BFR2/YDR299W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YDR299W_S288C   1   MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSDYGNSN   50
YDR299W_AWRI1631   1   MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSDYGNSN   50
YDR299W_AWRI796   
   --------------------------------------------------   
YDR299W_BC187   1   -----MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSD   45
YDR299W_BY4741   1   MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSDYGNSN   50
YDR299W_BY4742   1   MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSDYGNSN   50
YDR299W_CBS7960   1   MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSDYGNSN   50
YDR299W_CEN.PK   1   MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSDYGNSN   50
YDR299W_CLIB324   1   MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSDYGNSN   50
YDR299W_CLIB382   1   MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSDYGNSN   50
YDR299W_D273-10B   1   MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSDYGNSN   50
YDR299W_DBVPG6044   1   MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSDYGNSN   50
YDR299W_EC1118   1   -----MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSD   45
YDR299W_FL100   1   MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSDYGNSN   50
YDR299W_FY1679   1   MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSDYGNSN   50
YDR299W_FostersB   1   MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSDYGNSN   50
YDR299W_FostersO   
   --------------------------------------------------   
YDR299W_JAY291   1   MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSDYGNSN   50
YDR299W_JK9-3d   1   MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSDYGNSN   50
YDR299W_K11   1   MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSDYGNSN   50
YDR299W_Kyokai7   1   MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSDYGNSN   50
YDR299W_L1528   1   MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSDYGNSN   50
YDR299W_LalvinQA23   
   --------------------------------------------------   
YDR299W_PW5   1   MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSDYGNSN   50
YDR299W_RM11-1a   1   MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSDYGNSN   50
YDR299W_RedStar   1   MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSDYGNSN   50
YDR299W_SEY6210   1   MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSDYGNSN   50
YDR299W_SK1   1   MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSDYGNSN   50
YDR299W_T7   1   MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSDYGNSN   50
YDR299W_T73   1   MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSDYGNSN   50
YDR299W_UC5   1   MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSDYGNSN   50
YDR299W_UWOPS05_217_3   1   MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSDYGNSN   50
YDR299W_VL3   1   MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSDYGNSN   50
YDR299W_Vin13   1   MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSDYGNSN   50
YDR299W_W303   1   MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSDYGNSN   50
YDR299W_X2180-1A   1   MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSDYGNSN   50
YDR299W_Y55   1   MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSDYGNSN   50
YDR299W_YJM269   1   MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSDYGNSN   50
YDR299W_YJM339   1   MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSDYGNSN   50
YDR299W_YJM789   1   -----MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSD   45
YDR299W_YPH499   1   MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSDYGNSN   50
YDR299W_YPS128   1   MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSDYGNSN   50
YDR299W_YPS163   1   MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSDYGNSN   50
YDR299W_YS9   1   MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSDYGNSN   50
YDR299W_ZTW1   
   --------------------------------------------------   
         

YDR299W_S288C   51   TEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVSENEDE   100
YDR299W_AWRI1631   51   TEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVSENEDE   100
YDR299W_AWRI796   
   --------------------------------------------------   
YDR299W_BC187   46   YGNSNTEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVS   95
YDR299W_BY4741   51   TEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVSENEDE   100
YDR299W_BY4742   51   TEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVSENEDE   100
YDR299W_CBS7960   51   TEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVSENEDE   100
YDR299W_CEN.PK   51   TEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVSENEDE   100
YDR299W_CLIB324   51   TEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVSENEDE   100
YDR299W_CLIB382   51   TEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVSENEDE   100
YDR299W_D273-10B   51   TEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVSENEDE   100
YDR299W_DBVPG6044   51   TEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVSENEDE   100
YDR299W_EC1118   46   YGNSNTEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVS   95
