ZIP1/YDR285W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YDR285W_S288C   
   --------------------------------------------------   
YDR285W_AWRI1631   
   --------------------------------------------------   
YDR285W_AWRI796   
   --------------------------------------------------   
YDR285W_BC187   
   --------------------------------------------------   
YDR285W_BY4741   
   --------------------------------------------------   
YDR285W_BY4742   
   --------------------------------------------------   
YDR285W_CBS7960   
   --------------------------------------------------   
YDR285W_CEN.PK   
   --------------------------------------------------   
YDR285W_CLIB215   
   --------------------------------------------------   
YDR285W_D273-10B   
   --------------------------------------------------   
YDR285W_DBVPG6044   
   --------------------------------------------------   
YDR285W_EC1118   
   --------------------------------------------------   
YDR285W_EC9-8   
   --------------------------------------------------   
YDR285W_FL100   
   --------------------------------------------------   
YDR285W_FY1679   
   --------------------------------------------------   
YDR285W_FostersB   
   --------------------------------------------------   
YDR285W_FostersO   
   --------------------------------------------------   
YDR285W_JAY291   
   --------------------------------------------------   
YDR285W_JK9-3d   
   --------------------------------------------------   
YDR285W_K11   
   --------------------------------------------------   
YDR285W_Kyokai7   
   --------------------------------------------------   
YDR285W_L1528   
   --------------------------------------------------   
YDR285W_LalvinQA23   
   --------------------------------------------------   
YDR285W_PW5   
   --------------------------------------------------   
YDR285W_RM11-1a   
   --------------------------------------------------   
YDR285W_SEY6210   
   --------------------------------------------------   
YDR285W_SK1   
   --------------------------------------------------   
YDR285W_T7   
   --------------------------------------------------   
YDR285W_UC5   
   --------------------------------------------------   
YDR285W_UWOPS05_217_3   
   --------------------------------------------------   
YDR285W_VL3   
   --------------------------------------------------   
YDR285W_Vin13   
   --------------------------------------------------   
YDR285W_W303   
   --------------------------------------------------   
YDR285W_X2180-1A   
   --------------------------------------------------   
YDR285W_Y10   1   MSNFFRDSSMGFKPRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSI   50
YDR285W_Y55   
   --------------------------------------------------   
YDR285W_YJM269   
   --------------------------------------------------   
YDR285W_YJM339   
   --------------------------------------------------   
YDR285W_YJM789   
   --------------------------------------------------   
YDR285W_YPH499   
   --------------------------------------------------   
YDR285W_YPS128   
   --------------------------------------------------   
YDR285W_YPS163   
   --------------------------------------------------   
YDR285W_YS9   
   --------------------------------------------------   
YDR285W_ZTW1   
   --------------------------------------------------   
         

YDR285W_S288C   
   --------------------------------------------------   
YDR285W_AWRI1631   
   --------------------------------------------------   
YDR285W_AWRI796   
   --------------------------------------------------   
YDR285W_BC187   
   --------------------------------------------------   
YDR285W_BY4741   
   --------------------------------------------------   
YDR285W_BY4742   
   --------------------------------------------------   
YDR285W_CBS7960   
   --------------------------------------------------   
YDR285W_CEN.PK   
   --------------------------------------------------   
YDR285W_CLIB215   
   --------------------------------------------------   
YDR285W_D273-10B   
   --------------------------------------------------   
YDR285W_DBVPG6044   
   --------------------------------------------------   
YDR285W_EC1118   
   --------------------------------------------------   
YDR285W_EC9-8   
   --------------------------------------------------   
YDR285W_FL100   
   --------------------------------------------------   
YDR285W_FY1679   
   --------------------------------------------------   
YDR285W_FostersB   
   --------------------------------------------------   
YDR285W_FostersO   
   --------------------------------------------------   
YDR285W_JAY291   
   --------------------------------------------------   
YDR285W_JK9-3d   
