NUS1/YDL193W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YDL193W_S288C   1   MPTMIKKDDKAMEPPNEKPHRKIERDDVPESSNHIPPPESGVLKGGKVNS   50
YDL193W_AWRI1631   1   MPTMIKKDDKAMEPPNEKPHRKIERDDVPESSNHIPPPESGVLKGGKVNS   50
YDL193W_AWRI796   
   --------------------------------------------------   
YDL193W_BC187   1   MPTMIKKDDKAMEPPNEKPHRKIERDDVPESSNHIPPPESGVLKGGKVNS   50
YDL193W_BY4741   1   MPTMIKKDDKAMEPPNEKPHRKIERDDVPESSNHIPPPESGVLKGGKVNS   50
YDL193W_BY4742   1   MPTMIKKDDKAMEPPNEKPHRKIERDDVPESSNHIPPPESGVLKGGKVNS   50
YDL193W_CBS7960   1   MPTMIKKDDKAMEPPNEKPHRKIERDDVPESSNHIPPPESGVLKGGKVNS   50
YDL193W_CEN.PK   1   MPTMIKKDDKAMEPPNEKPHRKIERDDVPESSNHIPPPESGVLKGGKVNS   50
YDL193W_D273-10B   1   MPTMIKKDDKAMEPPNEKPHRKIERDDVPESSNHIPPPESGVLKGGKVNS   50
YDL193W_EC1118   1   MPTMIKKDDKAMEPPNEKPHRKIERDDVPESSNHIPPPESGVLKGGKVNS   50
YDL193W_EC9-8   1   MPTMIKKDDKAMEPPNEKPHRKIERDDVPESSNHIPPPESGVLKGGKVNS   50
YDL193W_FL100   1   MPTMIKKDDKAMEPPNEKPHRKIERDDVPESSNHIPPPESGVLKGGKVNS   50
YDL193W_FY1679   1   MPTMIKKDDKAMEPPNEKPHRKIERDDVPESSNHIPPPESGVLKGGKVNS   50
YDL193W_FostersB   1   MPTMIKKDDKAMEPPNEKPHRKIERDDVPESSNHIPPPESGVLKGGKVNS   50
YDL193W_FostersO   
   --------------------------------------------------   
YDL193W_JAY291   1   MPTMIKKDDKAMEPPNEKPHRKIERDDVPESSNHIPPPESGVLKGGKVNS   50
YDL193W_JK9-3d   1   MPTMIKKDDKAMEPPNEKPHRKIERDDVPESSNHIPPPESGVLKGGKVNS   50
YDL193W_K11   1   MPTMIKKDDKAMEPPNEKPHRKIERDDVPESSNHIPPPESGVLKGGKVNS   50
YDL193W_Kyokai7   1   MPTMIKKDDKAMEPPNEKPHRKIERDDVPESSNHIPPPESGVLKGGKVNS   50
YDL193W_LalvinQA23   
   --------------------------------------------------   
YDL193W_PW5   1   MPTMIKKDDKAMEPPNEKPHRKIERDDVPESSNHIPPPESGVLKGGKVNS   50
YDL193W_RM11-1a   1   MPTMIKKDDKAMEPPNEKPHRKIERDDVPESSNHIPPPESGVLKGGKVNS   50
YDL193W_RedStar   1   MPTMIKKDDKAMEPPNEKPHRKIERDDVPESSNHIPPPESGVLKGGKVNS   50
YDL193W_SEY6210   1   MPTMIKKDDKAMEPPNEKPHRKIERDDVPESSNHIPPPESGVLKGGKVNS   50
YDL193W_SK1   1   MPTMIKKDDKAMEPPNEKPHRKIERDDVPESSNHIPPPESGVLKGGKVNS   50
YDL193W_T7   1   MPTMIKKDDKAMEPPNEKPHRKIERDDVPESSNHIPPPESGVLKGGKVNS   50
YDL193W_T73   1   MPTMIKKDDKAMEPPNEKPHRKIERDDVPESSNHIPPPESGVLKGGKVNS   50
YDL193W_UC5   1   MPTMIKKDDKAMEPPNEKPHRKIERDDVPESSNHIPPPESGVLKGGKVNS   50
YDL193W_UWOPS05_217_3   1   MPTMIKKDDKAMEPPNEKPHRKIERDDVPESSNHIPPPESGVLKGGKVNS   50
YDL193W_VL3   
   --------------------------------------------------   
YDL193W_Vin13   
   --------------------------------------------------   
YDL193W_W303   1   MPTMIKKDDKAMEPPNEKPHRKIERDDVPESSNHIPPPESGVLKGGKVNS   50
YDL193W_X2180-1A   1   MPTMIKKDDKAMEPPNEKPHRKIERDDVPESSNHIPPPESGVLKGGKVNS   50
YDL193W_Y55   1   MPTMIKKDDKAMEPPNEKPHRKIERDDVPESSNHIPPPESGVLKGGKVNS   50
YDL193W_YJM269   1   MPTMIKKDDKAMEPPNEKPHRKIERDDVPESSNHIPPPESGVLKGGKVNS   50
YDL193W_YJM339   1   MPTMIKKDDKAMEPPNEKPHRKIERDDVPESSNHIPPPESGVLKGGKVNS   50
YDL193W_YJM789   1   MPTMIKKDDKAMEPPNEKPHRKIERDDVPESSNHIPPPESGVLKGGKVNS   50
YDL193W_YPH499   1   MPTMIKKDDKAMEPPNEKPHRKIERDDVPESSNHIPPPESGVLKGGKVNS   50
YDL193W_YPS128   1   MPTMIKKDDKAMEPPNEKPHRKIERDDVPESSNHIPPPESGVLKGGKVNS   50
YDL193W_YPS163   1   MPTMIKKDDKAMEPPNEKPHRKIERDDVPESSNHIPPPESGVLKGGKVNS   50
YDL193W_YS9   1   MPTMIKKDDKAMEPPNEKPHRKIERDDVPESSNHIPPPESGVLKGGKVNS   50
YDL193W_ZTW1   1   MPTMIKKDDKAMEPPNEKPHRKIERDDVPESSNHIPPPESGVLKGGKVNS   50
         

YDL193W_S288C   51   KTRALKAVTSIIADADENPQKKVNNETNGVQKQKTEDLSKRIGKFEYLFY   100
YDL193W_AWRI1631   51   KTRALKAVTSIIADADENPQKKVNNETNGVQKQKTEDLSKRIGKFEYLFY   100
YDL193W_AWRI796   
   --------------------------------------------------   
YDL193W_BC187   51   KTRALKAVTSIIADADENPQKKVNNETNGVQKQKTEDLSKRIGKFEYLFY   100
YDL193W_BY4741   51   KTRALKAVTSIIADADENPQKKVNNETNGVQKQKTEDLSKRIGKFEYLFY   100
YDL193W_BY4742   51   KTRALKAVTSIIADADENPQKKVNNETNGVQKQKTEDLSKRIGKFEYLFY   100
YDL193W_CBS7960   51   KTRALKAVTSIIADADENPQKKVNNETNGVQKQKTEDLSKRIGKFEYLFY   100
YDL193W_CEN.PK   51   KTRALKAVTSIIADADENPQKKVNNETNGVQKQKTEDLSKRIGKFEYLFY   100
YDL193W_D273-10B   51   KTRALKAVTSIIADADENPQKKVNNETNGVQKQKTEDLSKRIGKFEYLFY   100
YDL193W_EC1118   51   KTRALKAVTSIIADADENPQKKVNNETNGVQKQKTEDLSKRIGKFEYLFY   100
YDL193W_EC9-8   51   KTRALKAVTSIIADADENPQKKVSNETNGVQKQKTEDLSKRIGKFEYLFY   100
YDL193W_FL100   51   KTRALKAVTSIIADADENPQKKVSNETNGVQKQKTEDLSKRIGKFEYLFY   100
YDL193W_FY1679   51   KTRALKAVTSIIADADENPQKKVNNETNGVQKQKTEDLSKRIGKFEYLFY   100
YDL193W_FostersB   51   KTRALKAVTSIIADADENPQKKVNNETNGVQKQKTEDLSKRIGKFEYLFY   100
YDL193W_FostersO   
   --------------------------------------------------   
YDL193W_JAY291   51   KTRALKAVTSIIADADENPQKKVNNETNGVQKQKTEDLSKRIGKFEYLFY   100
YDL193W_JK9-3d   51   KTRALKAVTSIIADADENPQKKVNNETNGVQKQKTEDLSKRIGKFEYLFY   100
YDL193W_K11   51   KTRALKAVTSIIADADENPQKKVSNETNGVQKQKTEDLSKRIGKFEYLFY   100
YDL193W_Kyokai7   51   KTRALKAVTSIIADADENPQKKVSNETNGVQKQKTEDLSKRIGKFEYLFY   100
YDL193W_LalvinQA23   
   --------------------------------------------------   
YDL193W_PW5   51   KTRALKAVTSIIADADENPQKKVNNETNGVQKQKTEDLSKRIGKFEYLFY   100
YDL193W_RM11-1a   51   KTRALKAVTSIIADADENPQKKVNNETNGVQKQKTEDLSKRIGKFEYLFY   100
YDL193W_RedStar   51   KTRALKAVTSIIADADENPQKKVNNETNGVQKQKTEDLSKRIGKFEYLFY   100
YDL193W_SEY6210   51   KTRALKAVTSIIADADENPQKKVNNETNGVQKQKTEDLSKRIGKFEYLFY   100
YDL193W_SK1   51   KTRALKAVTSIIADADENPQKKVNNETNGVQKQKTEDLSKRIGKFEYLFY   100
YDL193W_T7   51   KTRALKAVTSIIADADENPQKKVNNETNGVQKQKTEDLSKRIGKFEYLFY   100
YDL193W_T73   51   KTRALKAVTSIIADADENPQKKVNNETNGVQKQKTEDLSKRIGKFEYLFY   100
YDL193W_UC5   51   KTRALKAVTSIIADADENPQKKVSNETNGVQKQKTEDLSKRIGKFEYLFY   100
YDL193W_UWOPS05_217_3   51   KTRALKAVTSIIADADENPQKKVNNETNGVQKQKTEDLSKRIGKFEYLFY   100
YDL193W_VL3   
   --------------------------------------------------   
YDL193W_Vin13   
   --------------------------------------------------   
YDL193W_W303   51   KTRALKAVTSIIADADENPQKKVNNETNGVQKQKTEDLSKRIGKFEYLFY   100
YDL193W_X2180-1A   51   KTRALKAVTSIIADADENPQKKVNNETNGVQKQKTEDLSKRIGKFEYLFY   100
YDL193W_Y55   51   KTRALKAVTSIIADADENPQKKVNNETNGVQKQKTEDLSKRIGKFEYLFY   100
YDL193W_YJM269   51   KTRALKAVTSIIADADENPQKKVNNETNGVQKQKTEDLSKRIGKFEYLFY   100
YDL193W_YJM339   51   KTRALKAVTSIIADADENPQKKVNNETNGVQKQKTEDLSKRIGKFEYLFY   100
YDL193W_YJM789   51   KTRALKAVTSIIADADENPQKKVNNETNGVQKQKTEDLSKRIGKFEYLFY   100
YDL193W_YPH499   51   KTRALKAVTSIIADADENPQKKVNNETNGVQKQKTEDLSKRIGKFEYLFY   100
YDL193W_YPS128   51   KTRALKAVTSIIADADENPQKKVNNETNGVQKQKTEDLSKRIGKFEYLFY   100
YDL193W_YPS163   51   KTRALKAVTSIIADADENPQKKVNNETNGVQKQKTEDLSKRIGKFEYLFY   100
YDL193W_YS9   51   KTRALKAVTSIIADADENPQKKVNNETNGVQKQKTEDLSKRIGKFEYLFY   100
YDL193W_ZTW1   51   KTRALKAVTSIIADADENPQKKVSNETNGVQKQKTEDLSKRIGKFEYLFY   100
         

