LYS20/YDL182W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YDL182W_S288C   1   MTAAKPNPYAAKPGDYLSNVNNFQLIDSTLREGEQFANAFFDTEKKIEIA   50
YDL182W_AWRI1631   1   MTAAKPNPYAAKPGDYLSNVNNFQLIDSTLREGEQFANAFFDTEKKIEIA   50
YDL182W_AWRI796   1   MTAAKPNPYAAKPGDYLSNVNNFQLIDSTLREGEQFANAFFDTEKKIEIA   50
YDL182W_BC187   
   --------------------------------------------------   
YDL182W_BY4741   
   --------------------------------------------------   
YDL182W_BY4742   
   --------------------------------------------------   
YDL182W_CBS7960   1   MTAAKPNPYAAKPGDYLSNVNNFQLIDSTLREGEQFANAFFDTEKKIEIA   50
YDL182W_CEN.PK   
   --------------------------------------------------   
YDL182W_CLIB215   1   MTAAKPNPYAAKPGDYLSNVNNFQLIDSTLREGEQFANAFFDTEKKIEIA   50
YDL182W_CLIB324   1   MTAAKPNPYAAKPGDYLSNVNNFQLIDSTLREGEQFANAFFDTEKKIEIA   50
YDL182W_D273-10B   
   --------------------------------------------------   
YDL182W_DBVPG6044   
   --------------------------------------------------   
YDL182W_EC1118   1   MTAAKPNPYAAKPGDYLSNVNNFQLIDSTLREGEQFANAFFDTEKKIEIA   50
YDL182W_FL100   
   --------------------------------------------------   
YDL182W_FY1679   
   --------------------------------------------------   
YDL182W_FostersB   1   MTAAKPNPYAAKPGDYLSNVNNFQLIDSTLREGEQFANAFFDTEKKIEIA   50
YDL182W_FostersO   1   MTAAKPNPYAAKPGDYLSNVNNFQLIDSTLREGEQFANAFFDTEKKIEIA   50
YDL182W_JK9-3d   
   --------------------------------------------------   
YDL182W_K11   
   --------------------------------------------------   
YDL182W_Kyokai7   1   MTAAKPNPYAAKPGDYLSNVNNFQLIDSTLREGEQFANAFFDTEKKIEIA   50
YDL182W_L1528   
   --------------------------------------------------   
YDL182W_LalvinQA23   
   --------------------------------------------------   
YDL182W_RM11-1a   
   --------------------------------------------------   
YDL182W_SEY6210   
   --------------------------------------------------   
YDL182W_SK1   
   --------------------------------------------------   
YDL182W_UWOPS05_217_3   
   --------------------------------------------------   
YDL182W_VL3   1   MTAAKPNPYAAKPGDYLSNVNNFQLIDSTLREGEQFANAFFDTEKKIEIA   50
YDL182W_Vin13   1   MTAAKPNPYAAKPGDYLSNVNNFQLIDSTLREGEQFANAFFDTEKKIEIA   50
YDL182W_W303   
   --------------------------------------------------   
YDL182W_X2180-1A   
   --------------------------------------------------   
YDL182W_Y55   
   --------------------------------------------------   
YDL182W_YJM269   1   MTAAKPNPYAAKPGDYLSNVNNFQLIDSTLREGEQFANAFFDTEKKIEIA   50
YDL182W_YJM339   
   --------------------------------------------------   
YDL182W_YJM789   1   MTAAKPNPYAAKPGDYLSNVNNFQLIDSTLREGEQFANAFFDTEKKIEIA   50
YDL182W_YPH499   
   --------------------------------------------------   
YDL182W_YPS128   
   --------------------------------------------------   
YDL182W_YPS163   
   --------------------------------------------------   
YDL182W_YS9   
   --------------------------------------------------   
YDL182W_ZTW1   1   MTAAKPNPYAAKPGDYLSNVNNFQLIDSTLREGEQFANAFFDTEKKIEIA   50
         

YDL182W_S288C   51   RALDDFGVDYIELTSPVASEQSRKDCEAICKLGLKAKILTHIRCHMDDAK   100
YDL182W_AWRI1631   51   RALDDFGVDYIELTSPVASEQSRKDCEAICKLGLKAKILTHIRCHMDDAR   100
YDL182W_AWRI796   51   RALDDFGVDYIELTSPVASEQSRKDCEAICKLGLKAKILTHIRCHMDDAK   100
YDL182W_BC187   1   ---------------------------------------------MDDAK   5
YDL182W_BY4741   1   ---------------------------------------------MDDAK   5
YDL182W_BY4742   1   ---------------------------------------------MDDAR   5
YDL182W_CBS7960   51   RALDDFGVDYIELTSPVASEQSRKDCEAICKLGLKAKILTHIRCHMDDAK   100
YDL182W_CEN.PK   1   ---------------------------------------------MDDAK   5
YDL182W_CLIB215   51   RALDDFGVDYIELTSPVASEQSRKDCEAICKLGLKAKILTHIRCHMDDAK   100
YDL182W_CLIB324   51   RALDDFGVDYIELTSPVASEQSRKDCEAICKLGLKAKILTHIRCHMDDAK   100
YDL182W_D273-10B   1   ---------------------------------------------MDDAK   5
YDL182W_DBVPG6044   1   ---------------------------------------------MDDAR   5
YDL182W_EC1118   51   RALDDFGVDYIELTSPVASEQSRKDCEAICKLGLKAKILTHIRCHMDDAK   100
YDL182W_FL100   1   ---------------------------------------------MDDAR   5
YDL182W_FY1679   1   ---------------------------------------------MDDAR   5
YDL182W_FostersB   51   RALDDFGVDYIELTSPVASEQSRKDCEAICKLGLKAKILTHIRCHMDDAK   100
YDL182W_FostersO   51   RALDDFGVDYIELTSPVASEQSRKDCEAICKLGLKAKILTHIRCHMDDAK   100
YDL182W_JK9-3d   1   ---------------------------------------------MDDAK   5
YDL182W_K11   1   ---------------------------------------------MDDAK   5
YDL182W_Kyokai7   51   RALDDFGVDYIELTSPVASEQSRKDCEAICKLGLKAKILTHIRCHMDDAK   100
YDL182W_L1528   1   ---------------------------------------------MDDAK   5
YDL182W_LalvinQA23   1   ---------------------------------------------MDDAK   5
YDL182W_RM11-1a   1   ---------------------------------------------MDDAK   5
YDL182W_SEY6210   1   ---------------------------------------------MDDAK   5
YDL182W_SK1   1   ---------------------------------------------MDDAR   5
YDL182W_UWOPS05_217_3   1   ---------------------------------------------MDDAK   5
YDL182W_VL3   51   RALDDFGVDYIELTSPVASEQSRKDCEAICKLGLKAKILTHIRCHMDDAK   100
YDL182W_Vin13   51   RALDDFGVDYIELTSPVASEQSRKDCEAICKLGLKAKILTHIRCHMDDAK   100
YDL182W_W303   1   ---------------------------------------------MDDAK   5
YDL182W_X2180-1A   1   ---------------------------------------------MDDAK   5
YDL182W_Y55   1   ---------------------------------------------MDDAR   5
YDL182W_YJM269   51   RALDDFGVDYIELTSPVASEQSRKDCEAICKLGLKAKILTHIRCHMDDAK   100
YDL182W_YJM339   1   ---------------------------------------------MDDAK   5
YDL182W_YJM789   51   RALDDFGVDYIELTSPVASEQSRKDCEAICKLGLKAKILTHIRCHMDDAK   100
YDL182W_YPH499   1   ---------------------------------------------MDDAR   5
YDL182W_YPS128   1   ---------------------------------------------MDDAK   5
YDL182W_YPS163   1   ---------------------------------------------MDDAK   5
YDL182W_YS9   1   ---------------------------------------------MDDAR   5
YDL182W_ZTW1   51   RALDDFGVDYIELTSPVASEQSRKDCEAICKLGLKAKILTHIRCHMDDAK   100
         