   --------------------------------------------------   
YDR285W_K11   
   --------------------------------------------------   
YDR285W_Kyokai7   
   --------------------------------------------------   
YDR285W_L1528   
   --------------------------------------------------   
YDR285W_LalvinQA23   
   --------------------------------------------------   
YDR285W_PW5   
   --------------------------------------------------   
YDR285W_RM11-1a   
   --------------------------------------------------   
YDR285W_SEY6210   
   --------------------------------------------------   
YDR285W_SK1   
   --------------------------------------------------   
YDR285W_T7   
   --------------------------------------------------   
YDR285W_UC5   
   --------------------------------------------------   
YDR285W_UWOPS05_217_3   
   --------------------------------------------------   
YDR285W_VL3   
   --------------------------------------------------   
YDR285W_Vin13   
   --------------------------------------------------   
YDR285W_W303   
   --------------------------------------------------   
YDR285W_X2180-1A   
   --------------------------------------------------   
YDR285W_Y10   51   EGDDTFKKPHKTSTEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYN   100
YDR285W_Y55   
   --------------------------------------------------   
YDR285W_YJM269   
   --------------------------------------------------   
YDR285W_YJM339   
   --------------------------------------------------   
YDR285W_YJM789   
   --------------------------------------------------   
YDR285W_YPH499   
   --------------------------------------------------   
YDR285W_YPS128   
   --------------------------------------------------   
YDR285W_YPS163   
   --------------------------------------------------   
YDR285W_YS9   
   --------------------------------------------------   
YDR285W_ZTW1   
   --------------------------------------------------   
         

YDR285W_S288C   
   --------------------------------------------------   
YDR285W_AWRI1631   
   --------------------------------------------------   
YDR285W_AWRI796   
   --------------------------------------------------   
YDR285W_BC187   
   --------------------------------------------------   
YDR285W_BY4741   
   --------------------------------------------------   
YDR285W_BY4742   
   --------------------------------------------------   
YDR285W_CBS7960   
   --------------------------------------------------   
YDR285W_CEN.PK   
   --------------------------------------------------   
YDR285W_CLIB215   
   --------------------------------------------------   
YDR285W_D273-10B   
   --------------------------------------------------   
YDR285W_DBVPG6044   
   --------------------------------------------------   
YDR285W_EC1118   
   --------------------------------------------------   
YDR285W_EC9-8   
   --------------------------------------------------   
YDR285W_FL100   
   --------------------------------------------------   
YDR285W_FY1679   
   --------------------------------------------------   
YDR285W_FostersB   
   --------------------------------------------------   
YDR285W_FostersO   
   --------------------------------------------------   
YDR285W_JAY291   
   --------------------------------------------------   
YDR285W_JK9-3d   
   --------------------------------------------------   
YDR285W_K11   
   --------------------------------------------------   
YDR285W_Kyokai7   
   --------------------------------------------------   
YDR285W_L1528   
   --------------------------------------------------   
YDR285W_LalvinQA23   
   --------------------------------------------------   
YDR285W_PW5   
   --------------------------------------------------   
YDR285W_RM11-1a   
   --------------------------------------------------   
YDR285W_SEY6210   
   --------------------------------------------------   
YDR285W_SK1   
   --------------------------------------------------   
YDR285W_T7   
   --------------------------------------------------   
YDR285W_UC5   
   --------------------------------------------------   
YDR285W_UWOPS05_217_3   
   --------------------------------------------------   
YDR285W_VL3   
   --------------------------------------------------   
YDR285W_Vin13   
   --------------------------------------------------   
YDR285W_W303   
   --------------------------------------------------   
YDR285W_X2180-1A   
   --------------------------------------------------   
YDR285W_Y10   101   RILKNDVAAIENDTDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKD   150
YDR285W_Y55   
   --------------------------------------------------   
YDR285W_YJM269   
   --------------------------------------------------   
YDR285W_YJM339   
   --------------------------------------------------   