YDL193W_S288C   101   KFLLVLLYICFGLFRYGQYQYNKMKLRIFSIIYNHAYTPQLIRQDVIPLK   150
YDL193W_AWRI1631   101   KFLLVLLYICFGSFRYGQYQYHKMKLRIFSIIYNHAYTPQLIRQDVIPLK   150
YDL193W_AWRI796   
   --------------------------------------------------   
YDL193W_BC187   101   KFLLVLLYICFGSFRYGQYQYHKMKLRIFSIIYNHAYTPQLIRQDVIPLK   150
YDL193W_BY4741   101   KFLLVLLYICFGLFRYGQYQYNKMKLRIFSIIYNHAYTPQLIRQDVIPLK   150
YDL193W_BY4742   101   KFLLVLLYICFGLFRYGQYQYNKMKLRIFSIIYNHAYTPQLIRQDVIPLK   150
YDL193W_CBS7960   101   KFLLVLLYICFGSFRYGQYQYHKMKLRIFSIIYNHAYTPQLIRQDVIPLK   150
YDL193W_CEN.PK   101   KFLLVLLYICFGLFRYGQYQYNKMKLRIFSIIYNHAYTPQLIRQDVIPLK   150
YDL193W_D273-10B   101   KFLLVLLYICFGLFRYGQYQYHKMKLRIFSIIYNHAYTPQLIRQDVIPLK   150
YDL193W_EC1118   101   KFLLVLLYICFGSFRYGQYQYHKMKLRIFSIIYNHAYTPQLIRQDVIPLK   150
YDL193W_EC9-8   101   KFLLVLLYICFGLFRYGQYQYHKMKLRIFSIIYNHAYTPQLIRQDVIPLK   150
YDL193W_FL100   101   KFLLVLLYICFGLFRYGQYQYHKMKLRIFSIIYNHAYTPQLIRQDVIPLK   150
YDL193W_FY1679   101   KFLLVLLYICFGLFRYGQYQYNKMKLRIFSIIYNHAYTPQLIRQDVIPLK   150
YDL193W_FostersB   101   KFLLVLLYICFGXFRYGQYQYHKMKLRIFSIIYNHAYTPQLIRQDVIPLK   150
YDL193W_FostersO   
   --------------------------------------------------   
YDL193W_JAY291   101   KFLLVLLYICFGSFRYGQYQYHKMKLRIFSIIYNHAYTPQLIRQDVIPLK   150
YDL193W_JK9-3d   101   KFLLVLLYICFGLFRYGQYQYNKMKLRIFSIIYNHAYTPQLIRQDVIPLK   150
YDL193W_K11   101   KFLLVLLYICFGLFRYGQYQYHKMKLRIFSIIYNHAYTPQLIRQDVIPLK   150
YDL193W_Kyokai7   101   KFLLVLLYICFGLFRYGQYQYHKMKLRIFSIIYNHAYTPQLIRQDVIPLK   150
YDL193W_LalvinQA23   
   --------------------------------------------------   
YDL193W_PW5   101   KFLLVLLYICFGLFRYGQYQYNKMKLRIFSIIYNHAYTPQLIRQDVIPLK   150
YDL193W_RM11-1a   101   KFLLVLLYICFGSFRYGQYQYHKMKLRIFSIIYNHAYTPQLIRQDVIPLK   150
YDL193W_RedStar   101   KFLLVLLYICFGLFRYGQYQYNKMKLRIFSIIYNHAYTPQLIRQDVIPLK   150
YDL193W_SEY6210   101   KFLLVLLYICFGLFRYGQYQYNKMKLRIFSIIYNHAYTPQLIRQDVIPLK   150
YDL193W_SK1   101   KFLLVLLYICFGLFRYGQYQYNKMKLRIFSIIYNHAYTPQLIRQDVIPLK   150
YDL193W_T7   101   KFLLVLLYICFGLFRYGQYQYNKMKLRIFSIIYNHAYTPQLIRQDVIPLK   150
YDL193W_T73   101   KFLLVLLYICFGSFRYGQYQYHKMKLRIFSIIYNHAYTPQLIRQDVIPLK   150
YDL193W_UC5   101   KFLLVLLYICFGLFRYGQYQYHKMKLRIFSIIYNHAYTPQLIRQDVIPLK   150
YDL193W_UWOPS05_217_3   101   KFLLVLLYICFGLFRYGQYQYNKMKLRIFSIIYNHAYTPQLIRQDVIPLK   150
YDL193W_VL3   
   --------------------------------------------------   
YDL193W_Vin13   
   --------------------------------------------------   
YDL193W_W303   101   KFLLVLLYICFGLFRYGQYQYNKMKLRIFSIIYNHAYTPQLIRQDVIPLK   150
YDL193W_X2180-1A   101   KFLLVLLYICFGLFRYGQYQYNKMKLRIFSIIYNHAYTPQLIRQDVIPLK   150
YDL193W_Y55   101   KFLLVLLYICFGSFRYGQYQYHKMKLRIFSIIYNHAYTPQLIRQDVIPLK   150
YDL193W_YJM269   101   KFLLVLLYICFGLFRYGQYQYNKMKLRIFSIIYNHAYTPQLIRQDVIPLK   150
YDL193W_YJM339   101   KFLLVLLYICFGSFRYGQYQYHKMKLRIFSIIYNHAYTPQLIRQDVIPLK   150
YDL193W_YJM789   101   KFLLVLLYICFGSFRYGQYQYHKMKLRIFSIIYNHAYTPQLIRQDVIPLK   150
YDL193W_YPH499   101   KFLLVLLYICFGLFRYGQYQYNKMKLRIFSIIYNHAYTPQLIRQDVIPLK   150
YDL193W_YPS128   101   KFLLVLLYICFGLFRYGQYQYNKMKLRIFSIIYNHAYTPQLIRQDVIPLK   150
YDL193W_YPS163   101   KFLLVLLYICFGLFRYGQYQYNKMKLRIFSIIYNHAYTPQLIRQDVIPLK   150
YDL193W_YS9   101   KFLLVLLYICFGLFRYGQYQYNKMKLRIFSIIYNHAYTPQLIRQDVIPLK   150
YDL193W_ZTW1   101   KFLLVLLYICFGLFRYGQYQYHKMKLRIFSIIYNHAYTPQLIRQDVIPLK   150
         