YDL182W_S288C   101   VAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEI   150
YDL182W_AWRI1631   101   VAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEI   150
YDL182W_AWRI796   101   VAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEI   150
YDL182W_BC187   6   VAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEI   55
YDL182W_BY4741   6   VAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEI   55
YDL182W_BY4742   6   VAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEI   55
YDL182W_CBS7960   101   VAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEI   150
YDL182W_CEN.PK   6   VAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEI   55
YDL182W_CLIB215   101   VAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEI   150
YDL182W_CLIB324   101   VAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEI   150
YDL182W_D273-10B   6   VAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEI   55
YDL182W_DBVPG6044   6   VAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEI   55
YDL182W_EC1118   101   VAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEI   150
YDL182W_FL100   6   VAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEI   55
YDL182W_FY1679   6   VAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEI   55
YDL182W_FostersB   101   VAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKXIEI   150
YDL182W_FostersO   101   VAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEI   150
YDL182W_JK9-3d   6   VAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEI   55
YDL182W_K11   6   VAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEI   55
YDL182W_Kyokai7   101   VAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEI   150
YDL182W_L1528   6   VAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEI   55
YDL182W_LalvinQA23   6   VAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEI   55
YDL182W_RM11-1a   6   VAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEI   55
YDL182W_SEY6210   6   VAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEI   55
YDL182W_SK1   6   VAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEI   55
YDL182W_UWOPS05_217_3   6   VAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEI   55
YDL182W_VL3   101   VAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEI   150
YDL182W_Vin13   101   VAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEI   150
YDL182W_W303   6   VAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEI   55
YDL182W_X2180-1A   6   VAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEI   55
YDL182W_Y55   6   VAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEI   55
YDL182W_YJM269   101   VAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEI   150
YDL182W_YJM339   6   VAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEI   55
YDL182W_YJM789   101   VAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEI   150
YDL182W_YPH499   6   VAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEI   55
YDL182W_YPS128   6   VAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEI   55
YDL182W_YPS163   6   VAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEI   55
YDL182W_YS9   6   VAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEI   55
YDL182W_ZTW1   101   VAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEI   150
         

YDL182W_S288C   151   RFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRT   200
YDL182W_AWRI1631   151   RFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRT   200
YDL182W_AWRI796   151   RFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRT   200
YDL182W_BC187   56   RFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRT   105
YDL182W_BY4741   56   RFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRT   105
YDL182W_BY4742   56   RFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRT   105
YDL182W_CBS7960   151   RFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRT   200
YDL182W_CEN.PK   56   RFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRT   105
YDL182W_CLIB215   151   RFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRT   200
YDL182W_CLIB324   151   RFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRT   200
YDL182W_D273-10B   56   RFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRT   105
YDL182W_DBVPG6044   56   RFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRT   105
YDL182W_EC1118   151   RFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRT   200
YDL182W_FL100   56   RFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRT   105
YDL182W_FY1679   56   RFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRT   105
YDL182W_FostersB   151   RFSSEDSFRSDXVDLLNIYKTVDKIGVNRVGIADTVGCXNPRQVYELIRT   200
YDL182W_FostersO   151   RFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRT   200
YDL182W_JK9-3d   56   RFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRT   105
YDL182W_K11   56   RFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRT   105
YDL182W_Kyokai7   151   RFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRT   200
YDL182W_L1528   56   RFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRT   105
YDL182W_LalvinQA23   56   RFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRT   105
YDL182W_RM11-1a   56   RFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRT   105
YDL182W_SEY6210   56   RFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRT   105
YDL182W_SK1   56   RFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRT   105
YDL182W_UWOPS05_217_3   56   RFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRT   105
YDL182W_VL3   151   RFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRT   200
YDL182W_Vin13   151   RFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRT   200
YDL182W_W303   56   RFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRT   105
YDL182W_X2180-1A   56   RFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRT   105
YDL182W_Y55   56   RFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRT   105
YDL182W_YJM269   151   RFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRT   200
YDL182W_YJM339   56   RFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRT   105
YDL182W_YJM789   151   RFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRT   200
YDL182W_YPH499   56   RFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRT   105
YDL182W_YPS128   56   RFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRT   105
YDL182W_YPS163   56   RFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRT   105
YDL182W_YS9   56   RFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRT   105
YDL182W_ZTW1   151   RFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELIRT   200
         