YDR285W_YJM789   
   --------------------------------------------------   
YDR285W_YPH499   
   --------------------------------------------------   
YDR285W_YPS128   
   --------------------------------------------------   
YDR285W_YPS163   
   --------------------------------------------------   
YDR285W_YS9   
   --------------------------------------------------   
YDR285W_ZTW1   
   --------------------------------------------------   
         

YDR285W_S288C   
   --------------------------------------------------   
YDR285W_AWRI1631   
   --------------------------------------------------   
YDR285W_AWRI796   
   --------------------------------------------------   
YDR285W_BC187   
   --------------------------------------------------   
YDR285W_BY4741   
   --------------------------------------------------   
YDR285W_BY4742   
   --------------------------------------------------   
YDR285W_CBS7960   
   --------------------------------------------------   
YDR285W_CEN.PK   
   --------------------------------------------------   
YDR285W_CLIB215   
   --------------------------------------------------   
YDR285W_D273-10B   
   --------------------------------------------------   
YDR285W_DBVPG6044   
   --------------------------------------------------   
YDR285W_EC1118   
   --------------------------------------------------   
YDR285W_EC9-8   
   --------------------------------------------------   
YDR285W_FL100   
   --------------------------------------------------   
YDR285W_FY1679   
   --------------------------------------------------   
YDR285W_FostersB   
   --------------------------------------------------   
YDR285W_FostersO   
   --------------------------------------------------   
YDR285W_JAY291   
   --------------------------------------------------   
YDR285W_JK9-3d   
   --------------------------------------------------   
YDR285W_K11   
   --------------------------------------------------   
YDR285W_Kyokai7   
   --------------------------------------------------   
YDR285W_L1528   
   --------------------------------------------------   
YDR285W_LalvinQA23   
   --------------------------------------------------   
YDR285W_PW5   
   --------------------------------------------------   
YDR285W_RM11-1a   
   --------------------------------------------------   
YDR285W_SEY6210   
   --------------------------------------------------   
YDR285W_SK1   
   --------------------------------------------------   
YDR285W_T7   
   --------------------------------------------------   
YDR285W_UC5   
   --------------------------------------------------   
YDR285W_UWOPS05_217_3   
   --------------------------------------------------   
YDR285W_VL3   
   --------------------------------------------------   
YDR285W_Vin13   
   --------------------------------------------------   
YDR285W_W303   
   --------------------------------------------------   
YDR285W_X2180-1A   
   --------------------------------------------------   
YDR285W_Y10   151   SKMHEYTMTNGKAPLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQK   200
YDR285W_Y55   
   --------------------------------------------------   
YDR285W_YJM269   
   --------------------------------------------------   
YDR285W_YJM339   
   --------------------------------------------------   
YDR285W_YJM789   
   --------------------------------------------------   
YDR285W_YPH499   
   --------------------------------------------------   
YDR285W_YPS128   
   --------------------------------------------------   
YDR285W_YPS163   
   --------------------------------------------------   
YDR285W_YS9   
   --------------------------------------------------   
YDR285W_ZTW1   
   --------------------------------------------------   
         

YDR285W_S288C   
   --------------------------------------------------   
YDR285W_AWRI1631   
   --------------------------------------------------   
YDR285W_AWRI796   
   --------------------------------------------------   
YDR285W_BC187   
   --------------------------------------------------   
YDR285W_BY4741   
   --------------------------------------------------   
YDR285W_BY4742   
   --------------------------------------------------   
YDR285W_CBS7960   
   --------------------------------------------------   
YDR285W_CEN.PK   
   --------------------------------------------------   
YDR285W_CLIB215   
   --------------------------------------------------   
YDR285W_D273-10B   
   --------------------------------------------------   
YDR285W_DBVPG6044   
   --------------------------------------------------   
YDR285W_EC1118   
   --------------------------------------------------   
YDR285W_EC9-8   
   --------------------------------------------------   
YDR285W_FL100   