YDL193W_S288C   151   KIPKRLAAILEVKPVGDVGGGVTGLLNDASEIVCWTVSAGIKHLMLYDYD   200
YDL193W_AWRI1631   151   KIPKRLAAILEVKPVGDVGGGVTGLLNDASEIVCWTVSAGIKHLMLYDYD   200
YDL193W_AWRI796   1   --------------------------------------------MLYDYD   6
YDL193W_BC187   151   KIPKRLAAILEVKPVGDVGGGVTGLLNDASEIVCWTVSAGIKHLMLYDYD   200
YDL193W_BY4741   151   KIPKRLAAILEVKPVGDVGGGVTGLLNDASEIVCWTVSAGIKHLMLYDYD   200
YDL193W_BY4742   151   KIPKRLAAILEVKPVGDVGGGVTGLLNDASEIVCWTVSAGIKHLMLYDYD   200
YDL193W_CBS7960   151   KIPKRLAAILEVKPVGDVGGGVTGLLNDASEIVCWTVSAGIKHLMLYDYD   200
YDL193W_CEN.PK   151   KIPKRLAAILEVKPVGDVGGGVTGLLNDASEIVCWTVSAGIKHLMLYDYD   200
YDL193W_D273-10B   151   KIPKRLAAILEVKPVGDVGGGVTGLLNDASEIVCWTVSAGIKHLMLYDYD   200
YDL193W_EC1118   151   KIPKRLAAILEVKPVGDVGGGVTGLLNDASEIVCWTVSAGIKHLMLYDYD   200
YDL193W_EC9-8   151   KIPKRLAAILEVKPVGDVGGGVTGLLNDASEIVCWTVSAGIKHLMLYDYD   200
YDL193W_FL100   151   KMPKRLAAILEVKPVGDVGGGVTGLLNDASEIVCWTVSAGIKHLMLYDYD   200
YDL193W_FY1679   151   KIPKRLAAILEVKPVGDVGGGVTGLLNDASEIVCWTVSAGIKHLMLYDYD   200
YDL193W_FostersB   151   KNS-----------------------------------------------   153
YDL193W_FostersO   1   --------------------------------------------MLYDYD   6
YDL193W_JAY291   151   KIPKRLAAILEVKPVGDVGGGVTGLLNDASEIVCWTVSAGIKHLMLYDYD   200
YDL193W_JK9-3d   151   KIPKRLAAILEVKPVGDVGGGVTGLLNDASEIVCWTVSAGIKHLMLYDYD   200
YDL193W_K11   151   KIPKRLAAILEVKPVGDVGGGVTGLLNDASEIVCWTVSAGIKHLMLYDYD   200
YDL193W_Kyokai7   151   KIPKRLAAILEVKPVGDVGGGVTGLLNDASEIVCWTVSAGIKHLMLYDYD   200
YDL193W_LalvinQA23   1   --------------------------------------------MLYDYD   6
YDL193W_PW5   151   KIPKRLAAILEVKPVGDVGGGVTGLLNDASEIVCWTVSAGIKHLMLYDYD   200
YDL193W_RM11-1a   151   KIPKRLAAILEVKPVGDVGGGVTGLLNDASEIVCWTVSAGIKHLMLYDYD   200
YDL193W_RedStar   151   KIPKRLAAILEVKPVGDVGGGVTGLLNDASEIVCWTVSAGIKHLMLYDYD   200
YDL193W_SEY6210   151   KIPKRLAAILEVKPVGDVGGGVTGLLNDASEIVCWTVSAGIKHLMLYDYD   200
YDL193W_SK1   151   KIPKRLAAILEVKPVGDVGGGVTGLLNDASEIVCWTVSAGIKHLMLYDYD   200
YDL193W_T7   151   KIPKRLAAILEVKPVGDVGGGVTGLLNDASEIVCWTVSAGIKHLMLYDYD   200
YDL193W_T73   151   KIPKRLAAILEVKPVGDVGGGVTGLLNDASEIVCWTVSAGIKHLMLYDYD   200
YDL193W_UC5   151   KIPKRLAAILEVKPVGDVGGGVTGLLNDASEIVCWTVSAGIKHLMLYDYD   200
YDL193W_UWOPS05_217_3   151   KIPKRLAAILEVKPVGDVGGGVTGLLNDASEIVCWTVSAGIKHLMLYDYD   200
YDL193W_VL3   1   --------------------------------------------MLYDYD   6
YDL193W_Vin13   1   --------------------------------------------MLYDYD   6
YDL193W_W303   151   KIPKRLAAILEVKPVGDVGGGVTGLLNDASEIVCWTVSAGIKHLMLYDYD   200
YDL193W_X2180-1A   151   KIPKRLAAILEVKPVGDVGGGVTGLLNDASEIVCWTVSAGIKHLMLYDYD   200
YDL193W_Y55   151   KIPKRLAAILEVKPVGDVGGGVTGLLNDASEIVCWTVSAGIKHLMLYDYD   200
YDL193W_YJM269   151   KIPKRLAAILEVKPVGDVGGGVTGLLNDASEIVCWTVSAGIKHLMLYDYD   200
YDL193W_YJM339   151   KIPKRLAAILEVKPVGDVGGGVTGLLNDASEIVCWTVSAGIKHLMLYDYD   200
YDL193W_YJM789   151   KIPKRLAAILEVKPVGDVGGGVTGLLNDASEIVCWTVSAGIKHLMLYDYD   200
YDL193W_YPH499   151   KIPKRLAAILEVKPVGDVGGGVTGLLNDASEIVCWTVSAGIKHLMLYDYD   200
YDL193W_YPS128   151   KIPKRLAAILEVKPVGDVGGGVTGLLNDASEIVCWTVSAGIKHLMLYDYD   200
YDL193W_YPS163   151   KIPKRLAAILEVKPVGDVGGGVTGLLNDASEIVCWTVSAGIKHLMLYDYD   200
YDL193W_YS9   151   KIPKRLAAILEVKPVGDVGGGVTGLLNDASEIVCWTVSAGIKHLMLYDYD   200
YDL193W_ZTW1   151   KIPKRLAAILEVKPVGDVGGGVTGLLNDASEIVCWTVSAGIKHLMLYDYD   200
         

YDL193W_S288C   201   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   250
YDL193W_AWRI1631   201   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   250
YDL193W_AWRI796   7   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   56
YDL193W_BC187   201   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   250
YDL193W_BY4741   201   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   250
YDL193W_BY4742   201   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   250
YDL193W_CBS7960   201   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   250
YDL193W_CEN.PK   201   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   250
YDL193W_D273-10B   201   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   250
YDL193W_EC1118   201   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   250
YDL193W_EC9-8   201   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   250
YDL193W_FL100   201   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   250
YDL193W_FY1679   201   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   250
YDL193W_FostersB   
   --------------------------------------------------   
YDL193W_FostersO   7   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   56
YDL193W_JAY291   201   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   250
YDL193W_JK9-3d   201   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   250
YDL193W_K11   201   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   250
YDL193W_Kyokai7   201   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   250
YDL193W_LalvinQA23   7   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   56
YDL193W_PW5   201   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   250
YDL193W_RM11-1a   201   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   250
YDL193W_RedStar   201   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   250
YDL193W_SEY6210   201   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   250
YDL193W_SK1   201   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   250
YDL193W_T7   201   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   250
YDL193W_T73   201   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   250
YDL193W_UC5   201   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   250
YDL193W_UWOPS05_217_3   201   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   250
YDL193W_VL3   7   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   56
YDL193W_Vin13   7   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   56
YDL193W_W303   201   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   250
YDL193W_X2180-1A   201   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   250
YDL193W_Y55   201   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   250
YDL193W_YJM269   201   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   250
YDL193W_YJM339   201   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   250
YDL193W_YJM789   201   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   250
YDL193W_YPH499   201   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   250
YDL193W_YPS128   201   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   250
YDL193W_YPS163   201   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   250
YDL193W_YS9   201   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   250
YDL193W_ZTW1   201   GILQRNVPELRMEIHSNLAKYFGPAHVPNYAVKIPHSNKIFYNLDGIETE   250
         

YDL193W_S288C   251   TDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV   300
YDL193W_AWRI1631   251   TDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV   300
YDL193W_AWRI796   57   TDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV   106
YDL193W_BC187   251   TDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV   300
YDL193W_BY4741   251   TDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV   300
YDL193W_BY4742   251   TDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV   300
YDL193W_CBS7960   251   TDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV   300
YDL193W_CEN.PK   251   TDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV   300
YDL193W_D273-10B   251   TDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV   300
YDL193W_EC1118   251   TDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV   300
YDL193W_EC9-8   251   IDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV   300
YDL193W_FL100   251   IDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV   300
YDL193W_FY1679   251   TDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV   300
YDL193W_FostersB   
   --------------------------------------------------   
YDL193W_FostersO   57   TDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMXELCAVNELSV   106
YDL193W_JAY291   251   TDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV   300
YDL193W_JK9-3d   251   TDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV   300
YDL193W_K11   251   IDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV   300
YDL193W_Kyokai7   251   IDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV   300
YDL193W_LalvinQA23   57   TDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMXELCAVNELSV   106
YDL193W_PW5   251   TDVGNEIEANQEKEKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV   300
YDL193W_RM11-1a   251   TDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV   300
YDL193W_RedStar   251   TDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV   300
YDL193W_SEY6210   251   TDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV   300
YDL193W_SK1   251   TDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV   300
YDL193W_T7   251   TDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV   300
YDL193W_T73   251   TDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV   300
YDL193W_UC5   251   IDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV   300
YDL193W_UWOPS05_217_3   251   TDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV   300
YDL193W_VL3   57   TDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV   106
YDL193W_Vin13   57   TDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV   106
YDL193W_W303   251   TDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV   300
YDL193W_X2180-1A   251   TDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV   300
YDL193W_Y55   251   TDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV   300
YDL193W_YJM269   251   TDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV   300
YDL193W_YJM339   251   TDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV   300
YDL193W_YJM789   251   TDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV   300
YDL193W_YPH499   251   TDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV   300
YDL193W_YPS128   251   TDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV   300
YDL193W_YPS163   251   TDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV   300
YDL193W_YS9   251   TDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV   300
YDL193W_ZTW1   251   IDVGNEIEANQEKDKIAIEISLLSNRDGRETIVDLTKTMAELCAVNELSV   300
         

YDL193W_S288C   301   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   350
YDL193W_AWRI1631   301   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   350
YDL193W_AWRI796   107   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   156
YDL193W_BC187   301   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   350
YDL193W_BY4741   301   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   350
YDL193W_BY4742   301   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   350
YDL193W_CBS7960   301   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   350
YDL193W_CEN.PK   301   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   350
YDL193W_D273-10B   301   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   350
YDL193W_EC1118   301   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   350
YDL193W_EC9-8   301   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   350
YDL193W_FL100   301   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   350
YDL193W_FY1679   301   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   350
YDL193W_FostersB   
   --------------------------------------------------   
YDL193W_FostersO   107   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   156
YDL193W_JAY291   301   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   350
YDL193W_JK9-3d   301   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   350
YDL193W_K11   301   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   350
YDL193W_Kyokai7   301   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   350
YDL193W_LalvinQA23   107   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   156
YDL193W_PW5   301   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   350
YDL193W_RM11-1a   301   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   350
YDL193W_RedStar   301   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   350
YDL193W_SEY6210   301   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   350
YDL193W_SK1   301   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   350
YDL193W_T7   301   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   350
YDL193W_T73   301   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   350
YDL193W_UC5   301   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   350
YDL193W_UWOPS05_217_3   301   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   350
YDL193W_VL3   107   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   156
YDL193W_Vin13   107   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   156
YDL193W_W303   301   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   350
YDL193W_X2180-1A   301   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   350
YDL193W_Y55   301   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   350
YDL193W_YJM269   301   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   350
YDL193W_YJM339   301   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   350
YDL193W_YJM789   301   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   350
YDL193W_YPH499   301   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   350
YDL193W_YPS128   301   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   350
YDL193W_YPS163   301   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   350
YDL193W_YS9   301   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   350
YDL193W_ZTW1   301   SDITMDLVDSELKQLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFYWEKD   350
         

