSHSGSVNEYLATLDSVQPLDDLSASVYSNFGVSSSFSFKP   441
YDR329C_SEY6210   400   GSSHSGSVNEYLATLDSVQPLDDLSASVYSNFGVSSSFSFKP   441
YDR329C_SK1   400   GSSHSGSVNEYLATLDSVQPLDDLSASVYSNFGVSSSFSFKP   441
YDR329C_T7   400   GSSHSGSVNEYLATLDSVQPLDDLSASVYSNFGVSSSFSFKP   441
YDR329C_UWOPS05_217_3   400   GSSHSGSVNEYLATLDSVQPLDDLSASVYSNFGVSSSFSFKP   441
YDR329C_VL3   396   SNNCRVFP----------------------------------   403
YDR329C_Vin13   227   GSSHSGSVNEYLATLDSVQPLDDLSASVYSNFGVSSSFSFKP   268
YDR329C_W303   400   GSSHSGSVNEYLATLDSVQPLDDLSASVYSNFGVSSSFSFKP   441
YDR329C_X2180-1A   400   GSSHSGSVNEYLATLDSVQPLDDLSASVYSNFGVSSSFSFKP   441
YDR329C_Y55   400   GSSHSGSVNEYLATLDSVQPLDDLSASVYSNFGVSSSFSFKP   441
YDR329C_YJM269   400   GSSHSGSVNEYLATLDSVQPLDDLSASVYSNFGVSSSFSFKP   441
YDR329C_YJM339   400   GSSHSGSVNEYLATLDSVQPLDDLSASVYSNFGVSSSFSFKP   441
YDR329C_YJM789   400   GSSHSGSVNEYLATLDSVQPLDDLSASVYSNFGVSSSFSFKP   441
YDR329C_YPH499   400   GSSHSGSVNEYLATLDSVQPLDDLSASVYSNFGVSSSFSFKP   441
YDR329C_YPS128   400   GSSHSGSVNEYLATLDSVQPLDDLSASVYSNFGVSSSFSFKP   441
YDR329C_ZTW1   400   GSSHSGSVNEYLATLDSVQPLDDLSASVYSNFGVSSSFSFKP   441
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YDR329C_S288C from SGD:

YDR329C_S288C [source=SGD]  Length: 442  Wed Sep 20 11:56:40 2017  Type: P  Check: 1972  ..

       1  MAPNQRSRSL LQRHRGKVLI SLTGIAALFT TGSVVVFFVK RWLYKQQLRI

      51  TEQHFIKEQI KRRFEQTQED SLYTIYELLP VWRMVLNEND LNLDSIVTQL

     101  KDQKNQLTRA KSSESRESSP LKSKAELWNE LELKSLIKLV TVTYTVSSLI

     151  LLTRLQLNIL TRNEYLDSAI KLTMQQENCN KLQNRFYNWV TSWWSDPEDK

     201  ADDAMVMAAK KSKKEGQEVY INEQAFLSLS WWILNKGWLS YNEIITNQIE

     251  IEFDGIHPRD TLTLEEFSSR LTNIFRNTNS QIFQQNNNNL TSILLPKDSS

     301  GQEFLLSQTL DADALTSFHS NTLVFNQLVN ELTQCIESTA TSIVLESLIN

     351  ESFHFIMNKV GIKTIAKKKP GQEDQQQYQM AVFAMSMKDC CQEMLQTTAG

     401  SSHSGSVNEY LATLDSVQPL DDLSASVYSN FGVSSSFSFK P*


Protein Sequence for YDR329C_AWRI796 from AWRI:

YDR329C_AWRI796 [source=AWRI]  Length: 360  Wed Sep 20 11:56:40 2017  Type: P  Check: 6151  ..

       1  MVLNENDLNL DSIVTQLKDQ KNQLTRAKSS ESRESSPLKS KAELWNELEL

      51  KSLIKLVTVT YTVSSLILLT RLQLNILTRN EYLDSAIKLT MQQENCNKLQ

     101  NRFYNWVTSW WSDPEDKADD AMVMAAKKSK KEGQEVYINE QAFLSLSWWI

     151  LNKGWLSYNE IITNQIEIEF DGIHPRDTLT LEEFSSRLTN IFRNTNSQIF

     201  QQNNNNLTSI LLPKDSSGQE FLLSQTLDAD ALTSFHSNTL VFNQLVNELT

     251  QCIESTATSI VLESLINESF HFIMNKGRHK DNSQEKNLGQ EDQQQYQMAV

     301  FAMSMKDCCQ EMLQTTAGSS HSGSVNEYLA TLDSVQPLDD LSASVYSNFG

     351  VSSSFSFKP*

Protein Sequence for YDR329C_BY4741 from Stanford:

YDR329C_BY4741 [source=Stanford]  Length: 442  Wed Sep 20 11:56:40 2017  Type: P  Check: 1972  ..

       1  MAPNQRSRSL LQRHRGKVLI SLTGIAALFT TGSVVVFFVK RWLYKQQLRI

      51  TEQHFIKEQI KRRFEQTQED SLYTIYELLP VWRMVLNEND LNLDSIVTQL

     101  KDQKNQLTRA KSSESRESSP LKSKAELWNE LELKSLIKLV TVTYTVSSLI

     151  LLTRLQLNIL TRNEYLDSAI KLTMQQENCN KLQNRFYNWV TSWWSDPEDK

     201  ADDAMVMAAK KSKKEGQEVY INEQAFLSLS WWILNKGWLS YNEIITNQIE

     251  IEFDGIHPRD TLTLEEFSSR LTNIFRNTNS QIFQQNNNNL TSILLPKDSS

     301  GQEFLLSQTL DADALTSFHS NTLVFNQLVN ELTQCIESTA TSIVLESLIN

     351  ESFHFIMNKV GIKTIAKKKP GQEDQQQYQM AVFAMSMKDC CQEMLQTTAG

     401  SSHSGSVNEY LATLDSVQPL DDLSASVYSN FGVSSSFSFK P*


Protein Sequence for YDR329C_BY4742 from Stanford:

YDR329C_BY4742 [source=Stanford]  Length: 442  Wed Sep 20 11:56:40 2017  Type: P  Check: 1972  ..