YDR299W_FL100   51   TEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVSENEDE   100
YDR299W_FY1679   51   TEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVSENEDE   100
YDR299W_FostersB   51   TEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVSENEDE   100
YDR299W_FostersO   
   --------------------------------------------------   
YDR299W_JAY291   51   TEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVSENEDE   100
YDR299W_JK9-3d   51   TEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVSENEDE   100
YDR299W_K11   51   TEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVSENEDE   100
YDR299W_Kyokai7   51   TEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVSENEDE   100
YDR299W_L1528   51   TEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVSENEDE   100
YDR299W_LalvinQA23   
   --------------------------------------------------   
YDR299W_PW5   51   TEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEASENEDE   100
YDR299W_RM11-1a   51   TEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVSENEDE   100
YDR299W_RedStar   51   TEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVSENEDE   100
YDR299W_SEY6210   51   TEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVSENEDE   100
YDR299W_SK1   51   TEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVSENEDE   100
YDR299W_T7   51   TEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEASENEDE   100
YDR299W_T73   51   TEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVSENEDE   100
YDR299W_UC5   51   TEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVSENEDE   100
YDR299W_UWOPS05_217_3   51   TEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVSENEDE   100
YDR299W_VL3   51   TEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVSENEDE   100
YDR299W_Vin13   51   TEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVSENEDE   100
YDR299W_W303   51   TEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVSENEDE   100
YDR299W_X2180-1A   51   TEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVSENEDE   100
YDR299W_Y55   51   TEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVSENEDE   100
YDR299W_YJM269   51   TEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVSENEDE   100
YDR299W_YJM339   51   TEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEASENEDE   100
YDR299W_YJM789   46   YGNSNTEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVS   95
YDR299W_YPH499   51   TEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVSENEDE   100
YDR299W_YPS128   51   TEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVSENEDE   100
YDR299W_YPS163   51   TEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVSENEDE   100
YDR299W_YS9   51   TEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVSENEDE   100
YDR299W_ZTW1   
   --------------------------------------------------   
         

YDR299W_S288C   101   EEEE-----------------EEEEEKEEDALSFRTDSEDEEVEIDEEES   133
YDR299W_AWRI1631   101   EEEEEEEEE--------GEEEEEEEEKEEDALSFRTDSEDEEVEIDEEES   142
YDR299W_AWRI796   
   --------------------------------------------------   
YDR299W_BC187   96   ENEDEEEEE--------EEEEEGEEEEEEDALSFRTDSEDEEVEIDEEES   137
YDR299W_BY4741   101   EEEE-----------------EEEEEKEEDALSFRTDSEDEEVEIDEEES   133
YDR299W_BY4742   101   -----------------EEEEEEEEEKEEDALSFRTDSEDEEVEIDEEES   133
YDR299W_CBS7960   101   EEEEEEEEE--------GEEEEEEEEKEEDALSFRTDSEDEEVEIDEEES   142
YDR299W_CEN.PK   101   EEEEEEEEE-----------------KEEDALSFRTDSEDEEVEIDEEES   133
YDR299W_CLIB324   101   EEEEEE--------EEEGEEEEEEEEKEEDALSFRTDSEDEEVEIDEEES   142
YDR299W_CLIB382   101   EEEEEEEEG-----EEEEEEEKEEEEKEEDALSFRTDSEDEEVEIDEEES   145
YDR299W_D273-10B   101   EEEEEEEEGE-----EEEEEEKEEEEKEEDALSFRTDSEDEEVEIDEEES   145
YDR299W_DBVPG6044   101   EEEEEEEEEK-----------------EEDALSFRTDSEDEEVEIDEEES   133
YDR299W_EC1118   96   ENEDEEEEE--------EEEEEGEEEEEEDALSFRTDSEDEEVEIDEEES   137
YDR299W_FL100   101   EEEE-----------------EEEEEKEEDALSFRTDSEDEEVEIDEEES   133
YDR299W_FY1679   101   EEEEEEEEE-----------------KEEDALSFRTDSEDEEVEIDEEES   133
YDR299W_FostersB   101   EEEEEE--------EEE--------EKEEDALSFRTDSEDEEVEIDEEES   134
YDR299W_FostersO   
   --------------------------------------------------   
YDR299W_JAY291   101   EEEEEEEEE--------GEEEEEEEEKEEDALSFRTDSEDEEVEIDEEES   142
YDR299W_JK9-3d   101   EEEEEEEEEK-----------------EEDALSFRTDSEDEEVEIDEEES   133
YDR299W_K11   101   EEEEEEEEGE-----EEEEEEKEEEEKEEDALSFRTDSEDEEVEIDEEES   145
YDR299W_Kyokai7   101   EEEEEEEEGE-----EEEEEEKEEEEKEEDALSFRTDSEDEEVEIDEEES   145
YDR299W_L1528   101   EEEEEEEEE--------GEEEEEEEEKEEDALSFRTDSEDEEVEIDEEES   142
YDR299W_LalvinQA23   
   --------------------------------------------------   
YDR299W_PW5   101   EEEEEEEE---------GEEEEEEEEKEEDALSFRTDSEDEEVEIDEEES   141
YDR299W_RM11-1a   101   EEEEEEEEE--------GEEEEEEEEKEEDALSFRTDSEDEEVEIDEEES   142
YDR299W_RedStar   101   EEEEXXXXX--------XEEEEEEEEKEEDALSFRTDSEDEEVEIDEEES   142
YDR299W_SEY6210   101   EEEEEEEEE-----------------KEEDALSFRTDSEDEEVEIDEEES   133
YDR299W_SK1   101   EEEEEEEEEK-----------------EEDALSFRTDSEDEEVEIDEEES   133
YDR299W_T7   101   EEEEEEEEEGEEEEEEEGEEEEEEEEKEEDALSFRTDSEDEEVEIDEEES   150
YDR299W_T73   101   EEEEEEEEGE---------EEEEEEEKEEDALSFRTDSEDEEVEIDEEES   141