YDL193W_S288C   351   NNEVIYSVFIRGLRQYAGCKVNVGK   375
YDL193W_AWRI1631   351   NNEVIYSVFIRGLRQYAGCKVNVGK   375
YDL193W_AWRI796   157   NNEVIYSVFIRGLRQYAGCKVNVGK   181
YDL193W_BC187   351   NNEVIYSVFIRGLRQYAGCKVNVGK   375
YDL193W_BY4741   351   NNEVIYSVFIRGLRQYAGCKVNVGK   375
YDL193W_BY4742   351   NNEVIYSVFIRGLRQYAGCKVNVGK   375
YDL193W_CBS7960   351   NNEVIYSVFIRGLRQYAGCKVNVGK   375
YDL193W_CEN.PK   351   NNEVIYSVFIRGLRQYAGCKVNVGK   375
YDL193W_D273-10B   351   NNEVIYSVFIRGLRQYAGCKVNVGK   375
YDL193W_EC1118   351   NNEVIYSVFIRGLRQYAGCKVNVGK   375
YDL193W_EC9-8   351   NNEVIYSVFIRGLRQYAGCKVNVGK   375
YDL193W_FL100   351   NNEVIYSVFIRGLRQYAGCKVNVGK   375
YDL193W_FY1679   351   NNEVIYSVFIRGLRQYAGCKVNVGK   375
YDL193W_FostersB   
   -------------------------   
YDL193W_FostersO   157   NNEVIYSVFIRGLRQYAGCKVNVGK   181
YDL193W_JAY291   351   NNEVIYSVFIRGLRQYAGCKVNVGK   375
YDL193W_JK9-3d   351   NNEVIYSVFIRGLRQYAGCKVNVGK   375
YDL193W_K11   351   NNEVIYSVFIRGLRQYAGCKVNVGK   375
YDL193W_Kyokai7   351   NNEVIYSVFIRGLRQYAGCKVNVGK   375
YDL193W_LalvinQA23   157   NNEVIYSVFIRGLRQYAGCKVNVGK   181
YDL193W_PW5   351   NNEVIYSVFIRGLRQYAGCKVNVGK   375
YDL193W_RM11-1a   351   NNEVIYSVFIRGLRQYAGCKVNVGK   375
YDL193W_RedStar   351   NNEVIYSVFIRGLRQYAGCKVNVGK   375
YDL193W_SEY6210   351   NNEVIYSVFIRGLRQYAGCKVNVGK   375
YDL193W_SK1   351   NNEVIYSVFIRGLRQYAGCKVNVGK   375
YDL193W_T7   351   NNEVIYSVFIRGLRQYAGCKVNVGK   375
YDL193W_T73   351   NNEVIYSVFIRGLRQYAGCKVNVGK   375
YDL193W_UC5   351   NNEVIYSVFIRGLRQYAGCKVNVGK   375
YDL193W_UWOPS05_217_3   351   NNEVIYSVFIRGLRQYAGCKVNVGK   375
YDL193W_VL3   157   NNEVIYSVFIRGLRQYAGCKVNVGK   181
YDL193W_Vin13   157   NNEVIYSVFIRGLRQYAGCKVNVGK   181
YDL193W_W303   351   NNEVIYSVFIRGLRQYAGCKVNVGK   375
YDL193W_X2180-1A   351   NNEVIYSVFIRGLRQYAGCKVNVGK   375
YDL193W_Y55   351   NNEVIYSVFIRGLRQYAGCKVNVGK   375
YDL193W_YJM269   351   NNEVIYSVFIRGLRQYAGCKVNVGK   375
YDL193W_YJM339   351   NNEVIYSVFIRGLRQYAGCKVNVGK   375
YDL193W_YJM789   351   NNEVIYSVFIRGLRQYAGCKVNVGK   375
YDL193W_YPH499   351   NNEVIYSVFIRGLRQYAGCKVNVGK   375
YDL193W_YPS128   351   NNEVIYSVFIRGLRQYAGCKVNVGK   375
YDL193W_YPS163   351   NNEVIYSVFIRGLRQYAGCKVNVGK   375
YDL193W_YS9   351   NNEVIYSVFIRGLRQYAGCKVNVGK   375
YDL193W_ZTW1   351   NNEVIYSVFIRGLRQYAGCKVNVGK   375
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YDL193W_S288C from SGD:

YDL193W_S288C [source=SGD]  Length: 376  Thu Aug 16 06:46:55 2018  Type: P  Check: 8217  ..

       1  MPTMIKKDDK AMEPPNEKPH RKIERDDVPE SSNHIPPPES GVLKGGKVNS

      51  KTRALKAVTS IIADADENPQ KKVNNETNGV QKQKTEDLSK RIGKFEYLFY

     101  KFLLVLLYIC FGLFRYGQYQ YNKMKLRIFS IIYNHAYTPQ LIRQDVIPLK

     151  KIPKRLAAIL EVKPVGDVGG GVTGLLNDAS EIVCWTVSAG IKHLMLYDYD

     201  GILQRNVPEL RMEIHSNLAK YFGPAHVPNY AVKIPHSNKI FYNLDGIETE

     251  TDVGNEIEAN QEKDKIAIEI SLLSNRDGRE TIVDLTKTMA ELCAVNELSV

     301  SDITMDLVDS ELKQLVGPEP DLLLYFGPSL DLQGFPPWHI RLTEFYWEKD

     351  NNEVIYSVFI RGLRQYAGCK VNVGK*

Protein Sequence for YDL193W_AWRI1631 from AWRI:

YDL193W_AWRI1631 [source=AWRI]  Length: 376  Thu Aug 16 06:46:55 2018  Type: P  Check: 8561  ..

       1  MPTMIKKDDK AMEPPNEKPH RKIERDDVPE SSNHIPPPES GVLKGGKVNS

      51  KTRALKAVTS IIADADENPQ KKVNNETNGV QKQKTEDLSK RIGKFEYLFY

     101  KFLLVLLYIC FGSFRYGQYQ YHKMKLRIFS IIYNHAYTPQ LIRQDVIPLK

     151  KIPKRLAAIL EVKPVGDVGG GVTGLLNDAS EIVCWTVSAG IKHLMLYDYD

     201  GILQRNVPEL RMEIHSNLAK YFGPAHVPNY AVKIPHSNKI FYNLDGIETE

     251  TDVGNEIEAN QEKDKIAIEI SLLSNRDGRE TIVDLTKTMA ELCAVNELSV

     301  SDITMDLVDS ELKQLVGPEP DLLLYFGPSL DLQGFPPWHI RLTEFYWEKD

     351  NNEVIYSVFI RGLRQYAGCK VNVGK*

Protein Sequence for YDL193W_AWRI796 from AWRI:

YDL193W_AWRI796 [source=AWRI]  Length: 182  Thu Aug 16 06:46:55 2018  Type: P  Check: 4234  ..

       1  MLYDYDGILQ RNVPELRMEI HSNLAKYFGP AHVPNYAVKI PHSNKIFYNL

      51  DGIETETDVG NEIEANQEKD KIAIEISLLS NRDGRETIVD LTKTMAELCA

     101  VNELSVSDIT MDLVDSELKQ LVGPEPDLLL YFGPSLDLQG FPPWHIRLTE

     151  FYWEKDNNEV IYSVFIRGLR QYAGCKVNVG K*

Protein Sequence for YDL193W_BC187 from Stanford:

YDL193W_BC187 [source=Stanford]  Length: 376  Thu Aug 16 06:46:55 2018  Type: P  Check: 8561  ..

       1  MPTMIKKDDK AMEPPNEKPH RKIERDDVPE SSNHIPPPES GVLKGGKVNS

      51  KTRALKAVTS IIADADENPQ KKVNNETNGV QKQKTEDLSK RIGKFEYLFY

     101  KFLLVLLYIC FGSFRYGQYQ YHKMKLRIFS IIYNHAYTPQ LIRQDVIPLK

     151  KIPKRLAAIL EVKPVGDVGG GVTGLLNDAS EIVCWTVSAG IKHLMLYDYD

     201  GILQRNVPEL RMEIHSNLAK YFGPAHVPNY AVKIPHSNKI FYNLDGIETE

     251  TDVGNEIEAN QEKDKIAIEI SLLSNRDGRE TIVDLTKTMA ELCAVNELSV

     301  SDITMDLVDS ELKQLVGPEP DLLLYFGPSL DLQGFPPWHI RLTEFYWEKD

     351  NNEVIYSVFI RGLRQYAGCK VNVGK*

Protein Sequence for YDL193W_BY4741 from Stanford:

YDL193W_BY4741 [source=Stanford]  Length: 376  Thu Aug 16 06:46:55 2018  Type: P  Check: 8217  ..

       1  MPTMIKKDDK AMEPPNEKPH RKIERDDVPE SSNHIPPPES GVLKGGKVNS

      51  KTRALKAVTS IIADADENPQ KKVNNETNGV QKQKTEDLSK RIGKFEYLFY

     101  KFLLVLLYIC FGLFRYGQYQ YNKMKLRIFS IIYNHAYTPQ LIRQDVIPLK

     151  KIPKRLAAIL EVKPVGDVGG GVTGLLNDAS EIVCWTVSAG IKHLMLYDYD

     201  GILQRNVPEL RMEIHSNLAK YFGPAHVPNY AVKIPHSNKI FYNLDGIETE

     251  TDVGNEIEAN QEKDKIAIEI SLLSNRDGRE TIVDLTKTMA ELCAVNELSV

     301  SDITMDLVDS ELKQLVGPEP DLLLYFGPSL DLQGFPPWHI RLTEFYWEKD

     351  NNEVIYSVFI RGLRQYAGCK VNVGK*

Protein Sequence for YDL193W_BY4742 from Stanford:

YDL193W_BY4742 [source=Stanford]  Length: 376  Thu Aug 16 06:46:55 2018  Type: P  Check: 8217  ..