       1  MAPNQRSRSL LQRHRGKVLI SLTGIAALFT TGSVVVFFVK RWLYKQQLRI

      51  TEQHFIKEQI KRRFEQTQED SLYTIYELLP VWRMVLNEND LNLDSIVTQL

     101  KDQKNQLTRA KSSESRESSP LKSKAELWNE LELKSLIKLV TVTYTVSSLI

     151  LLTRLQLNIL TRNEYLDSAI KLTMQQENCN KLQNRFYNWV TSWWSDPEDK

     201  ADDAMVMAAK KSKKEGQEVY INEQAFLSLS WWILNKGWLS YNEIITNQIE

     251  IEFDGIHPRD TLTLEEFSSR LTNIFRNTNS QIFQQNNNNL TSILLPKDSS

     301  GQEFLLSQTL DADALTSFHS NTLVFNQLVN ELTQCIESTA TSIVLESLIN

     351  ESFHFIMNKV GIKTIAKKKP GQEDQQQYQM AVFAMSMKDC CQEMLQTTAG

     401  SSHSGSVNEY LATLDSVQPL DDLSASVYSN FGVSSSFSFK P*


Protein Sequence for YDR329C_CEN.PK from Stanford:

YDR329C_CEN.PK [source=Stanford]  Length: 442  Wed Sep 20 11:56:40 2017  Type: P  Check: 1972  ..

       1  MAPNQRSRSL LQRHRGKVLI SLTGIAALFT TGSVVVFFVK RWLYKQQLRI

      51  TEQHFIKEQI KRRFEQTQED SLYTIYELLP VWRMVLNEND LNLDSIVTQL

     101  KDQKNQLTRA KSSESRESSP LKSKAELWNE LELKSLIKLV TVTYTVSSLI

     151  LLTRLQLNIL TRNEYLDSAI KLTMQQENCN KLQNRFYNWV TSWWSDPEDK

     201  ADDAMVMAAK KSKKEGQEVY INEQAFLSLS WWILNKGWLS YNEIITNQIE

     251  IEFDGIHPRD TLTLEEFSSR LTNIFRNTNS QIFQQNNNNL TSILLPKDSS

     301  GQEFLLSQTL DADALTSFHS NTLVFNQLVN ELTQCIESTA TSIVLESLIN

     351  ESFHFIMNKV GIKTIAKKKP GQEDQQQYQM AVFAMSMKDC CQEMLQTTAG

     401  SSHSGSVNEY LATLDSVQPL DDLSASVYSN FGVSSSFSFK P*


Protein Sequence for YDR329C_CLIB324 from WashU:

YDR329C_CLIB324 [source=WashU]  Length: 442  Wed Sep 20 11:56:40 2017  Type: P  Check: 1792  ..

       1  MAPNQRSRSL LQRHRGKLLI SLTGIAALFT TGSVVVFFVK RWLYKQQLRI

      51  TEQHFIKEQI KRRFEQTQED SLYTIYELLP VWRMVLNEND LNLDSIVTQL

     101  KDQKNQLTRA KSSESRESSP LKSKAELWNE LELKSLIKLV TVTYTVSSLI

     151  LLTRLQLNIL TRNEYLDSAI KLTMQQENCN KLQNRFYNWV TSWWSDPEDK

     201  ADDAMVMAAK KSKKEGQEVY INEQAFLSLS WWILNKGWLS YNEIITNQIE

     251  IEFDGIHPRD TLTLEEFSSR LTNIFRNTNS QIFQQNNNNL TSILLPKDSS

     301  GQEFLLSQTL DADALTSFHS NTLVFNQLVN ELTQCIESTA TSIVLESLIN

     351  ESFHFIMNKV GIKTIAKKKP GQEDQQQYQM AVFAMSMKDC CQEMLQTTAG

     401  SSHSGSVNEY LATLDSVQPL DDLSASVYSN FGVSSSFSFK P*


Protein Sequence for YDR329C_D273-10B from Stanford:

YDR329C_D273-10B [source=Stanford]  Length: 442  Wed Sep 20 11:56:40 2017  Type: P  Check: 1972  ..

       1  MAPNQRSRSL LQRHRGKVLI SLTGIAALFT TGSVVVFFVK RWLYKQQLRI

      51  TEQHFIKEQI KRRFEQTQED SLYTIYELLP VWRMVLNEND LNLDSIVTQL

     101  KDQKNQLTRA KSSESRESSP LKSKAELWNE LELKSLIKLV TVTYTVSSLI

     151  LLTRLQLNIL TRNEYLDSAI KLTMQQENCN KLQNRFYNWV TSWWSDPEDK

     201  ADDAMVMAAK KSKKEGQEVY INEQAFLSLS WWILNKGWLS YNEIITNQIE

     251  IEFDGIHPRD TLTLEEFSSR LTNIFRNTNS QIFQQNNNNL TSILLPKDSS

     301  GQEFLLSQTL DADALTSFHS NTLVFNQLVN ELTQCIESTA TSIVLESLIN

     351  ESFHFIMNKV GIKTIAKKKP GQEDQQQYQM AVFAMSMKDC CQEMLQTTAG

     401  SSHSGSVNEY LATLDSVQPL DDLSASVYSN FGVSSSFSFK P*


Protein Sequence for YDR329C_DBVPG6044 from Stanford:

YDR329C_DBVPG6044 [source=Stanford]  Length: 442  Wed Sep 20 11:56:40 2017  Type: P  Check: 1792  ..

       1  MAPNQRSRSL LQRHRGKLLI SLTGIAALFT TGSVVVFFVK RWLYKQQLRI

      51  TEQHFIKEQI KRRFEQTQED SLYTIYELLP VWRMVLNEND LNLDSIVTQL

     101  KDQKNQLTRA KSSESRESSP LKSKAELWNE LELKSLIKLV TVTYTVSSLI

     151  LLTRLQLNIL TRNEYLDSAI KLTMQQENCN KLQNRFYNWV TSWWSDPEDK

     201  ADDAMVMAAK KSKKEGQEVY INEQAFLSLS WWILNKGWLS YNEIITNQIE

     251  IEFDGIHPRD TLTLEEFSSR LTNIFRNTNS QIFQQNNNNL TSILLPKDSS

     301  GQEFLLSQTL DADALTSFHS NTLVFNQLVN ELTQCIESTA TSIVLESLIN

     351  ESFHFIMNKV GIKTIAKKKP GQEDQQQYQM AVFAMSMKDC CQEMLQTTAG

     401  SSHSGSVNEY LATLDSVQPL DDLSASVYSN FGVSSSFSFK P*


Protein Sequence for YDR329C_EC1118 from Genoscope:

YDR329C_EC1118 [source=Genoscope]  Length: 442  Wed Sep 20 11:56:40 2017  Type: P  Check: 1624  ..