YDL182W_S288C   201   LKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITP   250
YDL182W_AWRI1631   201   LKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITP   250
YDL182W_AWRI796   201   LKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITP   250
YDL182W_BC187   106   LKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITP   155
YDL182W_BY4741   106   LKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITP   155
YDL182W_BY4742   106   LKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITP   155
YDL182W_CBS7960   201   LKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITP   250
YDL182W_CEN.PK   106   LKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITP   155
YDL182W_CLIB215   201   LKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITP   250
YDL182W_CLIB324   201   LKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITP   250
YDL182W_D273-10B   106   LKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITP   155
YDL182W_DBVPG6044   106   LKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITP   155
YDL182W_EC1118   201   LKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITP   250
YDL182W_FL100   106   LKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITP   155
YDL182W_FY1679   106   LKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITP   155
YDL182W_FostersB   201   LKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITP   250
YDL182W_FostersO   201   LKSVVSCDIECHFHNDTGCAXANAYTALEGGARLIDVSVLGIGERNGITP   250
YDL182W_JK9-3d   106   LKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITP   155
YDL182W_K11   106   LKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITP   155
YDL182W_Kyokai7   201   LKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITP   250
YDL182W_L1528   106   LKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITP   155
YDL182W_LalvinQA23   106   LKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITP   155
YDL182W_RM11-1a   106   LKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITP   155
YDL182W_SEY6210   106   LKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITP   155
YDL182W_SK1   106   LKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITP   155
YDL182W_UWOPS05_217_3   106   LKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITP   155
YDL182W_VL3   201   LKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITP   250
YDL182W_Vin13   201   LKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITP   250
YDL182W_W303   106   LKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITP   155
YDL182W_X2180-1A   106   LKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITP   155
YDL182W_Y55   106   LKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITP   155
YDL182W_YJM269   201   LKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITP   250
YDL182W_YJM339   106   LKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITP   155
YDL182W_YJM789   201   LKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITP   250
YDL182W_YPH499   106   LKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITP   155
YDL182W_YPS128   106   LKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITP   155
YDL182W_YPS163   106   LKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITP   155
YDL182W_YS9   106   LKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVLGIGERNGITP   155
YDL182W_ZTW1   201   LKSVVSCDIECHFHNDTGLCHCKRLHCFGRWCQID---------------   235
         

YDL182W_S288C   251   LGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC   300
YDL182W_AWRI1631   251   LGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC   300
YDL182W_AWRI796   251   LGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC   300
YDL182W_BC187   156   LGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC   205
YDL182W_BY4741   156   LGGLMARMIVAAPDYVRSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC   205
YDL182W_BY4742   156   LGGLMARMIVAAPDYVRSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC   205
YDL182W_CBS7960   251   LGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC   300
YDL182W_CEN.PK   156   LGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC   205
YDL182W_CLIB215   251   LGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC   300
YDL182W_CLIB324   251   LGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC   300
YDL182W_D273-10B   156   LGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC   205
YDL182W_DBVPG6044   156   LGGLMARMIVAAPEYVKSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC   205
YDL182W_EC1118   251   LGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC   300
YDL182W_FL100   156   LGGLMARMIVAAPDYVRSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC   205
YDL182W_FY1679   156   LGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC   205
YDL182W_FostersB   251   LGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC   300
YDL182W_FostersO   251   LGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC   300
YDL182W_JK9-3d   156   LGGLMARMIVAAPDYVRSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC   205
YDL182W_K11   156   LGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC   205
YDL182W_Kyokai7   251   LGGLMARMIVAAPDYVRSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC   300
YDL182W_L1528   156   LGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC   205
YDL182W_LalvinQA23   156   LGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC   205
YDL182W_RM11-1a   156   LGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC   205
YDL182W_SEY6210   156   LGGLMARMIVAAPDYVRSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC   205
YDL182W_SK1   156   LGGLMARMIVAAPDYVRSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC   205
YDL182W_UWOPS05_217_3   156   LGGLMARMIVAAPDYVRSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC   205
YDL182W_VL3   251   LGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC   300
YDL182W_Vin13   251   LGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC   300
YDL182W_W303   156   LGGLMARMIVAAPDYVRSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC   205
YDL182W_X2180-1A   156   LGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC   205
YDL182W_Y55   156   LGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC   205
YDL182W_YJM269   251   LGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC   300
YDL182W_YJM339   156   LGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC   205
YDL182W_YJM789   251   LGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC   300
YDL182W_YPH499   156   LGGLMARMIVAAPDYVRSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC   205
YDL182W_YPS128   156   LGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC   205
YDL182W_YPS163   156   LGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC   205
YDL182W_YS9   156   LGGLMARMIVAAPDYVRSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC   205
YDL182W_ZTW1   
   --------------------------------------------------   
         

YDL182W_S288C   301   AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKARV   350
YDL182W_AWRI1631   301   AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKARV   350
YDL182W_AWRI796   301   AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKARV   350
YDL182W_BC187   206   AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKARV   255
YDL182W_BY4741   206   AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKSRV   255
YDL182W_BY4742   206   AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKSRV   255
YDL182W_CBS7960   301   AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKARV   350
YDL182W_CEN.PK   206   AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKARV   255
YDL182W_CLIB215   301   AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKARV   350
YDL182W_CLIB324   301   AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKARV   350
YDL182W_D273-10B   206   AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKSRV   255
YDL182W_DBVPG6044   206   AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKARV   255
YDL182W_EC1118   301   AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKARV   350
YDL182W_FL100   206   AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKSRV   255
YDL182W_FY1679   206   AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKSRV   255
YDL182W_FostersB   301   AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKARV   350
YDL182W_FostersO   301   AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKARV   350
YDL182W_JK9-3d   206   AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKARV   255
YDL182W_K11   206   AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKARV   255
YDL182W_Kyokai7   301   AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKARV   350
YDL182W_L1528   206   AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKARV   255
YDL182W_LalvinQA23   206   AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKARV   255
YDL182W_RM11-1a   206   AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKSRV   255
YDL182W_SEY6210   206   AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKSRV   255
YDL182W_SK1   206   AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKARV   255
YDL182W_UWOPS05_217_3   206   AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKARV   255
YDL182W_VL3   301   AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKARV   350
YDL182W_Vin13   301   AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKARV   350
YDL182W_W303   206   AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKSRV   255
YDL182W_X2180-1A   206   AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKARV   255
YDL182W_Y55   206   AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKARV   255
YDL182W_YJM269   301   AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLLEPSKPECSE   350
YDL182W_YJM339   206   AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKARV   255
YDL182W_YJM789   301   AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKARV   350
YDL182W_YPH499   206   AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKSRV   255
YDL182W_YPS128   206   AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKARV   255
YDL182W_YPS163   206   AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKARV   255
YDL182W_YS9   206   AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKARV   255
YDL182W_ZTW1   
   --------------------------------------------------   
         