   --------------------------------------------------   
YDR285W_FY1679   
   --------------------------------------------------   
YDR285W_FostersB   
   --------------------------------------------------   
YDR285W_FostersO   
   --------------------------------------------------   
YDR285W_JAY291   
   --------------------------------------------------   
YDR285W_JK9-3d   
   --------------------------------------------------   
YDR285W_K11   
   --------------------------------------------------   
YDR285W_Kyokai7   
   --------------------------------------------------   
YDR285W_L1528   
   --------------------------------------------------   
YDR285W_LalvinQA23   
   --------------------------------------------------   
YDR285W_PW5   
   --------------------------------------------------   
YDR285W_RM11-1a   
   --------------------------------------------------   
YDR285W_SEY6210   
   --------------------------------------------------   
YDR285W_SK1   
   --------------------------------------------------   
YDR285W_T7   
   --------------------------------------------------   
YDR285W_UC5   
   --------------------------------------------------   
YDR285W_UWOPS05_217_3   
   --------------------------------------------------   
YDR285W_VL3   
   --------------------------------------------------   
YDR285W_Vin13   
   --------------------------------------------------   
YDR285W_W303   
   --------------------------------------------------   
YDR285W_X2180-1A   
   --------------------------------------------------   
YDR285W_Y10   201   QQQDNAKLKVRLQSYASNSDKINEKVGKYKSCLETLQERIATLTSHKNNQ   250
YDR285W_Y55   
   --------------------------------------------------   
YDR285W_YJM269   
   --------------------------------------------------   
YDR285W_YJM339   
   --------------------------------------------------   
YDR285W_YJM789   
   --------------------------------------------------   
YDR285W_YPH499   
   --------------------------------------------------   
YDR285W_YPS128   
   --------------------------------------------------   
YDR285W_YPS163   
   --------------------------------------------------   
YDR285W_YS9   
   --------------------------------------------------   
YDR285W_ZTW1   
   --------------------------------------------------   
         

YDR285W_S288C   
   --------------------------------------------------   
YDR285W_AWRI1631   
   --------------------------------------------------   
YDR285W_AWRI796   
   --------------------------------------------------   
YDR285W_BC187   
   --------------------------------------------------   
YDR285W_BY4741   
   --------------------------------------------------   
YDR285W_BY4742   
   --------------------------------------------------   
YDR285W_CBS7960   
   --------------------------------------------------   
YDR285W_CEN.PK   
   --------------------------------------------------   
YDR285W_CLIB215   
   --------------------------------------------------   
YDR285W_D273-10B   
   --------------------------------------------------   
YDR285W_DBVPG6044   
   --------------------------------------------------   
YDR285W_EC1118   
   --------------------------------------------------   
YDR285W_EC9-8   
   --------------------------------------------------   
YDR285W_FL100   
   --------------------------------------------------   
YDR285W_FY1679   
   --------------------------------------------------   
YDR285W_FostersB   
   --------------------------------------------------   
YDR285W_FostersO   
   --------------------------------------------------   
YDR285W_JAY291   
   --------------------------------------------------   
YDR285W_JK9-3d   
   --------------------------------------------------   
YDR285W_K11   
   --------------------------------------------------   
YDR285W_Kyokai7   
   --------------------------------------------------   
YDR285W_L1528   
   --------------------------------------------------   
YDR285W_LalvinQA23   
   --------------------------------------------------   
YDR285W_PW5   
   --------------------------------------------------   
YDR285W_RM11-1a   
   --------------------------------------------------   
YDR285W_SEY6210   
   --------------------------------------------------   
YDR285W_SK1   
   --------------------------------------------------   
YDR285W_T7   
   --------------------------------------------------   
YDR285W_UC5   
   --------------------------------------------------   
YDR285W_UWOPS05_217_3   
   --------------------------------------------------   
YDR285W_VL3   
   --------------------------------------------------   
YDR285W_Vin13   1   ----------------------------------------------MKKG   4
YDR285W_W303   
   --------------------------------------------------   