       1  MAPNQRSRSL LQRHRGKLLI SLTGIAALFT TGSVVVFFVK RWLYKQQLRI

      51  TEQHFIKEQI KRRFEQTQED SLYTIYELLP VWRMVLNEND LNLDSIVTQL

     101  KDQKNQLTRA KSSESRESSP LKSKAELWNE LELKSLIKLV TVTYTVSSLI

     151  LLTRLQLNIL TRNEYLDSAI KLTMQQENCN KLQNRFYNWV TSWWSDPEDK

     201  ADDAMVMAAK KSKKEGQEVY INEQAFISLS WWILNKGWLS YNEIITNQIE

     251  IEFDGIHPRD TLTLEEFSSR LTNIFRNTNS QIFQQNNNNL TSILLPKDSS

     301  GQEFLLSQTL DADALTSFHS NTLVFNQLVN ELTQCIESTA TSIVLESLIN

     351  ESFHFIMNKV GIKTIAKKKP GQEDQQQYQM AVFAMSMKDC CQEMLQTTAG

     401  SSHSGSVNEY LATLDSVQPL DDLSASVYSN FGVSSSFSFK P*


Protein Sequence for YDR329C_EC9-8 from ASinica:

YDR329C_EC9-8 [source=ASinica]  Length: 442  Wed Sep 20 11:56:40 2017  Type: P  Check: 1792  ..

       1  MAPNQRSRSL LQRHRGKLLI SLTGIAALFT TGSVVVFFVK RWLYKQQLRI

      51  TEQHFIKEQI KRRFEQTQED SLYTIYELLP VWRMVLNEND LNLDSIVTQL

     101  KDQKNQLTRA KSSESRESSP LKSKAELWNE LELKSLIKLV TVTYTVSSLI

     151  LLTRLQLNIL TRNEYLDSAI KLTMQQENCN KLQNRFYNWV TSWWSDPEDK

     201  ADDAMVMAAK KSKKEGQEVY INEQAFLSLS WWILNKGWLS YNEIITNQIE

     251  IEFDGIHPRD TLTLEEFSSR LTNIFRNTNS QIFQQNNNNL TSILLPKDSS

     301  GQEFLLSQTL DADALTSFHS NTLVFNQLVN ELTQCIESTA TSIVLESLIN

     351  ESFHFIMNKV GIKTIAKKKP GQEDQQQYQM AVFAMSMKDC CQEMLQTTAG

     401  SSHSGSVNEY LATLDSVQPL DDLSASVYSN FGVSSSFSFK P*


Protein Sequence for YDR329C_FL100 from Stanford:

YDR329C_FL100 [source=Stanford]  Length: 442  Wed Sep 20 11:56:40 2017  Type: P  Check: 1972  ..

       1  MAPNQRSRSL LQRHRGKVLI SLTGIAALFT TGSVVVFFVK RWLYKQQLRI

      51  TEQHFIKEQI KRRFEQTQED SLYTIYELLP VWRMVLNEND LNLDSIVTQL

     101  KDQKNQLTRA KSSESRESSP LKSKAELWNE LELKSLIKLV TVTYTVSSLI

     151  LLTRLQLNIL TRNEYLDSAI KLTMQQENCN KLQNRFYNWV TSWWSDPEDK

     201  ADDAMVMAAK KSKKEGQEVY INEQAFLSLS WWILNKGWLS YNEIITNQIE

     251  IEFDGIHPRD TLTLEEFSSR LTNIFRNTNS QIFQQNNNNL TSILLPKDSS

     301  GQEFLLSQTL DADALTSFHS NTLVFNQLVN ELTQCIESTA TSIVLESLIN

     351  ESFHFIMNKV GIKTIAKKKP GQEDQQQYQM AVFAMSMKDC CQEMLQTTAG

     401  SSHSGSVNEY LATLDSVQPL DDLSASVYSN FGVSSSFSFK P*


Protein Sequence for YDR329C_FY1679 from Stanford:

YDR329C_FY1679 [source=Stanford]  Length: 442  Wed Sep 20 11:56:40 2017  Type: P  Check: 1972  ..

       1  MAPNQRSRSL LQRHRGKVLI SLTGIAALFT TGSVVVFFVK RWLYKQQLRI

      51  TEQHFIKEQI KRRFEQTQED SLYTIYELLP VWRMVLNEND LNLDSIVTQL

     101  KDQKNQLTRA KSSESRESSP LKSKAELWNE LELKSLIKLV TVTYTVSSLI

     151  LLTRLQLNIL TRNEYLDSAI KLTMQQENCN KLQNRFYNWV TSWWSDPEDK

     201  ADDAMVMAAK KSKKEGQEVY INEQAFLSLS WWILNKGWLS YNEIITNQIE

     251  IEFDGIHPRD TLTLEEFSSR LTNIFRNTNS QIFQQNNNNL TSILLPKDSS

     301  GQEFLLSQTL DADALTSFHS NTLVFNQLVN ELTQCIESTA TSIVLESLIN

     351  ESFHFIMNKV GIKTIAKKKP GQEDQQQYQM AVFAMSMKDC CQEMLQTTAG

     401  SSHSGSVNEY LATLDSVQPL DDLSASVYSN FGVSSSFSFK P*


Protein Sequence for YDR329C_FostersB from AWRI:

YDR329C_FostersB [source=AWRI]  Length: 222  Wed Sep 20 11:56:40 2017  Type: P  Check: 6490  ..

       1  MAPNQRSRSL LQRHRGKLLI SLTGIAALFT TGSVVVFFVK RWLYKQQLRI

      51  TEQHFIKEQI KRRFEQTQED SLYTIYELLP VWRMVLNEND LNLDSIVTQL

     101  KDQKNQLTRA KSSESRESSP LKSKAELWNE LELKSLIKLV TVTYTVSSLI

     151  LLTRLQLNIL TRNEYLDSAI KLTMQQENCN KLQNRFYNWV TSWWSDPEDK

     201  ADDAMVMAXK KVKERRPGSV Y*

Protein Sequence for YDR329C_FostersO from AWRI:

YDR329C_FostersO [source=AWRI]  Length: 442  Wed Sep 20 11:56:40 2017  Type: P  Check: 5530  ..