YDL182W_S288C   351   DQLNLNLTDDQIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVL   400
YDL182W_AWRI1631   351   DQLNLNLTDDQIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVL   400
YDL182W_AWRI796   351   DQLNLNLTDDQIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVL   400
YDL182W_BC187   256   DQLNLNLTDDQIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVL   305
YDL182W_BY4741   256   DQLNLNLTDDQIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVL   305
YDL182W_BY4742   256   DQLNLNLTDDQIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVL   305
YDL182W_CBS7960   351   DQLNLNLTDDQIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVL   400
YDL182W_CEN.PK   256   DQLNLNLTDDQIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVL   305
YDL182W_CLIB215   351   DQLNLNLTDDQIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVL   400
YDL182W_CLIB324   351   DQLNLNLTDDQIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVL   400
YDL182W_D273-10B   256   DQLNLNLTDDQIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVL   305
YDL182W_DBVPG6044   256   DQLNLNLTDDQIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVL   305
YDL182W_EC1118   351   DQLNLNLTDDQIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVL   400
YDL182W_FL100   256   DQLNLNLTDDQIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVL   305
YDL182W_FY1679   256   DQLNLNLTDDQIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVL   305
YDL182W_FostersB   351   DQLNLNLTDDQIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVL   400
YDL182W_FostersO   351   DQLNLNLTDDQIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVX   400
YDL182W_JK9-3d   256   DQLNLNLTDDQIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVL   305
YDL182W_K11   256   DQLNLNLTDDQIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVL   305
YDL182W_Kyokai7   351   DQLNLNLTDDQIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVL   400
YDL182W_L1528   256   DQLNLNLTDDQIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVL   305
YDL182W_LalvinQA23   256   DQLNLNLTDDQIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVL   305
YDL182W_RM11-1a   256   DQLNLNLTDDQIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVL   305
YDL182W_SEY6210   256   DQLNLNLTDDQIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVL   305
YDL182W_SK1   256   DQLNLNLTDDQIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVL   305
YDL182W_UWOPS05_217_3   256   DQLNLNLTDDQIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVL   305
YDL182W_VL3   351   DQLNLNLTDDQIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVL   400
YDL182W_Vin13   351   DQLNLNLTDDQIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVL   400
YDL182W_W303   256   DQLNLNLTDDQIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVL   305
YDL182W_X2180-1A   256   DQLNLNLTDDQIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVL   305
YDL182W_Y55   256   DQLNLNLTDDQIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVL   305
YDL182W_YJM269   351   LELG----------------------------------------------   354
YDL182W_YJM339   256   DQLNLNLTDDQIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVL   305
YDL182W_YJM789   351   DQLNLNLTDDQIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVL   400
YDL182W_YPH499   256   DQLNLNLTDDQIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVL   305
YDL182W_YPS128   256   DQLNLNLTDDQIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVL   305
YDL182W_YPS163   256   DQLNLNLTDDQIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVL   305
YDL182W_YS9   256   DQLNLNLTDDQIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVL   305
YDL182W_ZTW1   
   --------------------------------------------------   
         