       1  MPTMIKKDDK AMEPPNEKPH RKIERDDVPE SSNHIPPPES GVLKGGKVNS

      51  KTRALKAVTS IIADADENPQ KKVNNETNGV QKQKTEDLSK RIGKFEYLFY

     101  KFLLVLLYIC FGLFRYGQYQ YNKMKLRIFS IIYNHAYTPQ LIRQDVIPLK

     151  KIPKRLAAIL EVKPVGDVGG GVTGLLNDAS EIVCWTVSAG IKHLMLYDYD

     201  GILQRNVPEL RMEIHSNLAK YFGPAHVPNY AVKIPHSNKI FYNLDGIETE

     251  TDVGNEIEAN QEKDKIAIEI SLLSNRDGRE TIVDLTKTMA ELCAVNELSV

     301  SDITMDLVDS ELKQLVGPEP DLLLYFGPSL DLQGFPPWHI RLTEFYWEKD

     351  NNEVIYSVFI RGLRQYAGCK VNVGK*

Protein Sequence for YDL193W_CBS7960 from WashU:

YDL193W_CBS7960 [source=WashU]  Length: 376  Thu Aug 16 06:46:55 2018  Type: P  Check: 8561  ..

       1  MPTMIKKDDK AMEPPNEKPH RKIERDDVPE SSNHIPPPES GVLKGGKVNS

      51  KTRALKAVTS IIADADENPQ KKVNNETNGV QKQKTEDLSK RIGKFEYLFY

     101  KFLLVLLYIC FGSFRYGQYQ YHKMKLRIFS IIYNHAYTPQ LIRQDVIPLK

     151  KIPKRLAAIL EVKPVGDVGG GVTGLLNDAS EIVCWTVSAG IKHLMLYDYD

     201  GILQRNVPEL RMEIHSNLAK YFGPAHVPNY AVKIPHSNKI FYNLDGIETE

     251  TDVGNEIEAN QEKDKIAIEI SLLSNRDGRE TIVDLTKTMA ELCAVNELSV

     301  SDITMDLVDS ELKQLVGPEP DLLLYFGPSL DLQGFPPWHI RLTEFYWEKD

     351  NNEVIYSVFI RGLRQYAGCK VNVGK*

Protein Sequence for YDL193W_CEN.PK from Stanford:

YDL193W_CEN.PK [source=Stanford]  Length: 376  Thu Aug 16 06:46:55 2018  Type: P  Check: 8217  ..

       1  MPTMIKKDDK AMEPPNEKPH RKIERDDVPE SSNHIPPPES GVLKGGKVNS

      51  KTRALKAVTS IIADADENPQ KKVNNETNGV QKQKTEDLSK RIGKFEYLFY

     101  KFLLVLLYIC FGLFRYGQYQ YNKMKLRIFS IIYNHAYTPQ LIRQDVIPLK

     151  KIPKRLAAIL EVKPVGDVGG GVTGLLNDAS EIVCWTVSAG IKHLMLYDYD

     201  GILQRNVPEL RMEIHSNLAK YFGPAHVPNY AVKIPHSNKI FYNLDGIETE

     251  TDVGNEIEAN QEKDKIAIEI SLLSNRDGRE TIVDLTKTMA ELCAVNELSV

     301  SDITMDLVDS ELKQLVGPEP DLLLYFGPSL DLQGFPPWHI RLTEFYWEKD

     351  NNEVIYSVFI RGLRQYAGCK VNVGK*

Protein Sequence for YDL193W_D273-10B from Stanford:

YDL193W_D273-10B [source=Stanford]  Length: 376  Thu Aug 16 06:46:55 2018  Type: P  Check: 8169  ..

       1  MPTMIKKDDK AMEPPNEKPH RKIERDDVPE SSNHIPPPES GVLKGGKVNS

      51  KTRALKAVTS IIADADENPQ KKVNNETNGV QKQKTEDLSK RIGKFEYLFY

     101  KFLLVLLYIC FGLFRYGQYQ YHKMKLRIFS IIYNHAYTPQ LIRQDVIPLK

     151  KIPKRLAAIL EVKPVGDVGG GVTGLLNDAS EIVCWTVSAG IKHLMLYDYD

     201  GILQRNVPEL RMEIHSNLAK YFGPAHVPNY AVKIPHSNKI FYNLDGIETE

     251  TDVGNEIEAN QEKDKIAIEI SLLSNRDGRE TIVDLTKTMA ELCAVNELSV

     301  SDITMDLVDS ELKQLVGPEP DLLLYFGPSL DLQGFPPWHI RLTEFYWEKD

     351  NNEVIYSVFI RGLRQYAGCK VNVGK*

Protein Sequence for YDL193W_EC1118 from Genoscope:

YDL193W_EC1118 [source=Genoscope]  Length: 376  Thu Aug 16 06:46:55 2018  Type: P  Check: 8561  ..

       1  MPTMIKKDDK AMEPPNEKPH RKIERDDVPE SSNHIPPPES GVLKGGKVNS

      51  KTRALKAVTS IIADADENPQ KKVNNETNGV QKQKTEDLSK RIGKFEYLFY

     101  KFLLVLLYIC FGSFRYGQYQ YHKMKLRIFS IIYNHAYTPQ LIRQDVIPLK

     151  KIPKRLAAIL EVKPVGDVGG GVTGLLNDAS EIVCWTVSAG IKHLMLYDYD

     201  GILQRNVPEL RMEIHSNLAK YFGPAHVPNY AVKIPHSNKI FYNLDGIETE

     251  TDVGNEIEAN QEKDKIAIEI SLLSNRDGRE TIVDLTKTMA ELCAVNELSV

     301  SDITMDLVDS ELKQLVGPEP DLLLYFGPSL DLQGFPPWHI RLTEFYWEKD

     351  NNEVIYSVFI RGLRQYAGCK VNVGK*

Protein Sequence for YDL193W_EC9-8 from ASinica:

YDL193W_EC9-8 [source=ASinica]  Length: 376  Thu Aug 16 06:46:55 2018  Type: P  Check: 8001  ..

       1  MPTMIKKDDK AMEPPNEKPH RKIERDDVPE SSNHIPPPES GVLKGGKVNS

      51  KTRALKAVTS IIADADENPQ KKVSNETNGV QKQKTEDLSK RIGKFEYLFY

     101  KFLLVLLYIC FGLFRYGQYQ YHKMKLRIFS IIYNHAYTPQ LIRQDVIPLK

     151  KIPKRLAAIL EVKPVGDVGG GVTGLLNDAS EIVCWTVSAG IKHLMLYDYD

     201  GILQRNVPEL RMEIHSNLAK YFGPAHVPNY AVKIPHSNKI FYNLDGIETE

     251  IDVGNEIEAN QEKDKIAIEI SLLSNRDGRE TIVDLTKTMA ELCAVNELSV

     301  SDITMDLVDS ELKQLVGPEP DLLLYFGPSL DLQGFPPWHI RLTEFYWEKD

     351  NNEVIYSVFI RGLRQYAGCK VNVGK*

Protein Sequence for YDL193W_FL100 from Stanford:

YDL193W_FL100 [source=Stanford]  Length: 376  Thu Aug 16 06:46:55 2018  Type: P  Check: 8153  ..

       1  MPTMIKKDDK AMEPPNEKPH RKIERDDVPE SSNHIPPPES GVLKGGKVNS

      51  KTRALKAVTS IIADADENPQ KKVSNETNGV QKQKTEDLSK RIGKFEYLFY

     101  KFLLVLLYIC FGLFRYGQYQ YHKMKLRIFS IIYNHAYTPQ LIRQDVIPLK

     151  KMPKRLAAIL EVKPVGDVGG GVTGLLNDAS EIVCWTVSAG IKHLMLYDYD

     201  GILQRNVPEL RMEIHSNLAK YFGPAHVPNY AVKIPHSNKI FYNLDGIETE

     251  IDVGNEIEAN QEKDKIAIEI SLLSNRDGRE TIVDLTKTMA ELCAVNELSV

     301  SDITMDLVDS ELKQLVGPEP DLLLYFGPSL DLQGFPPWHI RLTEFYWEKD

     351  NNEVIYSVFI RGLRQYAGCK VNVGK*

Protein Sequence for YDL193W_FY1679 from Stanford:

YDL193W_FY1679 [source=Stanford]  Length: 376  Thu Aug 16 06:46:55 2018  Type: P  Check: 8217  ..

       1  MPTMIKKDDK AMEPPNEKPH RKIERDDVPE SSNHIPPPES GVLKGGKVNS

      51  KTRALKAVTS IIADADENPQ KKVNNETNGV QKQKTEDLSK RIGKFEYLFY

     101  KFLLVLLYIC FGLFRYGQYQ YNKMKLRIFS IIYNHAYTPQ LIRQDVIPLK

     151  KIPKRLAAIL EVKPVGDVGG GVTGLLNDAS EIVCWTVSAG IKHLMLYDYD

     201  GILQRNVPEL RMEIHSNLAK YFGPAHVPNY AVKIPHSNKI FYNLDGIETE

     251  TDVGNEIEAN QEKDKIAIEI SLLSNRDGRE TIVDLTKTMA ELCAVNELSV

     301  SDITMDLVDS ELKQLVGPEP DLLLYFGPSL DLQGFPPWHI RLTEFYWEKD

     351  NNEVIYSVFI RGLRQYAGCK VNVGK*

Protein Sequence for YDL193W_FostersB from AWRI:

YDL193W_FostersB [source=AWRI]  Length: 154  Thu Aug 16 06:46:55 2018  Type: P  Check: 4324  ..

       1  MPTMIKKDDK AMEPPNEKPH RKIERDDVPE SSNHIPPPES GVLKGGKVNS

      51  KTRALKAVTS IIADADENPQ KKVNNETNGV QKQKTEDLSK RIGKFEYLFY

     101  KFLLVLLYIC FGXFRYGQYQ YHKMKLRIFS IIYNHAYTPQ LIRQDVIPLK

     151  KNS*

Protein Sequence for YDL193W_FostersO from AWRI:

YDL193W_FostersO [source=AWRI]  Length: 182  Thu Aug 16 06:46:55 2018  Type: P  Check: 5131  ..

       1  MLYDYDGILQ RNVPELRMEI HSNLAKYFGP AHVPNYAVKI PHSNKIFYNL

      51  DGIETETDVG NEIEANQEKD KIAIEISLLS NRDGRETIVD LTKTMXELCA

     101  VNELSVSDIT MDLVDSELKQ LVGPEPDLLL YFGPSLDLQG FPPWHIRLTE

     151  FYWEKDNNEV IYSVFIRGLR QYAGCKVNVG K*

Protein Sequence for YDL193W_JAY291 from Duke:

YDL193W_JAY291 [source=Duke]  Length: 376  Thu Aug 16 06:46:55 2018  Type: P  Check: 8561  ..