       1  MAPNQRSRSL LQRHRGKLLI SLTGIAALFT TGSVVVFFVK RWLYKQQLXI

      51  TEQHFIKEQI KRRFEQTQED SLYTIYELLP VWRMVLNEND LNLDSIVTQL

     101  KDQKNQLTRA KSSESRESSP LKSKAELWNE LELKSLIKLV TVTYTVSSLI

     151  LLTRLQLNIL TRNEYLDSAI KXTMQQENCN KLQNRFYNWV TSWWSDPEDK

     201  ADDAMVMAAK KSKKEGQEVY INEQXFLSLS WWILNKGWLS YNEIITNQIE

     251  IEFDGIHPRD TLTLEEFSSR LTNIFRNTNS QIFQQNNNNL TSILLPKDSS

     301  GQEFLLSQTL DADALTSFHS NTLVFNQLVN ELTQCIESTA TXIVLESLIN

     351  ESFHFIMNKV GIKTIAKKKX GQEDQQQYQM AVFAMSMKDC CQEMLQTTXG

     401  SSHSGSVNEY LATXDSVQPL DXLSAIVYSN FGVSSSFSFK P*


Protein Sequence for YDR329C_JAY291 from Duke:

YDR329C_JAY291 [source=Duke]  Length: 442  Wed Sep 20 11:56:40 2017  Type: P  Check: 1792  ..

       1  MAPNQRSRSL LQRHRGKLLI SLTGIAALFT TGSVVVFFVK RWLYKQQLRI

      51  TEQHFIKEQI KRRFEQTQED SLYTIYELLP VWRMVLNEND LNLDSIVTQL

     101  KDQKNQLTRA KSSESRESSP LKSKAELWNE LELKSLIKLV TVTYTVSSLI

     151  LLTRLQLNIL TRNEYLDSAI KLTMQQENCN KLQNRFYNWV TSWWSDPEDK

     201  ADDAMVMAAK KSKKEGQEVY INEQAFLSLS WWILNKGWLS YNEIITNQIE

     251  IEFDGIHPRD TLTLEEFSSR LTNIFRNTNS QIFQQNNNNL TSILLPKDSS

     301  GQEFLLSQTL DADALTSFHS NTLVFNQLVN ELTQCIESTA TSIVLESLIN

     351  ESFHFIMNKV GIKTIAKKKP GQEDQQQYQM AVFAMSMKDC CQEMLQTTAG

     401  SSHSGSVNEY LATLDSVQPL DDLSASVYSN FGVSSSFSFK P*


Protein Sequence for YDR329C_JK9-3d from Stanford:

YDR329C_JK9-3d [source=Stanford]  Length: 442  Wed Sep 20 11:56:40 2017  Type: P  Check: 1972  ..

       1  MAPNQRSRSL LQRHRGKVLI SLTGIAALFT TGSVVVFFVK RWLYKQQLRI

      51  TEQHFIKEQI KRRFEQTQED SLYTIYELLP VWRMVLNEND LNLDSIVTQL

     101  KDQKNQLTRA KSSESRESSP LKSKAELWNE LELKSLIKLV TVTYTVSSLI

     151  LLTRLQLNIL TRNEYLDSAI KLTMQQENCN KLQNRFYNWV TSWWSDPEDK

     201  ADDAMVMAAK KSKKEGQEVY INEQAFLSLS WWILNKGWLS YNEIITNQIE

     251  IEFDGIHPRD TLTLEEFSSR LTNIFRNTNS QIFQQNNNNL TSILLPKDSS

     301  GQEFLLSQTL DADALTSFHS NTLVFNQLVN ELTQCIESTA TSIVLESLIN

     351  ESFHFIMNKV GIKTIAKKKP GQEDQQQYQM AVFAMSMKDC CQEMLQTTAG

     401  SSHSGSVNEY LATLDSVQPL DDLSASVYSN FGVSSSFSFK P*


Protein Sequence for YDR329C_K11 from Stanford:

YDR329C_K11 [source=Stanford]  Length: 442  Wed Sep 20 11:56:40 2017  Type: P  Check: 2495  ..

       1  MAPNQRSRSL LQRHRGKLLI SLTGIAALFT TGSVVVFFVK RWLYKQQLRI

      51  TEQHFIKEQI KRRFEQTQED SLYTIYELLP VWRMVLNEND LNLDSIVTQL

     101  KDQKNQLTRA KSSESRESSP LKSKAELWNE LELKSLIKLV TVTYTVSSLI

     151  LLTRLQLNIL TRNEYLDSAI KLTMQQENCN KLQNRFYNWV TSWWSDPEDK

     201  ADDAMVMTAK KSKKEGQEVY INEQAFLSLS WWILNKGWLS YNEIITNQIE

     251  IEFDGIHPRD TLTLEEFSSR LTNIFRNTNS QIFQQNNNNL TSILLPKDSS

     301  GQEFLLSQTL DADALTSFHS NTLVFNQLVN ELTQCIESTA TSIVLESLIN

     351  ESFHFIMNKV GIKTIAKKKP GQEDQQQYQM AVFAMSMKDC CQEMLQTTAG

     401  SSHSGSVNEY LATLDSVQPL DDLSASVYSN FGVSSSFSFK P*


Protein Sequence for YDR329C_Kyokai7 from NRIB:

YDR329C_Kyokai7 [source=NRIB]  Length: 442  Wed Sep 20 11:56:40 2017  Type: P  Check: 2495  ..

       1  MAPNQRSRSL LQRHRGKLLI SLTGIAALFT TGSVVVFFVK RWLYKQQLRI

      51  TEQHFIKEQI KRRFEQTQED SLYTIYELLP VWRMVLNEND LNLDSIVTQL

     101  KDQKNQLTRA KSSESRESSP LKSKAELWNE LELKSLIKLV TVTYTVSSLI

     151  LLTRLQLNIL TRNEYLDSAI KLTMQQENCN KLQNRFYNWV TSWWSDPEDK

     201  ADDAMVMTAK KSKKEGQEVY INEQAFLSLS WWILNKGWLS YNEIITNQIE

     251  IEFDGIHPRD TLTLEEFSSR LTNIFRNTNS QIFQQNNNNL TSILLPKDSS

     301  GQEFLLSQTL DADALTSFHS NTLVFNQLVN ELTQCIESTA TSIVLESLIN

     351  ESFHFIMNKV GIKTIAKKKP GQEDQQQYQM AVFAMSMKDC CQEMLQTTAG

     401  SSHSGSVNEY LATLDSVQPL DDLSASVYSN FGVSSSFSFK P*


Protein Sequence for YDR329C_L1528 from Stanford:

YDR329C_L1528 [source=Stanford]  Length: 442  Wed Sep 20 11:56:40 2017  Type: P  Check: 1792  ..