YDR285W_X2180-1A   
   --------------------------------------------------   
YDR285W_Y10   251   ETKLKDLRQNHQLYQRRISGFKTSIENLNKTINDLGKNKKEADAELMKKG   300
YDR285W_Y55   
   --------------------------------------------------   
YDR285W_YJM269   
   --------------------------------------------------   
YDR285W_YJM339   
   --------------------------------------------------   
YDR285W_YJM789   
   --------------------------------------------------   
YDR285W_YPH499   
   --------------------------------------------------   
YDR285W_YPS128   
   --------------------------------------------------   
YDR285W_YPS163   
   --------------------------------------------------   
YDR285W_YS9   
   --------------------------------------------------   
YDR285W_ZTW1   
   --------------------------------------------------   
         

YDR285W_S288C   1   -------------------------------------MSNFFRDSSMGFK   13
YDR285W_AWRI1631   1   -------------------------------------MSNFFRDSSMGFK   13
YDR285W_AWRI796   1   -------------------------------------MSNFFRDSSMGFK   13
YDR285W_BC187   1   -------------------------------------MSNFFRDSSMGFK   13
YDR285W_BY4741   1   -------------------------------------MSNFFRDSSMGFK   13
YDR285W_BY4742   1   -------------------------------------MSNFFRDSSMGFK   13
YDR285W_CBS7960   1   -------------------------------------MSNFFRDSSMGFK   13
YDR285W_CEN.PK   1   -------------------------------------MSNFFRDSSMGFK   13
YDR285W_CLIB215   1   -------------------------------------MSNFFRDSSMGFK   13
YDR285W_D273-10B   1   -------------------------------------MSNFFRDSSMGFK   13
YDR285W_DBVPG6044   1   -------------------------------------MSNFFRDSSMGFK   13
YDR285W_EC1118   1   -------------------------------------MSNFFRDSSMGFK   13
YDR285W_EC9-8   1   -------------------------------------MSNFFRDSSMGFK   13
YDR285W_FL100   1   -------------------------------------MSNFFRDSSMGFK   13
YDR285W_FY1679   1   -------------------------------------MSNFFRDSSMGFK   13
YDR285W_FostersB   
   --------------------------------------------------   
YDR285W_FostersO   
   --------------------------------------------------   
YDR285W_JAY291   1   -------------------------------------MSNFFRDSSMGFK   13
YDR285W_JK9-3d   1   -------------------------------------MSNFFRDSSMGFK   13
YDR285W_K11   1   -------------------------------------MSNFFRDSSMGFK   13
YDR285W_Kyokai7   1   -------------------------------------MSNFFRDSSMGFK   13
YDR285W_L1528   1   -------------------------------------MSNFFRDSSMGFK   13
YDR285W_LalvinQA23   
   --------------------------------------------------   
YDR285W_PW5   1   -------------------------------------MSNFFRDSSMGFK   13
YDR285W_RM11-1a   1   -------------------------------------MSNFFRDSSMGFK   13
YDR285W_SEY6210   1   -------------------------------------MSNFFRDSSMGFK   13
YDR285W_SK1   1   -------------------------------------MSNFFRDSSMGFK   13
YDR285W_T7   1   -------------------------------------MSNFFRDSSMGFK   13
YDR285W_UC5   1   -------------------------------------MSNFFRDSSMGFK   13
YDR285W_UWOPS05_217_3   1   -------------------------------------MSNFFRDSSMGFK   13
YDR285W_VL3   
   --------------------------------------------------   
YDR285W_Vin13   5   KEIEYLKRELDDCSGQLSEEKIKNSSLIQEMGKNREEMIKSIENFFSEDK   54
YDR285W_W303   1   -------------------------------------MSNFFRDSSMGFK   13
YDR285W_X2180-1A   1   -------------------------------------MSNFFRDSSMGFK   13
YDR285W_Y10   301   KEIEYLKRELDDCSGQLSEEKIKNSSLIQEMGKNREEMIKSIENFFSEDK   350
YDR285W_Y55   1   -------------------------------------MSNFFRDSSMGFK   13
YDR285W_YJM269   
   --------------------------------------------------   
YDR285W_YJM339   1   -------------------------------------MSNFFRDSSMGFK   13
YDR285W_YJM789   1   -------------------------------------MSNFFRDSSMGFK   13
YDR285W_YPH499   1   -------------------------------------MSNFFRDSSMGFK   13
YDR285W_YPS128   1   -------------------------------------MSNFFRDSSMGFK   13
YDR285W_YPS163   1   -------------------------------------MSNFFRDSSMGFK   13
YDR285W_YS9   1   -------------------------------------MSNFFRDSSMGFK   13
YDR285W_ZTW1   1   -------------------------------------MSNFFRDSSMGFK   13
         

YDR285W_S288C   14   PRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPHKTS   63
YDR285W_AWRI1631   14   PRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPHKTS   63
YDR285W_AWRI796   14   PRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPHKTS   63
YDR285W_BC187   14   PRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPHKTS   63
YDR285W_BY4741   14   PRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPHKTS   63
YDR285W_BY4742   14   PRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPHKTS   63
YDR285W_CBS7960   14   PRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPHKTS   63