YDR299W_UC5   101   EEEEEEEEGE-----EEEEEEKEEEEKEEDALSFRTDSEDEEVEIDEEES   145
YDR299W_UWOPS05_217_3   101   EEEEEEEEEE--------EEEEEEEEKEEDALSFRTDSEDEEVEIDEEES   142
YDR299W_VL3   101   EEEEEEEEE--------GEEEEEEEEKEEDALSFRTDSEDEEVEIDEEES   142
YDR299W_Vin13   101   EEEEEE--------EEEGEEEEEEEEKEEDALSFRTDSEDEEVEIDEEES   142
YDR299W_W303   101   EEEE-----------------EEEEEKEEDALSFRTDSEDEEVEIDEEES   133
YDR299W_X2180-1A   101   EEEEEEEEE-----------------KEEDALSFRTDSEDEEVEIDEEES   133
YDR299W_Y55   101   EEEEEEEEEK-----------------EEDALSFRTDSEDEEVEIDEEES   133
YDR299W_YJM269   101   E--------------------EEEEEEEEDALSFRTDSEDEEVEIDEEES   130
YDR299W_YJM339   101   EEEEEEEE---------GEEEEEEEEKEEDALSFRTDSEDEEVEIDEEES   141
YDR299W_YJM789   96   ENEDEEEEE--------EEEEEGEEEEEEDALSFRTDSEDEEVEIDEEES   137
YDR299W_YPH499   101   EEEEEEEEEK-----------------EEDALSFRTDSEDEEVEIDEEES   133
YDR299W_YPS128   101   EEEEEEEEEE--------EEEEEEE-KEEDALSFRTDSEDEEVEIDEEES   141
YDR299W_YPS163   101   EEEEEEEEEE--------EEEEEEE-KEEDALSFRTDSEDEEVEIDEEES   141
YDR299W_YS9   101   EEEEGEEEEG----EEEEEEEEEEEEKEEDALSFRTDSEDEEVEIDEEES   146
YDR299W_ZTW1   
   --------------------------------------------------   
         

YDR299W_S288C   134   DADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQT   183
YDR299W_AWRI1631   143   DADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQT   192
YDR299W_AWRI796   
   --------------------------------------------------   
YDR299W_BC187   138   DADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQT   187
YDR299W_BY4741   134   DADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQT   183
YDR299W_BY4742   134   DADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQT   183
YDR299W_CBS7960   143   DADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQT   192
YDR299W_CEN.PK   134   DADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQT   183
YDR299W_CLIB324   143   DADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQT   192
YDR299W_CLIB382   146   DADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQT   195
YDR299W_D273-10B   146   DADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQT   195
YDR299W_DBVPG6044   134   DADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQT   183
YDR299W_EC1118   138   DADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQT   187
YDR299W_FL100   134   DADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQT   183
YDR299W_FY1679   134   DADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQT   183
YDR299W_FostersB   135   DADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQT   184
YDR299W_FostersO   
   --------------------------------------------------   
YDR299W_JAY291   143   DADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQT   192
YDR299W_JK9-3d   134   DADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQT   183
YDR299W_K11   146   DADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQT   195
YDR299W_Kyokai7   146   DADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQT   195
YDR299W_L1528   143   DADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQT   192
YDR299W_LalvinQA23   
   --------------------------------------------------   
YDR299W_PW5   142   DADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQT   191
YDR299W_RM11-1a   143   DADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQT   192
YDR299W_RedStar   143   DADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQT   192
YDR299W_SEY6210   134   DADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQT   183
YDR299W_SK1   134   DADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQT   183
YDR299W_T7   151   DADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQT   200
YDR299W_T73   142   DADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQT   191
YDR299W_UC5   146   DADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQT   195
YDR299W_UWOPS05_217_3   143   DADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQT   192
YDR299W_VL3   143   DADGGETEEAQQKRHALSKLIQQETKXAINKLSQSVQRDASKGYSILQQT   192
YDR299W_Vin13   143   DADGGETEEAQQKRHALSKLIQQETKXAINKLSQSVQRDASKGYSILQQT   192
YDR299W_W303   134   DADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQT   183
YDR299W_X2180-1A   134   DADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQT   183
YDR299W_Y55   134   DADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQT   183
YDR299W_YJM269   131   DADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQT   180
YDR299W_YJM339   142   DADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQT   191
YDR299W_YJM789   138   DADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQT   187
YDR299W_YPH499   134   DADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQT   183
YDR299W_YPS128   142   DADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQT   191
YDR299W_YPS163   142   DADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQT   191
YDR299W_YS9   147   DADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQT   196
YDR299W_ZTW1   
   --------------------------------------------------   
         

YDR299W_S288C   184   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   233