       1  MPTMIKKDDK AMEPPNEKPH RKIERDDVPE SSNHIPPPES GVLKGGKVNS

      51  KTRALKAVTS IIADADENPQ KKVNNETNGV QKQKTEDLSK RIGKFEYLFY

     101  KFLLVLLYIC FGSFRYGQYQ YHKMKLRIFS IIYNHAYTPQ LIRQDVIPLK

     151  KIPKRLAAIL EVKPVGDVGG GVTGLLNDAS EIVCWTVSAG IKHLMLYDYD

     201  GILQRNVPEL RMEIHSNLAK YFGPAHVPNY AVKIPHSNKI FYNLDGIETE

     251  TDVGNEIEAN QEKDKIAIEI SLLSNRDGRE TIVDLTKTMA ELCAVNELSV

     301  SDITMDLVDS ELKQLVGPEP DLLLYFGPSL DLQGFPPWHI RLTEFYWEKD

     351  NNEVIYSVFI RGLRQYAGCK VNVGK*

Protein Sequence for YDL193W_JK9-3d from Stanford:

YDL193W_JK9-3d [source=Stanford]  Length: 376  Thu Aug 16 06:46:55 2018  Type: P  Check: 8217  ..

       1  MPTMIKKDDK AMEPPNEKPH RKIERDDVPE SSNHIPPPES GVLKGGKVNS

      51  KTRALKAVTS IIADADENPQ KKVNNETNGV QKQKTEDLSK RIGKFEYLFY

     101  KFLLVLLYIC FGLFRYGQYQ YNKMKLRIFS IIYNHAYTPQ LIRQDVIPLK

     151  KIPKRLAAIL EVKPVGDVGG GVTGLLNDAS EIVCWTVSAG IKHLMLYDYD

     201  GILQRNVPEL RMEIHSNLAK YFGPAHVPNY AVKIPHSNKI FYNLDGIETE

     251  TDVGNEIEAN QEKDKIAIEI SLLSNRDGRE TIVDLTKTMA ELCAVNELSV

     301  SDITMDLVDS ELKQLVGPEP DLLLYFGPSL DLQGFPPWHI RLTEFYWEKD

     351  NNEVIYSVFI RGLRQYAGCK VNVGK*

Protein Sequence for YDL193W_K11 from Stanford:

YDL193W_K11 [source=Stanford]  Length: 376  Thu Aug 16 06:46:55 2018  Type: P  Check: 8001  ..

       1  MPTMIKKDDK AMEPPNEKPH RKIERDDVPE SSNHIPPPES GVLKGGKVNS

      51  KTRALKAVTS IIADADENPQ KKVSNETNGV QKQKTEDLSK RIGKFEYLFY

     101  KFLLVLLYIC FGLFRYGQYQ YHKMKLRIFS IIYNHAYTPQ LIRQDVIPLK

     151  KIPKRLAAIL EVKPVGDVGG GVTGLLNDAS EIVCWTVSAG IKHLMLYDYD

     201  GILQRNVPEL RMEIHSNLAK YFGPAHVPNY AVKIPHSNKI FYNLDGIETE

     251  IDVGNEIEAN QEKDKIAIEI SLLSNRDGRE TIVDLTKTMA ELCAVNELSV

     301  SDITMDLVDS ELKQLVGPEP DLLLYFGPSL DLQGFPPWHI RLTEFYWEKD

     351  NNEVIYSVFI RGLRQYAGCK VNVGK*

Protein Sequence for YDL193W_Kyokai7 from NRIB:

YDL193W_Kyokai7 [source=NRIB]  Length: 376  Thu Aug 16 06:46:55 2018  Type: P  Check: 8001  ..

       1  MPTMIKKDDK AMEPPNEKPH RKIERDDVPE SSNHIPPPES GVLKGGKVNS

      51  KTRALKAVTS IIADADENPQ KKVSNETNGV QKQKTEDLSK RIGKFEYLFY

     101  KFLLVLLYIC FGLFRYGQYQ YHKMKLRIFS IIYNHAYTPQ LIRQDVIPLK

     151  KIPKRLAAIL EVKPVGDVGG GVTGLLNDAS EIVCWTVSAG IKHLMLYDYD

     201  GILQRNVPEL RMEIHSNLAK YFGPAHVPNY AVKIPHSNKI FYNLDGIETE

     251  IDVGNEIEAN QEKDKIAIEI SLLSNRDGRE TIVDLTKTMA ELCAVNELSV

     301  SDITMDLVDS ELKQLVGPEP DLLLYFGPSL DLQGFPPWHI RLTEFYWEKD

     351  NNEVIYSVFI RGLRQYAGCK VNVGK*

Protein Sequence for YDL193W_LalvinQA23 from AWRI:

YDL193W_LalvinQA23 [source=AWRI]  Length: 182  Thu Aug 16 06:46:55 2018  Type: P  Check: 5131  ..

       1  MLYDYDGILQ RNVPELRMEI HSNLAKYFGP AHVPNYAVKI PHSNKIFYNL

      51  DGIETETDVG NEIEANQEKD KIAIEISLLS NRDGRETIVD LTKTMXELCA

     101  VNELSVSDIT MDLVDSELKQ LVGPEPDLLL YFGPSLDLQG FPPWHIRLTE

     151  FYWEKDNNEV IYSVFIRGLR QYAGCKVNVG K*

Protein Sequence for YDL193W_PW5 from WashU:

YDL193W_PW5 [source=WashU]  Length: 376  Thu Aug 16 06:46:55 2018  Type: P  Check: 8253  ..

       1  MPTMIKKDDK AMEPPNEKPH RKIERDDVPE SSNHIPPPES GVLKGGKVNS

      51  KTRALKAVTS IIADADENPQ KKVNNETNGV QKQKTEDLSK RIGKFEYLFY

     101  KFLLVLLYIC FGLFRYGQYQ YNKMKLRIFS IIYNHAYTPQ LIRQDVIPLK

     151  KIPKRLAAIL EVKPVGDVGG GVTGLLNDAS EIVCWTVSAG IKHLMLYDYD

     201  GILQRNVPEL RMEIHSNLAK YFGPAHVPNY AVKIPHSNKI FYNLDGIETE

     251  TDVGNEIEAN QEKEKIAIEI SLLSNRDGRE TIVDLTKTMA ELCAVNELSV

     301  SDITMDLVDS ELKQLVGPEP DLLLYFGPSL DLQGFPPWHI RLTEFYWEKD

     351  NNEVIYSVFI RGLRQYAGCK VNVGK*

Protein Sequence for YDL193W_RM11-1a from Stanford:

YDL193W_RM11-1a [source=Stanford]  Length: 376  Thu Aug 16 06:46:55 2018  Type: P  Check: 8561  ..

       1  MPTMIKKDDK AMEPPNEKPH RKIERDDVPE SSNHIPPPES GVLKGGKVNS

      51  KTRALKAVTS IIADADENPQ KKVNNETNGV QKQKTEDLSK RIGKFEYLFY

     101  KFLLVLLYIC FGSFRYGQYQ YHKMKLRIFS IIYNHAYTPQ LIRQDVIPLK

     151  KIPKRLAAIL EVKPVGDVGG GVTGLLNDAS EIVCWTVSAG IKHLMLYDYD

     201  GILQRNVPEL RMEIHSNLAK YFGPAHVPNY AVKIPHSNKI FYNLDGIETE

     251  TDVGNEIEAN QEKDKIAIEI SLLSNRDGRE TIVDLTKTMA ELCAVNELSV

     301  SDITMDLVDS ELKQLVGPEP DLLLYFGPSL DLQGFPPWHI RLTEFYWEKD

     351  NNEVIYSVFI RGLRQYAGCK VNVGK*

Protein Sequence for YDL193W_RedStar from Stanford:

YDL193W_RedStar [source=Stanford]  Length: 376  Thu Aug 16 06:46:55 2018  Type: P  Check: 8217  ..

       1  MPTMIKKDDK AMEPPNEKPH RKIERDDVPE SSNHIPPPES GVLKGGKVNS

      51  KTRALKAVTS IIADADENPQ KKVNNETNGV QKQKTEDLSK RIGKFEYLFY

     101  KFLLVLLYIC FGLFRYGQYQ YNKMKLRIFS IIYNHAYTPQ LIRQDVIPLK

     151  KIPKRLAAIL EVKPVGDVGG GVTGLLNDAS EIVCWTVSAG IKHLMLYDYD

     201  GILQRNVPEL RMEIHSNLAK YFGPAHVPNY AVKIPHSNKI FYNLDGIETE

     251  TDVGNEIEAN QEKDKIAIEI SLLSNRDGRE TIVDLTKTMA ELCAVNELSV

     301  SDITMDLVDS ELKQLVGPEP DLLLYFGPSL DLQGFPPWHI RLTEFYWEKD

     351  NNEVIYSVFI RGLRQYAGCK VNVGK*

Protein Sequence for YDL193W_SEY6210 from Stanford:

YDL193W_SEY6210 [source=Stanford]  Length: 376  Thu Aug 16 06:46:55 2018  Type: P  Check: 8217  ..

       1  MPTMIKKDDK AMEPPNEKPH RKIERDDVPE SSNHIPPPES GVLKGGKVNS

      51  KTRALKAVTS IIADADENPQ KKVNNETNGV QKQKTEDLSK RIGKFEYLFY

     101  KFLLVLLYIC FGLFRYGQYQ YNKMKLRIFS IIYNHAYTPQ LIRQDVIPLK

     151  KIPKRLAAIL EVKPVGDVGG GVTGLLNDAS EIVCWTVSAG IKHLMLYDYD

     201  GILQRNVPEL RMEIHSNLAK YFGPAHVPNY AVKIPHSNKI FYNLDGIETE

     251  TDVGNEIEAN QEKDKIAIEI SLLSNRDGRE TIVDLTKTMA ELCAVNELSV

     301  SDITMDLVDS ELKQLVGPEP DLLLYFGPSL DLQGFPPWHI RLTEFYWEKD

     351  NNEVIYSVFI RGLRQYAGCK VNVGK*

Protein Sequence for YDL193W_SK1 from Stanford:

YDL193W_SK1 [source=Stanford]  Length: 376  Thu Aug 16 06:46:55 2018  Type: P  Check: 8217  ..