       1  MAPNQRSRSL LQRHRGKLLI SLTGIAALFT TGSVVVFFVK RWLYKQQLRI

      51  TEQHFIKEQI KRRFEQTQED SLYTIYELLP VWRMVLNEND LNLDSIVTQL

     101  KDQKNQLTRA KSSESRESSP LKSKAELWNE LELKSLIKLV TVTYTVSSLI

     151  LLTRLQLNIL TRNEYLDSAI KLTMQQENCN KLQNRFYNWV TSWWSDPEDK

     201  ADDAMVMAAK KSKKEGQEVY INEQAFLSLS WWILNKGWLS YNEIITNQIE

     251  IEFDGIHPRD TLTLEEFSSR LTNIFRNTNS QIFQQNNNNL TSILLPKDSS

     301  GQEFLLSQTL DADALTSFHS NTLVFNQLVN ELTQCIESTA TSIVLESLIN

     351  ESFHFIMNKV GIKTIAKKKP GQEDQQQYQM AVFAMSMKDC CQEMLQTTAG

     401  SSHSGSVNEY LATLDSVQPL DDLSASVYSN FGVSSSFSFK P*


Protein Sequence for YDR329C_LalvinQA23 from AWRI:

YDR329C_LalvinQA23 [source=AWRI]  Length: 235  Wed Sep 20 11:56:40 2017  Type: P  Check: 2842  ..

       1  MAPNQRSRSL LQRHRGKLLI SLTGIAALFT TGSVVVFFVK RWLYKQQLRI

      51  TEQHFIKEQI KRRFEQTQED SLYTIYELLP VWRMVLNEND LNLDSIVTQL

     101  KDQKNQLTRA KSSESRESSP LKSKAELWNE LELKSLIKLV TVTYTVSSLI

     151  LLTRLQLNIL TRNEYLDSAI KLTMQQENCN KLQNRFYNWV TSWWSDPEDK

     201  ADDAMVMAAK KSKKEGQEVY INEQAFXSLS WVDS*

Protein Sequence for YDR329C_PW5 from WashU:

YDR329C_PW5 [source=WashU]  Length: 442  Wed Sep 20 11:56:40 2017  Type: P  Check: 1492  ..

       1  MAPNQRSRSL LQRHRGKLLI SLTGIAALFT TGSVVVFFVK RWLYKQQLRI

      51  TEQHFIKEQI KRRFEQTQED SLYTIYELLP VWRMVLNEND LNLDSIVTQL

     101  KDQKNQFTRA KSSESRESSP LKSKAELWNE LELKSLIKLV TVTYTVSSLI

     151  LLTRLQLNIL TRNEYLDSAI KLTMQQENCN KLQNRFYNWV TSWWSDPEDK

     201  ADDAMVMAAK KSKKEGQEVY INEQAFLSLS WWILNKGWLS YNEIITNQIE

     251  IEFDGIHPRD TLTLEEFSSR LTNIFRNTNS QIFQQNNNNL TSILLPKDSS

     301  GQEFLLSQTL DADALTSFHS NTLVFNQLVN ELTQCIESTA TSIVLESLIN

     351  ESFHFIMNKV GIKTIAKKKP GQEDQQQYQM AVFAMSMKDC CQEMLQTTAG

     401  SSHSGSVNEY LATLDSVQPL DDLSASVYSN FGVSSSFSFK P*


Protein Sequence for YDR329C_RM11-1a from Stanford:

YDR329C_RM11-1a [source=Stanford]  Length: 442  Wed Sep 20 11:56:40 2017  Type: P  Check: 1792  ..

       1  MAPNQRSRSL LQRHRGKLLI SLTGIAALFT TGSVVVFFVK RWLYKQQLRI

      51  TEQHFIKEQI KRRFEQTQED SLYTIYELLP VWRMVLNEND LNLDSIVTQL

     101  KDQKNQLTRA KSSESRESSP LKSKAELWNE LELKSLIKLV TVTYTVSSLI

     151  LLTRLQLNIL TRNEYLDSAI KLTMQQENCN KLQNRFYNWV TSWWSDPEDK

     201  ADDAMVMAAK KSKKEGQEVY INEQAFLSLS WWILNKGWLS YNEIITNQIE

     251  IEFDGIHPRD TLTLEEFSSR LTNIFRNTNS QIFQQNNNNL TSILLPKDSS

     301  GQEFLLSQTL DADALTSFHS NTLVFNQLVN ELTQCIESTA TSIVLESLIN

     351  ESFHFIMNKV GIKTIAKKKP GQEDQQQYQM AVFAMSMKDC CQEMLQTTAG

     401  SSHSGSVNEY LATLDSVQPL DDLSASVYSN FGVSSSFSFK P*


Protein Sequence for YDR329C_RedStar from Stanford:

YDR329C_RedStar [source=Stanford]  Length: 442  Wed Sep 20 11:56:40 2017  Type: P  Check: 1792  ..

       1  MAPNQRSRSL LQRHRGKLLI SLTGIAALFT TGSVVVFFVK RWLYKQQLRI

      51  TEQHFIKEQI KRRFEQTQED SLYTIYELLP VWRMVLNEND LNLDSIVTQL

     101  KDQKNQLTRA KSSESRESSP LKSKAELWNE LELKSLIKLV TVTYTVSSLI

     151  LLTRLQLNIL TRNEYLDSAI KLTMQQENCN KLQNRFYNWV TSWWSDPEDK

     201  ADDAMVMAAK KSKKEGQEVY INEQAFLSLS WWILNKGWLS YNEIITNQIE

     251  IEFDGIHPRD TLTLEEFSSR LTNIFRNTNS QIFQQNNNNL TSILLPKDSS

     301  GQEFLLSQTL DADALTSFHS NTLVFNQLVN ELTQCIESTA TSIVLESLIN

     351  ESFHFIMNKV GIKTIAKKKP GQEDQQQYQM AVFAMSMKDC CQEMLQTTAG

     401  SSHSGSVNEY LATLDSVQPL DDLSASVYSN FGVSSSFSFK P*


Protein Sequence for YDR329C_SEY6210 from Stanford:

YDR329C_SEY6210 [source=Stanford]  Length: 442  Wed Sep 20 11:56:40 2017  Type: P  Check: 1972  ..