YDR299W_AWRI1631   193   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   242
YDR299W_AWRI796   1   ----------------------------------MDDSEETKRLLKENEK   16
YDR299W_BC187   188   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   237
YDR299W_BY4741   184   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   233
YDR299W_BY4742   184   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   233
YDR299W_CBS7960   193   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   242
YDR299W_CEN.PK   184   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   233
YDR299W_CLIB324   193   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   242
YDR299W_CLIB382   196   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   245
YDR299W_D273-10B   196   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   245
YDR299W_DBVPG6044   184   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   233
YDR299W_EC1118   188   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   237
YDR299W_FL100   184   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   233
YDR299W_FY1679   184   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   233
YDR299W_FostersB   185   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   234
YDR299W_FostersO   
   --------------------------------------------------   
YDR299W_JAY291   193   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   242
YDR299W_JK9-3d   184   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   233
YDR299W_K11   196   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   245
YDR299W_Kyokai7   196   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   245
YDR299W_L1528   193   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   242
YDR299W_LalvinQA23   1   ----------------------------------MDDSEETKRLLKENEK   16
YDR299W_PW5   192   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   241
YDR299W_RM11-1a   193   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   242
YDR299W_RedStar   193   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   242
YDR299W_SEY6210   184   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   233
YDR299W_SK1   184   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   233
YDR299W_T7   201   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   250
YDR299W_T73   192   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   241
YDR299W_UC5   196   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKSLLKENEK   245
YDR299W_UWOPS05_217_3   193   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   242
YDR299W_VL3   193   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   242
YDR299W_Vin13   193   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   242
YDR299W_W303   184   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   233
YDR299W_X2180-1A   184   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   233
YDR299W_Y55   184   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   233
YDR299W_YJM269   181   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   230
YDR299W_YJM339   192   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   241
YDR299W_YJM789   188   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   237
YDR299W_YPH499   184   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   233
YDR299W_YPS128   192   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   241
YDR299W_YPS163   192   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   241
YDR299W_YS9   197   KLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEK   246
YDR299W_ZTW1   1   ----------------------------------MDDSEETKRLLKENEK   16
         

YDR299W_S288C   234   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHKLSKKRSLKELYQETNSL   282
YDR299W_AWRI1631   243   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHKLSKKRSLKELYQETNSL   291
YDR299W_AWRI796   17   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHKLSKKRSLKELYQETNSL   65
YDR299W_BC187   238   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHKLSKKRSLKELYQETNSL   286
YDR299W_BY4741   234   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHKLSKKRSLKELYQETNSL   282
YDR299W_BY4742   234   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHKLSKKRSLKELYQETNSL   282
YDR299W_CBS7960   243   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHKLSKKRSLKELYQETNSL   291
YDR299W_CEN.PK   234   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHKLSKKRSLKELYQETNSL   282
YDR299W_CLIB324   243   LFNNLFNRGVNFRIKFQLGDPLTLKNEEVAKHNCPKKDLSKRVYQEN---   289
YDR299W_CLIB382   246   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHKLSKKRSLKELYQETNSL   294
YDR299W_D273-10B   246   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHKLSKKRSLKELYQETNSL   294
YDR299W_DBVPG6044   234   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKYKLSKKRSLKELYQETNSL   282
YDR299W_EC1118   238   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHKLSKKRSLKELYQETNSL   286
YDR299W_FL100   234   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHKLSKKRSLKELYQETNSL   282
YDR299W_FY1679   234   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHKLSKKRSLKELYQETNSL   282
YDR299W_FostersB   235   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHKLSKKKISQRALPRN---   280
YDR299W_FostersO   1   -------------------------MKRWRSINCPKKRSLKELYQETNSL   25
YDR299W_JAY291   243   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHKLSKKRSLKELYQETNSL   291
YDR299W_JK9-3d   234   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHKLSKKRSLKELYQETNSL   282
YDR299W_K11   246   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHKLSKKRSLKELYQETNSL   294
YDR299W_Kyokai7   246   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHKLSKKRSLKELYQETNSL   294
YDR299W_L1528   243   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHKLSKKRSLKELYQETNSL   291
YDR299W_LalvinQA23   17   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHKLSKKRSLKELYQETNSL   65
YDR299W_PW5   242   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHKLSKKRSLKELYQETNSL   290
YDR299W_RM11-1a   243   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHKLSKKRSLKELYQETNSL   291
YDR299W_RedStar   243   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHKLSKKRSLKELYQETNSL   291
YDR299W_SEY6210   234   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHKLSKKRSLKELYQETNSL   282
YDR299W_SK1   234   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKYKLSKKRSLKELYQETNSL   282
YDR299W_T7   251   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHKLSKKRSLKELYQETNSL   299
YDR299W_T73   242   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHKLSKKRSLKELYQETNSL   290
YDR299W_UC5   246   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHKLSKKRSLKELYQETNSL   294
YDR299W_UWOPS05_217_3   243   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHKLSKKRSLKELYQETNSL   291
YDR299W_VL3   243   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHXLSKKRSLKELYQETNSL   291
YDR299W_Vin13   243   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHKLSKKRISQRALPRN---   288
YDR299W_W303   234   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHKLSKKRSLKELYQETNSL   282
YDR299W_X2180-1A   234   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHKLSKKRSLKELYQETNSL   282
YDR299W_Y55   234   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKYKLSKKRSLKELYQETNSL   282
YDR299W_YJM269   231   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHKLSKKRSLKELYQETNSL   279
YDR299W_YJM339   242   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHKLSKKRSLKELYQETNSL   290
YDR299W_YJM789   238   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHKLSKKRSLKELYQETNSL   286
YDR299W_YPH499   234   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHKLSKKRSLKELYQETNSL   282
YDR299W_YPS128   242   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHKLSKKRSLKELYQETNSL   290
YDR299W_YPS163   242   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHKLSKKRSLKELYQETNSL   290
YDR299W_YS9   247   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHKLSKKRSLKELYQETNSL   295
YDR299W_ZTW1   17   LFNNLFNRLINFRIKFQLGDHITQ-NEEVAKHKLSKKRSLKELYQETNSL   65
         

YDR299W_S288C   283   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   332
YDR299W_AWRI1631   292   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   341
YDR299W_AWRI796   66   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   115
YDR299W_BC187   287   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   336
YDR299W_BY4741   283   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   332
YDR299W_BY4742   283   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   332
YDR299W_CBS7960   292   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   341
YDR299W_CEN.PK   283   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   332
YDR299W_CLIB324   
   --------------------------------------------------   
YDR299W_CLIB382   295   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   344
YDR299W_D273-10B   295   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   344
YDR299W_DBVPG6044   283   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   332
YDR299W_EC1118   287   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   336
YDR299W_FL100   283   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   332
YDR299W_FY1679   283   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   332
YDR299W_FostersB   
   --------------------------------------------------   
YDR299W_FostersO   26   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   75
YDR299W_JAY291   292   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   341
YDR299W_JK9-3d   283   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   332
YDR299W_K11   295   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   344
YDR299W_Kyokai7   295   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   344
YDR299W_L1528   292   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   341
YDR299W_LalvinQA23   66   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   115
YDR299W_PW5   291   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   340
YDR299W_RM11-1a   292   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   341
YDR299W_RedStar   292   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   341
YDR299W_SEY6210   283   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   332