YDL182W_S288C   401   SAKKNKKNDSDVPELATIPAAKRTKPSA------------------   428
YDL182W_AWRI1631   401   SAKKNKKNDSDVPELATIPAAKRTKPSA------------------   428
YDL182W_AWRI796   401   SXKKEQEE--------------------------------------   408
YDL182W_BC187   306   SAKKNKKNDSDVPELATIPAAKRTKPSA------------------   333
YDL182W_BY4741   306   SAKKNKKNDSDVPELATIPAAKRTKPSA------------------   333
YDL182W_BY4742   306   SAKKNKKNDSDVPELATIPAAKRTKPSA------------------   333
YDL182W_CBS7960   401   SAKKNKKNDSDVPELATIPAAKRTKPSA------------------   428
YDL182W_CEN.PK   306   SAKKNKKNDSDVPELATIPAAKRTKPSA------------------   333
YDL182W_CLIB215   401   SAKKNKKNDSDVPELATIPAAKRTKPSA------------------   428
YDL182W_CLIB324   401   SAKKNKKNDSDVPELATIPAAKRTKPSA------------------   428
YDL182W_D273-10B   306   SAKKNKKNDSDVPELATIPAAKRTKPSA------------------   333
YDL182W_DBVPG6044   306   SAKKNKKNDSDVPELATIPAAKRTKPSA------------------   333
YDL182W_EC1118   401   SAKKNKKNDSDVPELATIPAAKRTKPSA------------------   428
YDL182W_FL100   306   SAKKNKKNDSDVPELATIPAAKRTKPSA------------------   333
YDL182W_FY1679   306   SAKKNKKNDSDVPELATIPAAKRTKPSA------------------   333
YDL182W_FostersB   401   SAKKEQEE--------------------------------------   408
YDL182W_FostersO   401   SXKKETRRMTAMYRNWPPSPPPSXLSHPPNVPKPLHYVLSLITYDI   446
YDL182W_JK9-3d   306   SAKKNKKNDSDVPELATIPAAKRTKPSA------------------   333
YDL182W_K11   306   SAKKNKKNDSDVPELATIPAAKRTKPSA------------------   333
YDL182W_Kyokai7   401   SAKKNKKNDSDVPELATIPAAKRTKPSA------------------   428
YDL182W_L1528   306   SAKKNKKNDSDVPELATIPAAKRTKPSA------------------   333
YDL182W_LalvinQA23   306   SAKKEQEE--------------------------------------   313
YDL182W_RM11-1a   306   SAKKNKKNDSDVPELATIPAAKRTKPSA------------------   333
YDL182W_SEY6210   306   SAKKNKKNDSDVPELATIPAAKRTKPSA------------------   333
YDL182W_SK1   306   SAKKNKKNDSDVPELATIPAAKRTKPSA------------------   333
YDL182W_UWOPS05_217_3   306   SAKKNKKNDSDVPELATIPAAKRTKPSA------------------   333
YDL182W_VL3   401   SXKKNKKNDSDVPELATIPAAKRTKPSA------------------   428
YDL182W_Vin13   401   SAKKNKKNDSDVPELATIPAAKRTKPSA------------------   428
YDL182W_W303   306   SAKKNKKNDSDVPELATIPAAKRTKPSA------------------   333
YDL182W_X2180-1A   306   SAKKNKKNDSDVPELATIPAAKRTKPSA------------------   333
YDL182W_Y55   306   SAKKNKKNDSDVPELATIPAAKRTKPSA------------------   333
YDL182W_YJM269   
   ----------------------------------------------   
YDL182W_YJM339   306   SAKKNKKNDSDVPELATIPAAKRTKPSA------------------   333
YDL182W_YJM789   401   SAKKNKKNDSDVPELATIPAAKRTKPSA------------------   428
YDL182W_YPH499   306   SAKKNKKNDSDVPELATIPAAKRTKPSA------------------   333
YDL182W_YPS128   306   SAKKNKKNDSDVPELATIPAAKRTKPSA------------------   333
YDL182W_YPS163   306   SAKKNKKNDSDVPELATIPAAKRTKPSA------------------   333
YDL182W_YS9   306   SAKKNKKNDSDVPELATIPAAKRTKPSA------------------   333
YDL182W_ZTW1   
   ----------------------------------------------   
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YDL182W_S288C from SGD:

YDL182W_S288C [source=SGD]  Length: 429  Sat Sep 23 00:44:55 2017  Type: P  Check: 3773  ..

       1  MTAAKPNPYA AKPGDYLSNV NNFQLIDSTL REGEQFANAF FDTEKKIEIA

      51  RALDDFGVDY IELTSPVASE QSRKDCEAIC KLGLKAKILT HIRCHMDDAK

     101  VAVETGVDGV DVVIGTSKFL RQYSHGKDMN YIAKSAVEVI EFVKSKGIEI

     151  RFSSEDSFRS DLVDLLNIYK TVDKIGVNRV GIADTVGCAN PRQVYELIRT

     201  LKSVVSCDIE CHFHNDTGCA IANAYTALEG GARLIDVSVL GIGERNGITP

     251  LGGLMARMIV AAPDYVKSKY KLHKIRDIEN LVADAVEVNI PFNNPITGFC

     301  AFTHKAGIHA KAILANPSTY EILDPHDFGM KRYIHFANRL TGWNAIKARV

     351  DQLNLNLTDD QIKEVTAKIK KLGDVRSLNI DDVDSIIKNF HAEVSTPQVL

     401  SAKKNKKNDS DVPELATIPA AKRTKPSA*

Protein Sequence for YDL182W_AWRI1631 from AWRI:

YDL182W_AWRI1631 [source=AWRI]  Length: 429  Sat Sep 23 00:44:55 2017  Type: P  Check: 4074  ..

       1  MTAAKPNPYA AKPGDYLSNV NNFQLIDSTL REGEQFANAF FDTEKKIEIA

      51  RALDDFGVDY IELTSPVASE QSRKDCEAIC KLGLKAKILT HIRCHMDDAR

     101  VAVETGVDGV DVVIGTSKFL RQYSHGKDMN YIAKSAVEVI EFVKSKGIEI

     151  RFSSEDSFRS DLVDLLNIYK TVDKIGVNRV GIADTVGCAN PRQVYELIRT

     201  LKSVVSCDIE CHFHNDTGCA IANAYTALEG GARLIDVSVL GIGERNGITP

     251  LGGLMARMIV AAPDYVKSKY KLHKIRDIEN LVADAVEVNI PFNNPITGFC

     301  AFTHKAGIHA KAILANPSTY EILDPHDFGM KRYIHFANRL TGWNAIKARV

     351  DQLNLNLTDD QIKEVTAKIK KLGDVRSLNI DDVDSIIKNF HAEVSTPQVL

     401  SAKKNKKNDS DVPELATIPA AKRTKPSA*

Protein Sequence for YDL182W_AWRI796 from AWRI:

YDL182W_AWRI796 [source=AWRI]  Length: 409  Sat Sep 23 00:44:55 2017  Type: P  Check: 3452  ..

       1  MTAAKPNPYA AKPGDYLSNV NNFQLIDSTL REGEQFANAF FDTEKKIEIA

      51  RALDDFGVDY IELTSPVASE QSRKDCEAIC KLGLKAKILT HIRCHMDDAK

     101  VAVETGVDGV DVVIGTSKFL RQYSHGKDMN YIAKSAVEVI EFVKSKGIEI

     151  RFSSEDSFRS DLVDLLNIYK TVDKIGVNRV GIADTVGCAN PRQVYELIRT

     201  LKSVVSCDIE CHFHNDTGCA IANAYTALEG GARLIDVSVL GIGERNGITP

     251  LGGLMARMIV AAPDYVKSKY KLHKIRDIEN LVADAVEVNI PFNNPITGFC

     301  AFTHKAGIHA KAILANPSTY EILDPHDFGM KRYIHFANRL TGWNAIKARV

     351  DQLNLNLTDD QIKEVTAKIK KLGDVRSLNI DDVDSIIKNF HAEVSTPQVL

     401  SXKKEQEE*

Protein Sequence for YDL182W_BC187 from Stanford:

YDL182W_BC187 [source=Stanford]  Length: 334  Sat Sep 23 00:44:55 2017  Type: P  Check: 8126  ..