YDR285W_CEN.PK   14   PRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPHKTS   63
YDR285W_CLIB215   14   PRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPHKTS   63
YDR285W_D273-10B   14   PRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPHKTS   63
YDR285W_DBVPG6044   14   PRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPHKTS   63
YDR285W_EC1118   14   PRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPHKTS   63
YDR285W_EC9-8   14   PRPNIFAKLRVRDVDSDSSANTVVEYSSNCLDVGSSIEGDDTFKKPHKTS   63
YDR285W_FL100   14   PRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPHKTS   63
YDR285W_FY1679   14   PRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPHKTS   63
YDR285W_FostersB   1   ---------------------------------------MIPSKKPHKTS   11
YDR285W_FostersO   
   --------------------------------------------------   
YDR285W_JAY291   14   PRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPHKTS   63
YDR285W_JK9-3d   14   PRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPHKTS   63
YDR285W_K11   14   PRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPHKTS   63
YDR285W_Kyokai7   14   PRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPHKTS   63
YDR285W_L1528   14   PRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPHKTS   63
YDR285W_LalvinQA23   1   ---------------------------------------MIPSKNPHKTS   11
YDR285W_PW5   14   PRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIKGDDTFKKPHKTS   63
YDR285W_RM11-1a   14   PRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPHKTS   63
YDR285W_SEY6210   14   PRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPHKTS   63
YDR285W_SK1   14   PRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPHKTS   63
YDR285W_T7   14   PRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPHKTS   63
YDR285W_UC5   14   PRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPHKTS   63
YDR285W_UWOPS05_217_3   14   PRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPHKTS   63
YDR285W_VL3   1   ---------------------------------------MIPSXKPHKTS   11
YDR285W_Vin13   55   AHHLLQFNKFEERVHDLFEKKLQKHFDVAKDTLNVGLRNTTVELSSNTET   104
YDR285W_W303   14   PRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPHKTS   63
YDR285W_X2180-1A   14   PRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPHKTS   63
YDR285W_Y10   351   AHHLLQFNKFEERVHDLFEKKLQKHFDVAKDTLNVGLRNTTVELSSNTET   400
YDR285W_Y55   14   PRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPHKTS   63
YDR285W_YJM269   
   --------------------------------------------------   
YDR285W_YJM339   14   PRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPHKTS   63
YDR285W_YJM789   14   PRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPHKTS   63
YDR285W_YPH499   14   PRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPHKTS   63
YDR285W_YPS128   14   PRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPHKTS   63
YDR285W_YPS163   14   PRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPHKTS   63
YDR285W_YS9   14   PRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPHKTS   63
YDR285W_ZTW1   14   PRPNIFAKLRVRDVDSDSSANTVVENSSNCLDVGSSIEGDDTFKKPHKTS   63
         

YDR285W_S288C   64   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   113
YDR285W_AWRI1631   64   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   113
YDR285W_AWRI796   64   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   113
YDR285W_BC187   64   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   113
YDR285W_BY4741   64   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   113
YDR285W_BY4742   64   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   113
YDR285W_CBS7960   64   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   113
YDR285W_CEN.PK   64   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   113
YDR285W_CLIB215   64   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   113
YDR285W_D273-10B   64   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   113
YDR285W_DBVPG6044   64   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   113
YDR285W_EC1118   64   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   113
YDR285W_EC9-8   64   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   113
YDR285W_FL100   64   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   113
YDR285W_FY1679   64   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   113
YDR285W_FostersB   12   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   61
YDR285W_FostersO   
   --------------------------------------------------   
YDR285W_JAY291   64   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   113
YDR285W_JK9-3d   64   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   113