YDR299W_SK1   283   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   332
YDR299W_T7   300   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   349
YDR299W_T73   291   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   340
YDR299W_UC5   295   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   344
YDR299W_UWOPS05_217_3   292   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   341
YDR299W_VL3   292   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   341
YDR299W_Vin13   
   --------------------------------------------------   
YDR299W_W303   283   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   332
YDR299W_X2180-1A   283   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   332
YDR299W_Y55   283   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   332
YDR299W_YJM269   280   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   329
YDR299W_YJM339   291   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   340
YDR299W_YJM789   287   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   336
YDR299W_YPH499   283   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   332
YDR299W_YPS128   291   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   340
YDR299W_YPS163   291   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   340
YDR299W_YS9   296   DSELKEYRTAVLNKWSTKVSPASGNAALSSNKFKAINLPADVQVENQLSD   345
YDR299W_ZTW1   66   DSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSD   115
         

YDR299W_S288C   333   MSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDG   382
YDR299W_AWRI1631   342   MSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDG   391
YDR299W_AWRI796   116   MSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDG   165
YDR299W_BC187   337   MSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDG   386
YDR299W_BY4741   333   MSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDG   382
YDR299W_BY4742   333   MSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDG   382
YDR299W_CBS7960   342   MSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDG   391
YDR299W_CEN.PK   333   MSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDG   382
YDR299W_CLIB324   
   --------------------------------------------------   
YDR299W_CLIB382   345   MSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDG   394
YDR299W_D273-10B   345   MSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDG   394
YDR299W_DBVPG6044   333   MSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDG   382
YDR299W_EC1118   337   MSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDG   386
YDR299W_FL100   333   MSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDG   382
YDR299W_FY1679   333   MSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDG   382
YDR299W_FostersB   
   --------------------------------------------------   
YDR299W_FostersO   76   MSRLMKRTKLNRRNITPLYFQKXCANGRLPELISPVVKDSVDDNENSDDG   125
YDR299W_JAY291   342   MSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDG   391
YDR299W_JK9-3d   333   MSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDG   382
YDR299W_K11   345   MSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDG   394
YDR299W_Kyokai7   345   MSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDG   394
YDR299W_L1528   342   MSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDG   391
YDR299W_LalvinQA23   116   MSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDG   165
YDR299W_PW5   341   MSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDG   390
YDR299W_RM11-1a   342   MSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDG   391
YDR299W_RedStar   342   MSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDG   391
YDR299W_SEY6210   333   MSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDG   382
YDR299W_SK1   333   MSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDG   382
YDR299W_T7   350   MSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDG   399
YDR299W_T73   341   MSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDG   390
YDR299W_UC5   345   MSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDG   394
YDR299W_UWOPS05_217_3   342   MSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDG   391
YDR299W_VL3   342   MSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDG   391
YDR299W_Vin13   
   --------------------------------------------------   
YDR299W_W303   333   MSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDG   382
YDR299W_X2180-1A   333   MSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDG   382
YDR299W_Y55   333   MSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDG   382
YDR299W_YJM269   330   MSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDG   379
YDR299W_YJM339   341   MSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDG   390
YDR299W_YJM789   337   MSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDG   386
YDR299W_YPH499   333   MSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDG   382
YDR299W_YPS128   341   MSRLMKRTKLNRRNITPLCFQKDCANGRLPELISPVVKDSVDDNENSDDG   390
YDR299W_YPS163   341   MSRLMKRTKLNRRNITPLCFQKDCANGRLPELISPVVKDSVDDNENSDDG   390