       1  MDDAKVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VKSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKARVDQLNL NLTDDQIKEV TAKIKKLGDV RSLNIDDVDS IIKNFHAEVS

     301  TPQVLSAKKN KKNDSDVPEL ATIPAAKRTK PSA*

Protein Sequence for YDL182W_BY4741 from Stanford:

YDL182W_BY4741 [source=Stanford]  Length: 334  Sat Sep 23 00:44:55 2017  Type: P  Check: 8583  ..

       1  MDDAKVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VRSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKSRVDQLNL NLTDDQIKEV TAKIKKLGDV RSLNIDDVDS IIKNFHAEVS

     301  TPQVLSAKKN KKNDSDVPEL ATIPAAKRTK PSA*

Protein Sequence for YDL182W_BY4742 from Stanford:

YDL182W_BY4742 [source=Stanford]  Length: 334  Sat Sep 23 00:44:55 2017  Type: P  Check: 8618  ..

       1  MDDARVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VRSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKSRVDQLNL NLTDDQIKEV TAKIKKLGDV RSLNIDDVDS IIKNFHAEVS

     301  TPQVLSAKKN KKNDSDVPEL ATIPAAKRTK PSA*

Protein Sequence for YDL182W_CBS7960 from WashU:

YDL182W_CBS7960 [source=WashU]  Length: 429  Sat Sep 23 00:44:55 2017  Type: P  Check: 3773  ..

       1  MTAAKPNPYA AKPGDYLSNV NNFQLIDSTL REGEQFANAF FDTEKKIEIA

      51  RALDDFGVDY IELTSPVASE QSRKDCEAIC KLGLKAKILT HIRCHMDDAK

     101  VAVETGVDGV DVVIGTSKFL RQYSHGKDMN YIAKSAVEVI EFVKSKGIEI

     151  RFSSEDSFRS DLVDLLNIYK TVDKIGVNRV GIADTVGCAN PRQVYELIRT

     201  LKSVVSCDIE CHFHNDTGCA IANAYTALEG GARLIDVSVL GIGERNGITP

     251  LGGLMARMIV AAPDYVKSKY KLHKIRDIEN LVADAVEVNI PFNNPITGFC

     301  AFTHKAGIHA KAILANPSTY EILDPHDFGM KRYIHFANRL TGWNAIKARV

     351  DQLNLNLTDD QIKEVTAKIK KLGDVRSLNI DDVDSIIKNF HAEVSTPQVL

     401  SAKKNKKNDS DVPELATIPA AKRTKPSA*

Protein Sequence for YDL182W_CEN.PK from Stanford:

YDL182W_CEN.PK [source=Stanford]  Length: 334  Sat Sep 23 00:44:55 2017  Type: P  Check: 8126  ..

       1  MDDAKVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VKSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKARVDQLNL NLTDDQIKEV TAKIKKLGDV RSLNIDDVDS IIKNFHAEVS

     301  TPQVLSAKKN KKNDSDVPEL ATIPAAKRTK PSA*

Protein Sequence for YDL182W_CLIB215 from WashU:

YDL182W_CLIB215 [source=WashU]  Length: 429  Sat Sep 23 00:44:55 2017  Type: P  Check: 3773  ..

       1  MTAAKPNPYA AKPGDYLSNV NNFQLIDSTL REGEQFANAF FDTEKKIEIA

      51  RALDDFGVDY IELTSPVASE QSRKDCEAIC KLGLKAKILT HIRCHMDDAK

     101  VAVETGVDGV DVVIGTSKFL RQYSHGKDMN YIAKSAVEVI EFVKSKGIEI

     151  RFSSEDSFRS DLVDLLNIYK TVDKIGVNRV GIADTVGCAN PRQVYELIRT

     201  LKSVVSCDIE CHFHNDTGCA IANAYTALEG GARLIDVSVL GIGERNGITP

     251  LGGLMARMIV AAPDYVKSKY KLHKIRDIEN LVADAVEVNI PFNNPITGFC

     301  AFTHKAGIHA KAILANPSTY EILDPHDFGM KRYIHFANRL TGWNAIKARV

     351  DQLNLNLTDD QIKEVTAKIK KLGDVRSLNI DDVDSIIKNF HAEVSTPQVL

     401  SAKKNKKNDS DVPELATIPA AKRTKPSA*

Protein Sequence for YDL182W_CLIB324 from WashU:

YDL182W_CLIB324 [source=WashU]  Length: 429  Sat Sep 23 00:44:55 2017  Type: P  Check: 3773  ..

       1  MTAAKPNPYA AKPGDYLSNV NNFQLIDSTL REGEQFANAF FDTEKKIEIA

      51  RALDDFGVDY IELTSPVASE QSRKDCEAIC KLGLKAKILT HIRCHMDDAK

     101  VAVETGVDGV DVVIGTSKFL RQYSHGKDMN YIAKSAVEVI EFVKSKGIEI

     151  RFSSEDSFRS DLVDLLNIYK TVDKIGVNRV GIADTVGCAN PRQVYELIRT

     201  LKSVVSCDIE CHFHNDTGCA IANAYTALEG GARLIDVSVL GIGERNGITP

     251  LGGLMARMIV AAPDYVKSKY KLHKIRDIEN LVADAVEVNI PFNNPITGFC

     301  AFTHKAGIHA KAILANPSTY EILDPHDFGM KRYIHFANRL TGWNAIKARV

     351  DQLNLNLTDD QIKEVTAKIK KLGDVRSLNI DDVDSIIKNF HAEVSTPQVL

     401  SAKKNKKNDS DVPELATIPA AKRTKPSA*

Protein Sequence for YDL182W_D273-10B from Stanford:

YDL182W_D273-10B [source=Stanford]  Length: 334  Sat Sep 23 00:44:55 2017  Type: P  Check: 8576  ..