       1  MAPNQRSRSL LQRHRGKVLI SLTGIAALFT TGSVVVFFVK RWLYKQQLRI

      51  TEQHFIKEQI KRRFEQTQED SLYTIYELLP VWRMVLNEND LNLDSIVTQL

     101  KDQKNQLTRA KSSESRESSP LKSKAELWNE LELKSLIKLV TVTYTVSSLI

     151  LLTRLQLNIL TRNEYLDSAI KLTMQQENCN KLQNRFYNWV TSWWSDPEDK

     201  ADDAMVMAAK KSKKEGQEVY INEQAFLSLS WWILNKGWLS YNEIITNQIE

     251  IEFDGIHPRD TLTLEEFSSR LTNIFRNTNS QIFQQNNNNL TSILLPKDSS

     301  GQEFLLSQTL DADALTSFHS NTLVFNQLVN ELTQCIESTA TSIVLESLIN

     351  ESFHFIMNKV GIKTIAKKKP GQEDQQQYQM AVFAMSMKDC CQEMLQTTAG

     401  SSHSGSVNEY LATLDSVQPL DDLSASVYSN FGVSSSFSFK P*


Protein Sequence for YDR329C_SK1 from Stanford:

YDR329C_SK1 [source=Stanford]  Length: 442  Wed Sep 20 11:56:40 2017  Type: P  Check: 1792  ..

       1  MAPNQRSRSL LQRHRGKLLI SLTGIAALFT TGSVVVFFVK RWLYKQQLRI

      51  TEQHFIKEQI KRRFEQTQED SLYTIYELLP VWRMVLNEND LNLDSIVTQL

     101  KDQKNQLTRA KSSESRESSP LKSKAELWNE LELKSLIKLV TVTYTVSSLI

     151  LLTRLQLNIL TRNEYLDSAI KLTMQQENCN KLQNRFYNWV TSWWSDPEDK

     201  ADDAMVMAAK KSKKEGQEVY INEQAFLSLS WWILNKGWLS YNEIITNQIE

     251  IEFDGIHPRD TLTLEEFSSR LTNIFRNTNS QIFQQNNNNL TSILLPKDSS

     301  GQEFLLSQTL DADALTSFHS NTLVFNQLVN ELTQCIESTA TSIVLESLIN

     351  ESFHFIMNKV GIKTIAKKKP GQEDQQQYQM AVFAMSMKDC CQEMLQTTAG

     401  SSHSGSVNEY LATLDSVQPL DDLSASVYSN FGVSSSFSFK P*


Protein Sequence for YDR329C_T7 from WashU:

YDR329C_T7 [source=WashU]  Length: 442  Wed Sep 20 11:56:40 2017  Type: P  Check: 2569  ..

       1  MAPNQRSRSL LQRHRGKLLI SLTGIAALFT TGSVVVFFVK RWLYKQQLRI

      51  TEQHFIKEQI KRRFEQTQED SLYTIYELLP VWRMVLNEND LNLDSIVTQL

     101  KDQKNQLTRA KSSESRESSP LKSKAELWNE LELKSLIKLV TVTYTVSSLI

     151  LLTRLQLNIL TRNEYLDSAI KLTMQQENCN KLQNRFYNWV TSWWSDPEDK

     201  ADDAMVMVAK KSKKEGQEVY INEQAFLSLS WWILNKGWLS YNEIITNQIE

     251  IEFDGIHPRD TLTLEEFSSR LTNIFRNTNS QIFQQNNNNL TSILLPKDSS

     301  GQEFLLSQTL DADALTSFHS NTLVFNQLVN ELTQCIESTA TSIVLESLIN

     351  ESFHFIMNKV GIKTIAKKKP GQEDQQQYQM AVFAMSMKDC CQEMLQTTAG

     401  SSHSGSVNEY LATLDSVQPL DDLSASVYSN FGVSSSFSFK P*


Protein Sequence for YDR329C_UWOPS05_217_3 from Stanford:

YDR329C_UWOPS05_217_3 [source=Stanford]  Length: 442  Wed Sep 20 11:56:40 2017  Type: P  Check: 2916  ..

       1  MAPNQRSRSL LQRHRGKLLI SLTGIAALFT TGSVVVFFVK RWLYKQQLRI

      51  TEQHFIKEQI KRRFEQTQED SLYTIYELLP VWRMVLNEND LNLDSIVTQL

     101  KDQKNQLTRA KSSESRESSP LKSKAELWNE LELKSLIKLV TVTYTVSSLI

     151  LLTRLQLNIL TRNEYLDSAI KLTMQQENCN KLQNRFYNWV TSWWSDPEDK

     201  ADDAMVVAAK KSKKEGQEVY INEQAFLSLS WWILNKGWLS YNEIITNQIE

     251  IEFDGIHPRD TLTLEEFSSR LTNIFRNTNS QIFQQNNNNL TSILLPKDSS

     301  GQEFLLSQTL DADALTSFHS NTLVFNQLVN ELTQSIESTA TSIVLESLIN

     351  ESFHFIMNKV GIKTIAKKKP GQEDQQQYQM AVFAMSMKDC CQEMLQTTAG

     401  SSHSGSVNEY LATLDSVQPL DDLSASVYSN FGVSSSFSFK P*


Protein Sequence for YDR329C_VL3 from AWRI:

YDR329C_VL3 [source=AWRI]  Length: 404  Wed Sep 20 11:56:40 2017  Type: P  Check: 3472  ..

       1  MAPNQRSRSL LQRHRGKLLI SLTGIAALFT TGSVVVFFVK RWLYKQQLRI

      51  TEQHFIKEQI KRRFEQTQED SLYTIYELLP VWRMVLNEND LNLDSIVTQL

     101  KDQKNQLTRA KSSESRESSP LKSKAELWNE LELKSLIKLV TVTYTVSSLI

     151  LLTRLQLNIL TRNEYLDSAI KLTMQQENCN KLQNRFYNWV TSWWSDPEDK

     201  ADDAMVMAAK KSKKEGQEVY INEQAFLSLS WWILNKGWLS YNEIITNQIE

     251  IEFDGIHPRD TLTLEEFSSR LTNIFRNTNS QIFQQNNNNL TSILLPKDSS

     301  GQEFLLSQTL DADALTSFHS NTLVFNQLVN ELTQCIESTA TSIVLESLIN

     351  ESFHFIMNKV GIKTIAKKKT WPRRSATVSN GSFRYVDERL LPRNASNNCR

     401  VFP*

Protein Sequence for YDR329C_Vin13 from AWRI:

YDR329C_Vin13 [source=AWRI]  Length: 269  Wed Sep 20 11:56:40 2017  Type: P  Check: 1683  ..