YDR285W_K11   64   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   113
YDR285W_Kyokai7   64   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   113
YDR285W_L1528   64   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   113
YDR285W_LalvinQA23   12   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   61
YDR285W_PW5   64   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   113
YDR285W_RM11-1a   64   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   113
YDR285W_SEY6210   64   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   113
YDR285W_SK1   64   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   113
YDR285W_T7   64   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   113
YDR285W_UC5   64   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   113
YDR285W_UWOPS05_217_3   64   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   113
YDR285W_VL3   12   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   61
YDR285W_Vin13   105   MLKQQYEDIKENLEQKMSSSKDEMAKTINELSVTQKGLIMGVQEELLTSS   154
YDR285W_W303   64   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   113
YDR285W_X2180-1A   64   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   113
YDR285W_Y10   401   MLKQQYEDIKENLEQKLSSSKDEMAKTINELSVTQKGLIMGVQEELLTSS   450
YDR285W_Y55   64   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   113
YDR285W_YJM269   1   MLKQQYEDIKENLEQKLSSSKDEMAKTINELSVTQKGLIMGVQEELLTSS   50
YDR285W_YJM339   64   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   113
YDR285W_YJM789   64   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   113
YDR285W_YPH499   64   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   113
YDR285W_YPS128   64   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   113
YDR285W_YPS163   64   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   113
YDR285W_YS9   64   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   113
YDR285W_ZTW1   64   TEQELITSMSLSQRNHGYSDDMEIGSPKKTTSTDQYNRILKNDVAAIEND   113
         

YDR285W_S288C   114   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   163
YDR285W_AWRI1631   114   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   163
YDR285W_AWRI796   114   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   163
YDR285W_BC187   114   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   163
YDR285W_BY4741   114   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   163
YDR285W_BY4742   114   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   163
YDR285W_CBS7960   114   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   163
YDR285W_CEN.PK   114   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   163
YDR285W_CLIB215   114   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   163
YDR285W_D273-10B   114   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   163
YDR285W_DBVPG6044   114   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   163
YDR285W_EC1118   114   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   163
YDR285W_EC9-8   114   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   163
YDR285W_FL100   114   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   163
YDR285W_FY1679   114   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   163
YDR285W_FostersB   62   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   111
YDR285W_FostersO   1   ---------------------------------------MHEYTMTNGKA   11
YDR285W_JAY291   114   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   163
YDR285W_JK9-3d   114   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   163
YDR285W_K11   114   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   163
YDR285W_Kyokai7   114   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   163
YDR285W_L1528   114   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   163
YDR285W_LalvinQA23   62   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   111
YDR285W_PW5   114   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   163
YDR285W_RM11-1a   114   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   163
YDR285W_SEY6210   114   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   163
YDR285W_SK1   114   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   163
YDR285W_T7   114   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   163
YDR285W_UC5   114   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   163
YDR285W_UWOPS05_217_3   114   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   163
YDR285W_VL3   62   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   111
YDR285W_Vin13   155   GNIQTALVSEMNNTRQELLDDASQTAKNYASLENLVKAYKAEIVQSNEYE   204
YDR285W_W303   114   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   163
YDR285W_X2180-1A   114   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   163