       1  MDDAKVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VKSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKSRVDQLNL NLTDDQIKEV TAKIKKLGDV RSLNIDDVDS IIKNFHAEVS

     301  TPQVLSAKKN KKNDSDVPEL ATIPAAKRTK PSA*

Protein Sequence for YDL182W_DBVPG6044 from Stanford:

YDL182W_DBVPG6044 [source=Stanford]  Length: 334  Sat Sep 23 00:44:55 2017  Type: P  Check: 8216  ..

       1  MDDARVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPEY VKSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKARVDQLNL NLTDDQIKEV TAKIKKLGDV RSLNIDDVDS IIKNFHAEVS

     301  TPQVLSAKKN KKNDSDVPEL ATIPAAKRTK PSA*

Protein Sequence for YDL182W_EC1118 from Genoscope:

YDL182W_EC1118 [source=Genoscope]  Length: 429  Sat Sep 23 00:44:55 2017  Type: P  Check: 3773  ..

       1  MTAAKPNPYA AKPGDYLSNV NNFQLIDSTL REGEQFANAF FDTEKKIEIA

      51  RALDDFGVDY IELTSPVASE QSRKDCEAIC KLGLKAKILT HIRCHMDDAK

     101  VAVETGVDGV DVVIGTSKFL RQYSHGKDMN YIAKSAVEVI EFVKSKGIEI

     151  RFSSEDSFRS DLVDLLNIYK TVDKIGVNRV GIADTVGCAN PRQVYELIRT

     201  LKSVVSCDIE CHFHNDTGCA IANAYTALEG GARLIDVSVL GIGERNGITP

     251  LGGLMARMIV AAPDYVKSKY KLHKIRDIEN LVADAVEVNI PFNNPITGFC

     301  AFTHKAGIHA KAILANPSTY EILDPHDFGM KRYIHFANRL TGWNAIKARV

     351  DQLNLNLTDD QIKEVTAKIK KLGDVRSLNI DDVDSIIKNF HAEVSTPQVL

     401  SAKKNKKNDS DVPELATIPA AKRTKPSA*

Protein Sequence for YDL182W_FL100 from Stanford:

YDL182W_FL100 [source=Stanford]  Length: 334  Sat Sep 23 00:44:55 2017  Type: P  Check: 8618  ..

       1  MDDARVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VRSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKSRVDQLNL NLTDDQIKEV TAKIKKLGDV RSLNIDDVDS IIKNFHAEVS

     301  TPQVLSAKKN KKNDSDVPEL ATIPAAKRTK PSA*

Protein Sequence for YDL182W_FY1679 from Stanford:

YDL182W_FY1679 [source=Stanford]  Length: 334  Sat Sep 23 00:44:55 2017  Type: P  Check: 8611  ..

       1  MDDARVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VKSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKSRVDQLNL NLTDDQIKEV TAKIKKLGDV RSLNIDDVDS IIKNFHAEVS

     301  TPQVLSAKKN KKNDSDVPEL ATIPAAKRTK PSA*

Protein Sequence for YDL182W_FostersB from AWRI:

YDL182W_FostersB [source=AWRI]  Length: 409  Sat Sep 23 00:44:55 2017  Type: P  Check: 4934  ..

       1  MTAAKPNPYA AKPGDYLSNV NNFQLIDSTL REGEQFANAF FDTEKKIEIA

      51  RALDDFGVDY IELTSPVASE QSRKDCEAIC KLGLKAKILT HIRCHMDDAK

     101  VAVETGVDGV DVVIGTSKFL RQYSHGKDMN YIAKSAVEVI EFVKSKXIEI

     151  RFSSEDSFRS DXVDLLNIYK TVDKIGVNRV GIADTVGCXN PRQVYELIRT

     201  LKSVVSCDIE CHFHNDTGCA IANAYTALEG GARLIDVSVL GIGERNGITP

     251  LGGLMARMIV AAPDYVKSKY KLHKIRDIEN LVADAVEVNI PFNNPITGFC

     301  AFTHKAGIHA KAILANPSTY EILDPHDFGM KRYIHFANRL TGWNAIKARV

     351  DQLNLNLTDD QIKEVTAKIK KLGDVRSLNI DDVDSIIKNF HAEVSTPQVL

     401  SAKKEQEE*

Protein Sequence for YDL182W_FostersO from AWRI:

YDL182W_FostersO [source=AWRI]  Length: 447  Sat Sep 23 00:44:55 2017  Type: P  Check: 2105  ..

       1  MTAAKPNPYA AKPGDYLSNV NNFQLIDSTL REGEQFANAF FDTEKKIEIA

      51  RALDDFGVDY IELTSPVASE QSRKDCEAIC KLGLKAKILT HIRCHMDDAK

     101  VAVETGVDGV DVVIGTSKFL RQYSHGKDMN YIAKSAVEVI EFVKSKGIEI

     151  RFSSEDSFRS DLVDLLNIYK TVDKIGVNRV GIADTVGCAN PRQVYELIRT

     201  LKSVVSCDIE CHFHNDTGCA XANAYTALEG GARLIDVSVL GIGERNGITP

     251  LGGLMARMIV AAPDYVKSKY KLHKIRDIEN LVADAVEVNI PFNNPITGFC

     301  AFTHKAGIHA KAILANPSTY EILDPHDFGM KRYIHFANRL TGWNAIKARV

     351  DQLNLNLTDD QIKEVTAKIK KLGDVRSLNI DDVDSIIKNF HAEVSTPQVX

     401  SXKKETRRMT AMYRNWPPSP PPSXLSHPPN VPKPLHYVLS LITYDI*


Protein Sequence for YDL182W_JK9-3d from Stanford:

YDL182W_JK9-3d [source=Stanford]  Length: 334  Sat Sep 23 00:44:55 2017  Type: P  Check: 8133  ..

       1  MDDAKVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VRSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKARVDQLNL NLTDDQIKEV TAKIKKLGDV RSLNIDDVDS IIKNFHAEVS

     301  TPQVLSAKKN KKNDSDVPEL ATIPAAKRTK PSA*

Protein Sequence for YDL182W_K11 from Stanford:

YDL182W_K11 [source=Stanford]  Length: 334  Sat Sep 23 00:44:55 2017  Type: P  Check: 8126  ..