       1  MQQENCNKLQ NRFYNWVTSW WSDPEDKADD AMVMAAKKSK KEGQEVYINE

      51  QAFXSLSWWI LNKGWLSYNE IITNQIEIEF DGIHPRDTLT LEEFSSRLTN

     101  IFRNTNSQIF QQNNNNLTSI LLPKDSSGQE FLLSQTLDAD ALTSFHSNTL

     151  VFNQLVNELT QCIESTATSI VLESLINESF HFIMNKVGIK TIAKKKPGQE

     201  DQQQYQMAVF AMSMKDCCQE MLQTTAGSSH SGSVNEYLAT LDSVQPLDDL

     251  SASVYSNFGV SSSFSFKP*

Protein Sequence for YDR329C_W303 from Stanford:

YDR329C_W303 [source=Stanford]  Length: 442  Wed Sep 20 11:56:40 2017  Type: P  Check: 1972  ..

       1  MAPNQRSRSL LQRHRGKVLI SLTGIAALFT TGSVVVFFVK RWLYKQQLRI

      51  TEQHFIKEQI KRRFEQTQED SLYTIYELLP VWRMVLNEND LNLDSIVTQL

     101  KDQKNQLTRA KSSESRESSP LKSKAELWNE LELKSLIKLV TVTYTVSSLI

     151  LLTRLQLNIL TRNEYLDSAI KLTMQQENCN KLQNRFYNWV TSWWSDPEDK

     201  ADDAMVMAAK KSKKEGQEVY INEQAFLSLS WWILNKGWLS YNEIITNQIE

     251  IEFDGIHPRD TLTLEEFSSR LTNIFRNTNS QIFQQNNNNL TSILLPKDSS

     301  GQEFLLSQTL DADALTSFHS NTLVFNQLVN ELTQCIESTA TSIVLESLIN

     351  ESFHFIMNKV GIKTIAKKKP GQEDQQQYQM AVFAMSMKDC CQEMLQTTAG

     401  SSHSGSVNEY LATLDSVQPL DDLSASVYSN FGVSSSFSFK P*


Protein Sequence for YDR329C_X2180-1A from Stanford:

YDR329C_X2180-1A [source=Stanford]  Length: 442  Wed Sep 20 11:56:40 2017  Type: P  Check: 1972  ..

       1  MAPNQRSRSL LQRHRGKVLI SLTGIAALFT TGSVVVFFVK RWLYKQQLRI

      51  TEQHFIKEQI KRRFEQTQED SLYTIYELLP VWRMVLNEND LNLDSIVTQL

     101  KDQKNQLTRA KSSESRESSP LKSKAELWNE LELKSLIKLV TVTYTVSSLI

     151  LLTRLQLNIL TRNEYLDSAI KLTMQQENCN KLQNRFYNWV TSWWSDPEDK

     201  ADDAMVMAAK KSKKEGQEVY INEQAFLSLS WWILNKGWLS YNEIITNQIE

     251  IEFDGIHPRD TLTLEEFSSR LTNIFRNTNS QIFQQNNNNL TSILLPKDSS

     301  GQEFLLSQTL DADALTSFHS NTLVFNQLVN ELTQCIESTA TSIVLESLIN

     351  ESFHFIMNKV GIKTIAKKKP GQEDQQQYQM AVFAMSMKDC CQEMLQTTAG

     401  SSHSGSVNEY LATLDSVQPL DDLSASVYSN FGVSSSFSFK P*


Protein Sequence for YDR329C_Y55 from Stanford:

YDR329C_Y55 [source=Stanford]  Length: 442  Wed Sep 20 11:56:40 2017  Type: P  Check: 1792  ..

       1  MAPNQRSRSL LQRHRGKLLI SLTGIAALFT TGSVVVFFVK RWLYKQQLRI

      51  TEQHFIKEQI KRRFEQTQED SLYTIYELLP VWRMVLNEND LNLDSIVTQL

     101  KDQKNQLTRA KSSESRESSP LKSKAELWNE LELKSLIKLV TVTYTVSSLI

     151  LLTRLQLNIL TRNEYLDSAI KLTMQQENCN KLQNRFYNWV TSWWSDPEDK

     201  ADDAMVMAAK KSKKEGQEVY INEQAFLSLS WWILNKGWLS YNEIITNQIE

     251  IEFDGIHPRD TLTLEEFSSR LTNIFRNTNS QIFQQNNNNL TSILLPKDSS

     301  GQEFLLSQTL DADALTSFHS NTLVFNQLVN ELTQCIESTA TSIVLESLIN

     351  ESFHFIMNKV GIKTIAKKKP GQEDQQQYQM AVFAMSMKDC CQEMLQTTAG

     401  SSHSGSVNEY LATLDSVQPL DDLSASVYSN FGVSSSFSFK P*


Protein Sequence for YDR329C_YJM269 from WashU:

YDR329C_YJM269 [source=WashU]  Length: 442  Wed Sep 20 11:56:40 2017  Type: P  Check: 1792  ..

       1  MAPNQRSRSL LQRHRGKLLI SLTGIAALFT TGSVVVFFVK RWLYKQQLRI

      51  TEQHFIKEQI KRRFEQTQED SLYTIYELLP VWRMVLNEND LNLDSIVTQL

     101  KDQKNQLTRA KSSESRESSP LKSKAELWNE LELKSLIKLV TVTYTVSSLI

     151  LLTRLQLNIL TRNEYLDSAI KLTMQQENCN KLQNRFYNWV TSWWSDPEDK

     201  ADDAMVMAAK KSKKEGQEVY INEQAFLSLS WWILNKGWLS YNEIITNQIE

     251  IEFDGIHPRD TLTLEEFSSR LTNIFRNTNS QIFQQNNNNL TSILLPKDSS

     301  GQEFLLSQTL DADALTSFHS NTLVFNQLVN ELTQCIESTA TSIVLESLIN

     351  ESFHFIMNKV GIKTIAKKKP GQEDQQQYQM AVFAMSMKDC CQEMLQTTAG

     401  SSHSGSVNEY LATLDSVQPL DDLSASVYSN FGVSSSFSFK P*


Protein Sequence for YDR329C_YJM339 from Stanford:

YDR329C_YJM339 [source=Stanford]  Length: 442  Wed Sep 20 11:56:40 2017  Type: P  Check: 1792  ..