       1  MPTMIKKDDK AMEPPNEKPH RKIERDDVPE SSNHIPPPES GVLKGGKVNS

      51  KTRALKAVTS IIADADENPQ KKVNNETNGV QKQKTEDLSK RIGKFEYLFY

     101  KFLLVLLYIC FGLFRYGQYQ YNKMKLRIFS IIYNHAYTPQ LIRQDVIPLK

     151  KIPKRLAAIL EVKPVGDVGG GVTGLLNDAS EIVCWTVSAG IKHLMLYDYD

     201  GILQRNVPEL RMEIHSNLAK YFGPAHVPNY AVKIPHSNKI FYNLDGIETE

     251  TDVGNEIEAN QEKDKIAIEI SLLSNRDGRE TIVDLTKTMA ELCAVNELSV

     301  SDITMDLVDS ELKQLVGPEP DLLLYFGPSL DLQGFPPWHI RLTEFYWEKD

     351  NNEVIYSVFI RGLRQYAGCK VNVGK*

Protein Sequence for YDL193W_T7 from WashU:

YDL193W_T7 [source=WashU]  Length: 376  Thu Aug 16 06:46:55 2018  Type: P  Check: 8217  ..

       1  MPTMIKKDDK AMEPPNEKPH RKIERDDVPE SSNHIPPPES GVLKGGKVNS

      51  KTRALKAVTS IIADADENPQ KKVNNETNGV QKQKTEDLSK RIGKFEYLFY

     101  KFLLVLLYIC FGLFRYGQYQ YNKMKLRIFS IIYNHAYTPQ LIRQDVIPLK

     151  KIPKRLAAIL EVKPVGDVGG GVTGLLNDAS EIVCWTVSAG IKHLMLYDYD

     201  GILQRNVPEL RMEIHSNLAK YFGPAHVPNY AVKIPHSNKI FYNLDGIETE

     251  TDVGNEIEAN QEKDKIAIEI SLLSNRDGRE TIVDLTKTMA ELCAVNELSV

     301  SDITMDLVDS ELKQLVGPEP DLLLYFGPSL DLQGFPPWHI RLTEFYWEKD

     351  NNEVIYSVFI RGLRQYAGCK VNVGK*

Protein Sequence for YDL193W_T73 from WashU:

YDL193W_T73 [source=WashU]  Length: 376  Thu Aug 16 06:46:55 2018  Type: P  Check: 8561  ..

       1  MPTMIKKDDK AMEPPNEKPH RKIERDDVPE SSNHIPPPES GVLKGGKVNS

      51  KTRALKAVTS IIADADENPQ KKVNNETNGV QKQKTEDLSK RIGKFEYLFY

     101  KFLLVLLYIC FGSFRYGQYQ YHKMKLRIFS IIYNHAYTPQ LIRQDVIPLK

     151  KIPKRLAAIL EVKPVGDVGG GVTGLLNDAS EIVCWTVSAG IKHLMLYDYD

     201  GILQRNVPEL RMEIHSNLAK YFGPAHVPNY AVKIPHSNKI FYNLDGIETE

     251  TDVGNEIEAN QEKDKIAIEI SLLSNRDGRE TIVDLTKTMA ELCAVNELSV

     301  SDITMDLVDS ELKQLVGPEP DLLLYFGPSL DLQGFPPWHI RLTEFYWEKD

     351  NNEVIYSVFI RGLRQYAGCK VNVGK*

Protein Sequence for YDL193W_UC5 from WashU:

YDL193W_UC5 [source=WashU]  Length: 376  Thu Aug 16 06:46:55 2018  Type: P  Check: 8001  ..

       1  MPTMIKKDDK AMEPPNEKPH RKIERDDVPE SSNHIPPPES GVLKGGKVNS

      51  KTRALKAVTS IIADADENPQ KKVSNETNGV QKQKTEDLSK RIGKFEYLFY

     101  KFLLVLLYIC FGLFRYGQYQ YHKMKLRIFS IIYNHAYTPQ LIRQDVIPLK

     151  KIPKRLAAIL EVKPVGDVGG GVTGLLNDAS EIVCWTVSAG IKHLMLYDYD

     201  GILQRNVPEL RMEIHSNLAK YFGPAHVPNY AVKIPHSNKI FYNLDGIETE

     251  IDVGNEIEAN QEKDKIAIEI SLLSNRDGRE TIVDLTKTMA ELCAVNELSV

     301  SDITMDLVDS ELKQLVGPEP DLLLYFGPSL DLQGFPPWHI RLTEFYWEKD

     351  NNEVIYSVFI RGLRQYAGCK VNVGK*

Protein Sequence for YDL193W_UWOPS05_217_3 from Stanford:

YDL193W_UWOPS05_217_3 [source=Stanford]  Length: 376  Thu Aug 16 06:46:55 2018  Type: P  Check: 8217  ..

       1  MPTMIKKDDK AMEPPNEKPH RKIERDDVPE SSNHIPPPES GVLKGGKVNS

      51  KTRALKAVTS IIADADENPQ KKVNNETNGV QKQKTEDLSK RIGKFEYLFY

     101  KFLLVLLYIC FGLFRYGQYQ YNKMKLRIFS IIYNHAYTPQ LIRQDVIPLK

     151  KIPKRLAAIL EVKPVGDVGG GVTGLLNDAS EIVCWTVSAG IKHLMLYDYD

     201  GILQRNVPEL RMEIHSNLAK YFGPAHVPNY AVKIPHSNKI FYNLDGIETE

     251  TDVGNEIEAN QEKDKIAIEI SLLSNRDGRE TIVDLTKTMA ELCAVNELSV

     301  SDITMDLVDS ELKQLVGPEP DLLLYFGPSL DLQGFPPWHI RLTEFYWEKD

     351  NNEVIYSVFI RGLRQYAGCK VNVGK*

Protein Sequence for YDL193W_VL3 from AWRI:

YDL193W_VL3 [source=AWRI]  Length: 182  Thu Aug 16 06:46:55 2018  Type: P  Check: 4234  ..

       1  MLYDYDGILQ RNVPELRMEI HSNLAKYFGP AHVPNYAVKI PHSNKIFYNL

      51  DGIETETDVG NEIEANQEKD KIAIEISLLS NRDGRETIVD LTKTMAELCA

     101  VNELSVSDIT MDLVDSELKQ LVGPEPDLLL YFGPSLDLQG FPPWHIRLTE

     151  FYWEKDNNEV IYSVFIRGLR QYAGCKVNVG K*

Protein Sequence for YDL193W_Vin13 from AWRI:

YDL193W_Vin13 [source=AWRI]  Length: 182  Thu Aug 16 06:46:55 2018  Type: P  Check: 4234  ..

       1  MLYDYDGILQ RNVPELRMEI HSNLAKYFGP AHVPNYAVKI PHSNKIFYNL

      51  DGIETETDVG NEIEANQEKD KIAIEISLLS NRDGRETIVD LTKTMAELCA

     101  VNELSVSDIT MDLVDSELKQ LVGPEPDLLL YFGPSLDLQG FPPWHIRLTE

     151  FYWEKDNNEV IYSVFIRGLR QYAGCKVNVG K*

Protein Sequence for YDL193W_W303 from Stanford:

YDL193W_W303 [source=Stanford]  Length: 376  Thu Aug 16 06:46:55 2018  Type: P  Check: 8217  ..

       1  MPTMIKKDDK AMEPPNEKPH RKIERDDVPE SSNHIPPPES GVLKGGKVNS

      51  KTRALKAVTS IIADADENPQ KKVNNETNGV QKQKTEDLSK RIGKFEYLFY

     101  KFLLVLLYIC FGLFRYGQYQ YNKMKLRIFS IIYNHAYTPQ LIRQDVIPLK

     151  KIPKRLAAIL EVKPVGDVGG GVTGLLNDAS EIVCWTVSAG IKHLMLYDYD

     201  GILQRNVPEL RMEIHSNLAK YFGPAHVPNY AVKIPHSNKI FYNLDGIETE

     251  TDVGNEIEAN QEKDKIAIEI SLLSNRDGRE TIVDLTKTMA ELCAVNELSV

     301  SDITMDLVDS ELKQLVGPEP DLLLYFGPSL DLQGFPPWHI RLTEFYWEKD

     351  NNEVIYSVFI RGLRQYAGCK VNVGK*

Protein Sequence for YDL193W_X2180-1A from Stanford:

YDL193W_X2180-1A [source=Stanford]  Length: 376  Thu Aug 16 06:46:55 2018  Type: P  Check: 8217  ..

       1  MPTMIKKDDK AMEPPNEKPH RKIERDDVPE SSNHIPPPES GVLKGGKVNS

      51  KTRALKAVTS IIADADENPQ KKVNNETNGV QKQKTEDLSK RIGKFEYLFY

     101  KFLLVLLYIC FGLFRYGQYQ YNKMKLRIFS IIYNHAYTPQ LIRQDVIPLK

     151  KIPKRLAAIL EVKPVGDVGG GVTGLLNDAS EIVCWTVSAG IKHLMLYDYD

     201  GILQRNVPEL RMEIHSNLAK YFGPAHVPNY AVKIPHSNKI FYNLDGIETE

     251  TDVGNEIEAN QEKDKIAIEI SLLSNRDGRE TIVDLTKTMA ELCAVNELSV

     301  SDITMDLVDS ELKQLVGPEP DLLLYFGPSL DLQGFPPWHI RLTEFYWEKD

     351  NNEVIYSVFI RGLRQYAGCK VNVGK*

Protein Sequence for YDL193W_Y55 from Stanford:

YDL193W_Y55 [source=Stanford]  Length: 376  Thu Aug 16 06:46:55 2018  Type: P  Check: 8561  ..