YDR299W_YS9   346   MSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDG   395
YDR299W_ZTW1   116   MSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDG   165
         

YDR299W_S288C   383   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   432
YDR299W_AWRI1631   392   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   441
YDR299W_AWRI796   166   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   215
YDR299W_BC187   387   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   436
YDR299W_BY4741   383   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   432
YDR299W_BY4742   383   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   432
YDR299W_CBS7960   392   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   441
YDR299W_CEN.PK   383   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   432
YDR299W_CLIB324   
   --------------------------------------------------   
YDR299W_CLIB382   395   LDIPKNYDPRRKDNNAIDITENPYVFV-----------------------   421
YDR299W_D273-10B   395   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   444
YDR299W_DBVPG6044   383   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   432
YDR299W_EC1118   387   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   436
YDR299W_FL100   383   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   432
YDR299W_FY1679   383   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   432
YDR299W_FostersB   
   --------------------------------------------------   
YDR299W_FostersO   126   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   175
YDR299W_JAY291   392   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   441
YDR299W_JK9-3d   383   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   432
YDR299W_K11   395   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   444
YDR299W_Kyokai7   395   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   444
YDR299W_L1528   392   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   441
YDR299W_LalvinQA23   166   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   215
YDR299W_PW5   391   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   440
YDR299W_RM11-1a   392   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   441
YDR299W_RedStar   392   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   441
YDR299W_SEY6210   383   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   432
YDR299W_SK1   383   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   432
YDR299W_T7   400   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   449
YDR299W_T73   391   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   440
YDR299W_UC5   395   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   444
YDR299W_UWOPS05_217_3   392   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   441
YDR299W_VL3   392   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   441
YDR299W_Vin13   
   --------------------------------------------------   
YDR299W_W303   383   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   432
YDR299W_X2180-1A   383   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   432
YDR299W_Y55   383   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   432
YDR299W_YJM269   380   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   429
YDR299W_YJM339   391   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   440
YDR299W_YJM789   387   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   436
YDR299W_YPH499   383   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   432
YDR299W_YPS128   391   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   440
YDR299W_YPS163   391   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   440
YDR299W_YS9   396   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   445
YDR299W_ZTW1   166   LDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNS   215
         

YDR299W_S288C   433   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   482
YDR299W_AWRI1631   442   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   491
YDR299W_AWRI796   216   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   265
YDR299W_BC187   437   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   486
YDR299W_BY4741   433   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   482
YDR299W_BY4742   433   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   482
YDR299W_CBS7960   442   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   491
YDR299W_CEN.PK   433   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   482
YDR299W_CLIB324   
   --------------------------------------------------   
YDR299W_CLIB382   
   --------------------------------------------------   
YDR299W_D273-10B   445   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   494
YDR299W_DBVPG6044   433   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   482
YDR299W_EC1118   437   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   486
YDR299W_FL100   433   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   482
YDR299W_FY1679   433   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   482
YDR299W_FostersB   
   --------------------------------------------------   