       1  MAPNQRSRSL LQRHRGKLLI SLTGIAALFT TGSVVVFFVK RWLYKQQLRI

      51  TEQHFIKEQI KRRFEQTQED SLYTIYELLP VWRMVLNEND LNLDSIVTQL

     101  KDQKNQLTRA KSSESRESSP LKSKAELWNE LELKSLIKLV TVTYTVSSLI

     151  LLTRLQLNIL TRNEYLDSAI KLTMQQENCN KLQNRFYNWV TSWWSDPEDK

     201  ADDAMVMAAK KSKKEGQEVY INEQAFLSLS WWILNKGWLS YNEIITNQIE

     251  IEFDGIHPRD TLTLEEFSSR LTNIFRNTNS QIFQQNNNNL TSILLPKDSS

     301  GQEFLLSQTL DADALTSFHS NTLVFNQLVN ELTQCIESTA TSIVLESLIN

     351  ESFHFIMNKV GIKTIAKKKP GQEDQQQYQM AVFAMSMKDC CQEMLQTTAG

     401  SSHSGSVNEY LATLDSVQPL DDLSASVYSN FGVSSSFSFK P*


Protein Sequence for YDR329C_YJM789 from Stanford:

YDR329C_YJM789 [source=Stanford]  Length: 442  Wed Sep 20 11:56:40 2017  Type: P  Check: 1972  ..

       1  MAPNQRSRSL LQRHRGKVLI SLTGIAALFT TGSVVVFFVK RWLYKQQLRI

      51  TEQHFIKEQI KRRFEQTQED SLYTIYELLP VWRMVLNEND LNLDSIVTQL

     101  KDQKNQLTRA KSSESRESSP LKSKAELWNE LELKSLIKLV TVTYTVSSLI

     151  LLTRLQLNIL TRNEYLDSAI KLTMQQENCN KLQNRFYNWV TSWWSDPEDK

     201  ADDAMVMAAK KSKKEGQEVY INEQAFLSLS WWILNKGWLS YNEIITNQIE

     251  IEFDGIHPRD TLTLEEFSSR LTNIFRNTNS QIFQQNNNNL TSILLPKDSS

     301  GQEFLLSQTL DADALTSFHS NTLVFNQLVN ELTQCIESTA TSIVLESLIN

     351  ESFHFIMNKV GIKTIAKKKP GQEDQQQYQM AVFAMSMKDC CQEMLQTTAG

     401  SSHSGSVNEY LATLDSVQPL DDLSASVYSN FGVSSSFSFK P*


Protein Sequence for YDR329C_YPH499 from Stanford:

YDR329C_YPH499 [source=Stanford]  Length: 442  Wed Sep 20 11:56:40 2017  Type: P  Check: 1972  ..

       1  MAPNQRSRSL LQRHRGKVLI SLTGIAALFT TGSVVVFFVK RWLYKQQLRI

      51  TEQHFIKEQI KRRFEQTQED SLYTIYELLP VWRMVLNEND LNLDSIVTQL

     101  KDQKNQLTRA KSSESRESSP LKSKAELWNE LELKSLIKLV TVTYTVSSLI

     151  LLTRLQLNIL TRNEYLDSAI KLTMQQENCN KLQNRFYNWV TSWWSDPEDK

     201  ADDAMVMAAK KSKKEGQEVY INEQAFLSLS WWILNKGWLS YNEIITNQIE

     251  IEFDGIHPRD TLTLEEFSSR LTNIFRNTNS QIFQQNNNNL TSILLPKDSS

     301  GQEFLLSQTL DADALTSFHS NTLVFNQLVN ELTQCIESTA TSIVLESLIN

     351  ESFHFIMNKV GIKTIAKKKP GQEDQQQYQM AVFAMSMKDC CQEMLQTTAG

     401  SSHSGSVNEY LATLDSVQPL DDLSASVYSN FGVSSSFSFK P*


Protein Sequence for YDR329C_YPS128 from Stanford:

YDR329C_YPS128 [source=Stanford]  Length: 442  Wed Sep 20 11:56:40 2017  Type: P  Check: 2342  ..

       1  MAPNQRSRSL LQRHRGKLLI SLTGIAALFT TGSVVVFFVK RWLYKQQLRI

      51  TEQHFIKEQI KRRFEQTQED SLYTIYELLP VWRMVLNEND LNLDSIVTQL

     101  KDQKNQLTRA KSSESRESSP LKSKAELWNE LELKSLIKLV TVTYTVSSLI

     151  LLTRLQLNIL TRNEYLNSAI KLTMQQENCN KLQNRFYNWV TSWWSDPEDK

     201  ADDAMVMAAK KSKKEGQEVY INEQAFLSLS WWILNKGWLS YNEIITNQIE

     251  IEFDGIHPRD TLTLEEFSSR LTNIFRNTNS QIFQQNNNSL TSILLPKDSS

     301  GQEFLLSQTL DADALTSFHS NTLVFNQLVN ELTQCIESTA TSIVLESLIN

     351  ESFHFIMNKV GIKTIAKKKP GQEDQQQYQM AVFAMSMKDC CQEMLQTTAG

     401  SSHSGSVNEY LATLDSVQPL DDLSASVYSN FGVSSSFSFK P*


Protein Sequence for YDR329C_ZTW1 from Zhejiang:

YDR329C_ZTW1 [source=Zhejiang]  Length: 442  Wed Sep 20 11:56:40 2017  Type: P  Check: 1933  ..

       1  MAPNQRSRSL LQRHRGKLLI SLTGIAALFT TGSVVVFFVK RWLYKQQLRI

      51  TEQHFIKEQI KRRFEQTQED SLYTIYELLP VWRMVLNEND LNLDSIVTQL

     101  KDQKNQLTRA KSSESRESSP LKSKAELWNE LELKSLIKLV TVTYTVSSLI

     151  LLTRLQLNIL TRNEYLDSAI KLTMQQENCN KLQNRFYNWV TSWWSDPEDK

     201  ADDAMVMAAK KSKKEGQEVY INEQAFLSLS WWILNKGWLS YNEIITNQIE

     251  IEFDGIHPRD TLTLEEFSSR LTNIFRNTNS QIFQQNNNNL TSILLPKDSS

     301  GQEFLLSQTL DADALTSFHS NTLVFNQLVN ELTQCIESTA TSIVLESLIN

     351  ESFHFIMNKV GIKTIAKKKP GQEDQQQYQM AVFAMSMKGC CQEMLQTTAG

     401  SSHSGSVNEY LATLDSVQPL DDLSASVYSN FGVSSSFSFK P*