       1  MPTMIKKDDK AMEPPNEKPH RKIERDDVPE SSNHIPPPES GVLKGGKVNS

      51  KTRALKAVTS IIADADENPQ KKVNNETNGV QKQKTEDLSK RIGKFEYLFY

     101  KFLLVLLYIC FGSFRYGQYQ YHKMKLRIFS IIYNHAYTPQ LIRQDVIPLK

     151  KIPKRLAAIL EVKPVGDVGG GVTGLLNDAS EIVCWTVSAG IKHLMLYDYD

     201  GILQRNVPEL RMEIHSNLAK YFGPAHVPNY AVKIPHSNKI FYNLDGIETE

     251  TDVGNEIEAN QEKDKIAIEI SLLSNRDGRE TIVDLTKTMA ELCAVNELSV

     301  SDITMDLVDS ELKQLVGPEP DLLLYFGPSL DLQGFPPWHI RLTEFYWEKD

     351  NNEVIYSVFI RGLRQYAGCK VNVGK*

Protein Sequence for YDL193W_YJM269 from WashU:

YDL193W_YJM269 [source=WashU]  Length: 376  Thu Aug 16 06:46:55 2018  Type: P  Check: 8217  ..

       1  MPTMIKKDDK AMEPPNEKPH RKIERDDVPE SSNHIPPPES GVLKGGKVNS

      51  KTRALKAVTS IIADADENPQ KKVNNETNGV QKQKTEDLSK RIGKFEYLFY

     101  KFLLVLLYIC FGLFRYGQYQ YNKMKLRIFS IIYNHAYTPQ LIRQDVIPLK

     151  KIPKRLAAIL EVKPVGDVGG GVTGLLNDAS EIVCWTVSAG IKHLMLYDYD

     201  GILQRNVPEL RMEIHSNLAK YFGPAHVPNY AVKIPHSNKI FYNLDGIETE

     251  TDVGNEIEAN QEKDKIAIEI SLLSNRDGRE TIVDLTKTMA ELCAVNELSV

     301  SDITMDLVDS ELKQLVGPEP DLLLYFGPSL DLQGFPPWHI RLTEFYWEKD

     351  NNEVIYSVFI RGLRQYAGCK VNVGK*

Protein Sequence for YDL193W_YJM339 from Stanford:

YDL193W_YJM339 [source=Stanford]  Length: 376  Thu Aug 16 06:46:55 2018  Type: P  Check: 8561  ..

       1  MPTMIKKDDK AMEPPNEKPH RKIERDDVPE SSNHIPPPES GVLKGGKVNS

      51  KTRALKAVTS IIADADENPQ KKVNNETNGV QKQKTEDLSK RIGKFEYLFY

     101  KFLLVLLYIC FGSFRYGQYQ YHKMKLRIFS IIYNHAYTPQ LIRQDVIPLK

     151  KIPKRLAAIL EVKPVGDVGG GVTGLLNDAS EIVCWTVSAG IKHLMLYDYD

     201  GILQRNVPEL RMEIHSNLAK YFGPAHVPNY AVKIPHSNKI FYNLDGIETE

     251  TDVGNEIEAN QEKDKIAIEI SLLSNRDGRE TIVDLTKTMA ELCAVNELSV

     301  SDITMDLVDS ELKQLVGPEP DLLLYFGPSL DLQGFPPWHI RLTEFYWEKD

     351  NNEVIYSVFI RGLRQYAGCK VNVGK*

Protein Sequence for YDL193W_YJM789 from Stanford:

YDL193W_YJM789 [source=Stanford]  Length: 376  Thu Aug 16 06:46:55 2018  Type: P  Check: 8561  ..

       1  MPTMIKKDDK AMEPPNEKPH RKIERDDVPE SSNHIPPPES GVLKGGKVNS

      51  KTRALKAVTS IIADADENPQ KKVNNETNGV QKQKTEDLSK RIGKFEYLFY

     101  KFLLVLLYIC FGSFRYGQYQ YHKMKLRIFS IIYNHAYTPQ LIRQDVIPLK

     151  KIPKRLAAIL EVKPVGDVGG GVTGLLNDAS EIVCWTVSAG IKHLMLYDYD

     201  GILQRNVPEL RMEIHSNLAK YFGPAHVPNY AVKIPHSNKI FYNLDGIETE

     251  TDVGNEIEAN QEKDKIAIEI SLLSNRDGRE TIVDLTKTMA ELCAVNELSV

     301  SDITMDLVDS ELKQLVGPEP DLLLYFGPSL DLQGFPPWHI RLTEFYWEKD

     351  NNEVIYSVFI RGLRQYAGCK VNVGK*

Protein Sequence for YDL193W_YPH499 from Stanford:

YDL193W_YPH499 [source=Stanford]  Length: 376  Thu Aug 16 06:46:55 2018  Type: P  Check: 8217  ..

       1  MPTMIKKDDK AMEPPNEKPH RKIERDDVPE SSNHIPPPES GVLKGGKVNS

      51  KTRALKAVTS IIADADENPQ KKVNNETNGV QKQKTEDLSK RIGKFEYLFY

     101  KFLLVLLYIC FGLFRYGQYQ YNKMKLRIFS IIYNHAYTPQ LIRQDVIPLK

     151  KIPKRLAAIL EVKPVGDVGG GVTGLLNDAS EIVCWTVSAG IKHLMLYDYD

     201  GILQRNVPEL RMEIHSNLAK YFGPAHVPNY AVKIPHSNKI FYNLDGIETE

     251  TDVGNEIEAN QEKDKIAIEI SLLSNRDGRE TIVDLTKTMA ELCAVNELSV

     301  SDITMDLVDS ELKQLVGPEP DLLLYFGPSL DLQGFPPWHI RLTEFYWEKD

     351  NNEVIYSVFI RGLRQYAGCK VNVGK*

Protein Sequence for YDL193W_YPS128 from Stanford:

YDL193W_YPS128 [source=Stanford]  Length: 376  Thu Aug 16 06:46:55 2018  Type: P  Check: 8217  ..

       1  MPTMIKKDDK AMEPPNEKPH RKIERDDVPE SSNHIPPPES GVLKGGKVNS

      51  KTRALKAVTS IIADADENPQ KKVNNETNGV QKQKTEDLSK RIGKFEYLFY

     101  KFLLVLLYIC FGLFRYGQYQ YNKMKLRIFS IIYNHAYTPQ LIRQDVIPLK

     151  KIPKRLAAIL EVKPVGDVGG GVTGLLNDAS EIVCWTVSAG IKHLMLYDYD

     201  GILQRNVPEL RMEIHSNLAK YFGPAHVPNY AVKIPHSNKI FYNLDGIETE

     251  TDVGNEIEAN QEKDKIAIEI SLLSNRDGRE TIVDLTKTMA ELCAVNELSV

     301  SDITMDLVDS ELKQLVGPEP DLLLYFGPSL DLQGFPPWHI RLTEFYWEKD

     351  NNEVIYSVFI RGLRQYAGCK VNVGK*

Protein Sequence for YDL193W_YPS163 from Stanford:

YDL193W_YPS163 [source=Stanford]  Length: 376  Thu Aug 16 06:46:55 2018  Type: P  Check: 8217  ..

       1  MPTMIKKDDK AMEPPNEKPH RKIERDDVPE SSNHIPPPES GVLKGGKVNS

      51  KTRALKAVTS IIADADENPQ KKVNNETNGV QKQKTEDLSK RIGKFEYLFY

     101  KFLLVLLYIC FGLFRYGQYQ YNKMKLRIFS IIYNHAYTPQ LIRQDVIPLK

     151  KIPKRLAAIL EVKPVGDVGG GVTGLLNDAS EIVCWTVSAG IKHLMLYDYD

     201  GILQRNVPEL RMEIHSNLAK YFGPAHVPNY AVKIPHSNKI FYNLDGIETE

     251  TDVGNEIEAN QEKDKIAIEI SLLSNRDGRE TIVDLTKTMA ELCAVNELSV

     301  SDITMDLVDS ELKQLVGPEP DLLLYFGPSL DLQGFPPWHI RLTEFYWEKD

     351  NNEVIYSVFI RGLRQYAGCK VNVGK*

Protein Sequence for YDL193W_YS9 from Stanford:

YDL193W_YS9 [source=Stanford]  Length: 376  Thu Aug 16 06:46:55 2018  Type: P  Check: 8217  ..

       1  MPTMIKKDDK AMEPPNEKPH RKIERDDVPE SSNHIPPPES GVLKGGKVNS

      51  KTRALKAVTS IIADADENPQ KKVNNETNGV QKQKTEDLSK RIGKFEYLFY

     101  KFLLVLLYIC FGLFRYGQYQ YNKMKLRIFS IIYNHAYTPQ LIRQDVIPLK

     151  KIPKRLAAIL EVKPVGDVGG GVTGLLNDAS EIVCWTVSAG IKHLMLYDYD

     201  GILQRNVPEL RMEIHSNLAK YFGPAHVPNY AVKIPHSNKI FYNLDGIETE

     251  TDVGNEIEAN QEKDKIAIEI SLLSNRDGRE TIVDLTKTMA ELCAVNELSV

     301  SDITMDLVDS ELKQLVGPEP DLLLYFGPSL DLQGFPPWHI RLTEFYWEKD

     351  NNEVIYSVFI RGLRQYAGCK VNVGK*

Protein Sequence for YDL193W_ZTW1 from Zhejiang:

YDL193W_ZTW1 [source=Zhejiang]  Length: 376  Thu Aug 16 06:46:55 2018  Type: P  Check: 8001  ..

       1  MPTMIKKDDK AMEPPNEKPH RKIERDDVPE SSNHIPPPES GVLKGGKVNS

      51  KTRALKAVTS IIADADENPQ KKVSNETNGV QKQKTEDLSK RIGKFEYLFY

     101  KFLLVLLYIC FGLFRYGQYQ YHKMKLRIFS IIYNHAYTPQ LIRQDVIPLK

     151  KIPKRLAAIL EVKPVGDVGG GVTGLLNDAS EIVCWTVSAG IKHLMLYDYD

     201  GILQRNVPEL RMEIHSNLAK YFGPAHVPNY AVKIPHSNKI FYNLDGIETE

     251  IDVGNEIEAN QEKDKIAIEI SLLSNRDGRE TIVDLTKTMA ELCAVNELSV

     301  SDITMDLVDS ELKQLVGPEP DLLLYFGPSL DLQGFPPWHI RLTEFYWEKD

     351  NNEVIYSVFI RGLRQYAGCK VNVGK*