YDR299W_FostersO   176   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   225
YDR299W_JAY291   442   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   491
YDR299W_JK9-3d   433   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   482
YDR299W_K11   445   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   494
YDR299W_Kyokai7   445   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   494
YDR299W_L1528   442   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   491
YDR299W_LalvinQA23   216   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   265
YDR299W_PW5   441   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   490
YDR299W_RM11-1a   442   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   491
YDR299W_RedStar   442   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   491
YDR299W_SEY6210   433   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   482
YDR299W_SK1   433   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   482
YDR299W_T7   450   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   499
YDR299W_T73   441   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   490
YDR299W_UC5   445   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   494
YDR299W_UWOPS05_217_3   442   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   491
YDR299W_VL3   442   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   491
YDR299W_Vin13   
   --------------------------------------------------   
YDR299W_W303   433   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   482
YDR299W_X2180-1A   433   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   482
YDR299W_Y55   433   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   482
YDR299W_YJM269   430   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   479
YDR299W_YJM339   441   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   490
YDR299W_YJM789   437   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   486
YDR299W_YPH499   433   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   482
YDR299W_YPS128   441   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   490
YDR299W_YPS163   441   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   490
YDR299W_YS9   446   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   495
YDR299W_ZTW1   216   ESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSG   265
         

YDR299W_S288C   483   YKWSDDQIDEFFAGLLGQRVNFNENEDEEQHARIENDEELEAVKNDDIQI   532
YDR299W_AWRI1631   492   YKWSDDQIDEFFAGLLGQRVNFNENEDEEQHARIENDEELEAVKNDDIQI   541
YDR299W_AWRI796   266   YKWSDDQIDEFFAGLLGQRVNFNENEDEEQHARIENDEELEAVKNDDIQI   315
YDR299W_BC187   487   YKWSDDQIDEFFAGLLGQRVNFNENEDEEQHARIENDEELEAVKNDDIQI   536
YDR299W_BY4741   483   YKWSDDQIDEFFAGLLGQRVNFNENEDEEQHARIENDEELEAVKNDDIQI   532
YDR299W_BY4742   483   YKWSDDQIDEFFAGLLGQRVNFNENEDEEQHARIENDEELEAVKNDDIQI   532
YDR299W_CBS7960   492   YKWSDDQIDEFFAGLLGQRVNFNENEDEEQHARIENDEELEAVKNDDIQI   541
YDR299W_CEN.PK   483   YKWSDDQIDEFFAGLLGQRVNFNENEDEEQHARIENDEELEAVKNDDIQI   532
YDR299W_CLIB324   
   --------------------------------------------------   
YDR299W_CLIB382   
   --------------------------------------------------   
YDR299W_D273-10B   495   YKWSDDQIDEFFAGLLGQRVNFNENEDEEQQARIENDEELEAVKNDDIQI   544
YDR299W_DBVPG6044   483   YKWSDDQIDEFFAGLLGQRVNFNENEDEEQQARIENDEELEAVKNDDIQI   532
YDR299W_EC1118   487   YKWSDDQIDEFFAGLLGQRVNFNENEDEEQHARIENDEELEAVKNDDIQI   536
YDR299W_FL100   483   YKWSDDQIDEFFAGLLGQRVNFNENEDEEQHARIENDEELEAVKNDDIQI   532
YDR299W_FY1679   483   YKWSDDQIDEFFAGLLGQRVNFNENEDEEQHARIENDEELEAVKNDDIQI   532
YDR299W_FostersB   
   --------------------------------------------------   
YDR299W_FostersO   226   YKWSDDQIDEFFAGLLGQRVNFNENEDEEQHARIENXEELEAVKNDDIQI   275
YDR299W_JAY291   492   YKWSDDQIDEFFAGLLGQRVNFNENEDEEQHARIENDEELEAVKNDDIQI   541
YDR299W_JK9-3d   483   YKWSDDQIDEFFAGLLGQRVNFNENEDEEQHARIENDEELEAVKNDDIQI   532
YDR299W_K11   495   YKWSDDQIDEFFAGLLGQRVNFNENEDEEQHARIENDEELEAVKNDDIQI   544
YDR299W_Kyokai7   495   YKWSDDQIDEFFAGLLGQRVNFNENEDEEQHARIENDEELEAVKNDDIQI   544
YDR299W_L1528   492   YKWSDDQIDEFFAGLLGQRVNFNENEDEEQHARIENDEELEAVKNDDIQI   541
YDR299W_LalvinQA23   266   YKWSDDQIDEFFAGLLGQRVNFNENEDEEQHARIENDEELEAVKNDDIQI   315
YDR299W_PW5   491   YKWSDDQIDEFFAGLLGQRVNFNENEDEEQHARIENDEELEAVKNDDIQI   540
YDR299W_RM11-1a   492   YKWSDDQIDEFFAGLLGQRVNFNENEDEEQHARIENDEELEAVKNDDIQI   541
YDR299W_RedStar   492   YKWSDDQIDEFFAGLLGQRVNFNENEDEEQHARIENDEELEAVKNDDIQI   541
YDR299W_SEY6210   483   YKWSDDQIDEFFAGLLGQRVNFNENEDEEQHARIENDEELEAVKNDDIQI   532
YDR299W_SK1   483   YKWSDDQIDEFFAGLLGQRVNFNENEDEEQQARIENDEELEAVKNDDIQI   532
YDR299W_T7   500   YKWSDDQIDEFFAGLLGQRVNFNENEDEEQHARIENDEELEAVKNDDIQI   549
YDR299W_T73   491   YKWSDDQIDEFFAGLLGQRVNFNENEDEEQHARIENDEELEAVKNDDIQI   540
YDR299W_UC5   495   YKWSDDQIDEFFAGLLGQRVNFNENEDEEQHARIENDEELEAVKNDDIQI   544
YDR299W_UWOPS05_217_3   492   YKWSDDQIDEFFAGLLGQRVNFNENEDEEQHARIENDEELEAVKNDDIQI   541
YDR299W_VL3   492   YKWSDDQIDEFFAGLLGQRVNFNENEDEEQHARIENDEELEAVKNDDIQI   541
YDR299W_Vin13   
   --------------------------------------------------   
YDR299W_W303   483   YKWSDDQIDEFFAGLLGQRVNFNENEDEEQHARIENDEELEAVKNDDIQI   532
YDR299W_X2180-1A   483   YKWSDDQIDEFFAGLL