YDR285W_Y10   451   GNIQTALVSEMNNTRQELLDDASQTAKNYASLENLVKAYKAEIVQSNEYE   500
YDR285W_Y55   114   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   163
YDR285W_YJM269   51   GNIQTALVSEMNNTRQELLDDASQTAKNYASLENLVKAYKAEIVQSNEYE   100
YDR285W_YJM339   114   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   163
YDR285W_YJM789   114   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   163
YDR285W_YPH499   114   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   163
YDR285W_YPS128   114   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   163
YDR285W_YPS163   114   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   163
YDR285W_YS9   114   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   163
YDR285W_ZTW1   114   TDEDFEITEVREVSEGVAKETKESHGDPNDSETTLKDSKMHEYTMTNGKA   163
         

YDR285W_S288C   164   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   213
YDR285W_AWRI1631   164   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   213
YDR285W_AWRI796   164   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   213
YDR285W_BC187   164   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   213
YDR285W_BY4741   164   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   213
YDR285W_BY4742   164   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   213
YDR285W_CBS7960   164   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   213
YDR285W_CEN.PK   164   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   213
YDR285W_CLIB215   164   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   213
YDR285W_D273-10B   164   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   213
YDR285W_DBVPG6044   164   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   213
YDR285W_EC1118   164   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   213
YDR285W_EC9-8   164   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   213
YDR285W_FL100   164   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   213
YDR285W_FY1679   164   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   213
YDR285W_FostersB   112   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   161
YDR285W_FostersO   12   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   61
YDR285W_JAY291   164   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   213
YDR285W_JK9-3d   164   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   213
YDR285W_K11   164   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   213
YDR285W_Kyokai7   164   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   213
YDR285W_L1528   164   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   213
YDR285W_LalvinQA23   112   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   161
YDR285W_PW5   164   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   213
YDR285W_RM11-1a   164   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   213
YDR285W_SEY6210   164   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   213
YDR285W_SK1   164   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   213
YDR285W_T7   164   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   213
YDR285W_UC5   164   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   213
YDR285W_UWOPS05_217_3   164   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   213
YDR285W_VL3   112   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   161
YDR285W_Vin13   205   ERIKHLESERSTLSSQKNQIISSLGTKEAQYEDLVKKLEAKNIEISQISG   254
YDR285W_W303   164   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   213
YDR285W_X2180-1A   164   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   213
YDR285W_Y10   501   ERIKHLESERSTLSSQKNQIISSLGTKEAQYEDLVKKLEAKNIEISQISG   550
YDR285W_Y55   164   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   213
YDR285W_YJM269   101   ERIKHLESERSTLSSQKNQIISSLGTKEAQYEDLVKKLEAKNIEISQISG   150
YDR285W_YJM339   164   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   213
YDR285W_YJM789   164   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   213
YDR285W_YPH499   164   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   213
YDR285W_YPS128   164   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   213
YDR285W_YPS163   164   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   213
YDR285W_YS9   164   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   213
YDR285W_ZTW1   164   PLHTSINNSSTSSNDVLLEAFTNTQRICSNLKQELQKQQQDNAKLKVRLQ   213
         

YDR285W_S288C   214   SYASNSDKINEKVGKYKSCLETLQERIATLTSHKNNQETKLKDLRQNHQL   263
YDR285W_AWRI1631   214   SYASNSDKINEKVGKYKSCLETLQERIATLTSHKNNQETKLKDLRQNHQL   263
YDR285W_AWRI796   214   SYASNSDKINEKVGKYKSCLETLQERIATLTSHKNNQETKLKDLRQNHQL   263
YDR285W_BC187   214   SYASNSDKINEKVGKYKSCLETLQERIATLTS<