       1  MDDAKVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VKSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKARVDQLNL NLTDDQIKEV TAKIKKLGDV RSLNIDDVDS IIKNFHAEVS

     301  TPQVLSAKKN KKNDSDVPEL ATIPAAKRTK PSA*

Protein Sequence for YDL182W_Kyokai7 from NRIB:

YDL182W_Kyokai7 [source=NRIB]  Length: 429  Sat Sep 23 00:44:55 2017  Type: P  Check: 4046  ..

       1  MTAAKPNPYA AKPGDYLSNV NNFQLIDSTL REGEQFANAF FDTEKKIEIA

      51  RALDDFGVDY IELTSPVASE QSRKDCEAIC KLGLKAKILT HIRCHMDDAK

     101  VAVETGVDGV DVVIGTSKFL RQYSHGKDMN YIAKSAVEVI EFVKSKGIEI

     151  RFSSEDSFRS DLVDLLNIYK TVDKIGVNRV GIADTVGCAN PRQVYELIRT

     201  LKSVVSCDIE CHFHNDTGCA IANAYTALEG GARLIDVSVL GIGERNGITP

     251  LGGLMARMIV AAPDYVRSKY KLHKIRDIEN LVADAVEVNI PFNNPITGFC

     301  AFTHKAGIHA KAILANPSTY EILDPHDFGM KRYIHFANRL TGWNAIKARV

     351  DQLNLNLTDD QIKEVTAKIK KLGDVRSLNI DDVDSIIKNF HAEVSTPQVL

     401  SAKKNKKNDS DVPELATIPA AKRTKPSA*

Protein Sequence for YDL182W_L1528 from Stanford:

YDL182W_L1528 [source=Stanford]  Length: 334  Sat Sep 23 00:44:55 2017  Type: P  Check: 8126  ..

       1  MDDAKVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VKSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKARVDQLNL NLTDDQIKEV TAKIKKLGDV RSLNIDDVDS IIKNFHAEVS

     301  TPQVLSAKKN KKNDSDVPEL ATIPAAKRTK PSA*

Protein Sequence for YDL182W_LalvinQA23 from AWRI:

YDL182W_LalvinQA23 [source=AWRI]  Length: 314  Sat Sep 23 00:44:55 2017  Type: P  Check: 8780  ..

       1  MDDAKVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VKSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKARVDQLNL NLTDDQIKEV TAKIKKLGDV RSLNIDDVDS IIKNFHAEVS

     301  TPQVLSAKKE QEE*

Protein Sequence for YDL182W_RM11-1a from Stanford:

YDL182W_RM11-1a [source=Stanford]  Length: 334  Sat Sep 23 00:44:55 2017  Type: P  Check: 8576  ..

       1  MDDAKVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VKSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKSRVDQLNL NLTDDQIKEV TAKIKKLGDV RSLNIDDVDS IIKNFHAEVS

     301  TPQVLSAKKN KKNDSDVPEL ATIPAAKRTK PSA*

Protein Sequence for YDL182W_SEY6210 from Stanford:

YDL182W_SEY6210 [source=Stanford]  Length: 334  Sat Sep 23 00:44:55 2017  Type: P  Check: 8583  ..

       1  MDDAKVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VRSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKSRVDQLNL NLTDDQIKEV TAKIKKLGDV RSLNIDDVDS IIKNFHAEVS

     301  TPQVLSAKKN KKNDSDVPEL ATIPAAKRTK PSA*

Protein Sequence for YDL182W_SK1 from Stanford:

YDL182W_SK1 [source=Stanford]  Length: 334  Sat Sep 23 00:44:55 2017  Type: P  Check: 8168  ..

       1  MDDARVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VRSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKARVDQLNL NLTDDQIKEV TAKIKKLGDV RSLNIDDVDS IIKNFHAEVS

     301  TPQVLSAKKN KKNDSDVPEL ATIPAAKRTK PSA*

Protein Sequence for YDL182W_UWOPS05_217_3 from Stanford:

YDL182W_UWOPS05_217_3 [source=Stanford]  Length: 334  Sat Sep 23 00:44:55 2017  Type: P  Check: 8133  ..

       1  MDDAKVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VRSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKARVDQLNL NLTDDQIKEV TAKIKKLGDV RSLNIDDVDS IIKNFHAEVS

     301  TPQVLSAKKN KKNDSDVPEL ATIPAAKRTK PSA*

Protein Sequence for YDL182W_VL3 from AWRI:

YDL182W_VL3 [source=AWRI]  Length: 429  Sat Sep 23 00:44:55 2017  Type: P  Check: 3842  ..

       1  MTAAKPNPYA AKPGDYLSNV NNFQLIDSTL REGEQFANAF FDTEKKIEIA

      51  RALDDFGVDY IELTSPVASE QSRKDCEAIC KLGLKAKILT HIRCHMDDAK

     101  VAVETGVDGV DVVIGTSKFL RQYSHGKDMN YIAKSAVEVI EFVKSKGIEI

     151  RFSSEDSFRS DLVDLLNIYK TVDKIGVNRV GIADTVGCAN PRQVYELIRT

     201  LKSVVSCDIE CHFHNDTGCA IANAYTALEG GARLIDVSVL GIGERNGITP

     251  LGGLMARMIV AAPDYVKSKY KLHKIRDIEN LVADAVEVNI PFNNPITGFC

     301  AFTHKAGIHA KAILANPSTY EILDPHDFGM KRYIHFANRL TGWNAIKARV

     351  DQLNLNLTDD QIKEVTAKIK KLGDVRSLNI DDVDSIIKNF HAEVSTPQVL

     401  SXKKNKKNDS DVPELATIPA AKRTKPSA*

Protein Sequence for YDL182W_Vin13 from AWRI:

YDL182W_Vin13 [source=AWRI]  Length: 429  Sat Sep 23 00:44:55 2017  Type: P  Check: 3773  ..

       1  MTAAKPNPYA AKPGDYLSNV NNFQLIDSTL REGEQFANAF FDTEKKIEIA

      51  RALDDFGVDY IELTSPVASE QSRKDCEAIC KLGLKAKILT HIRCHMDDAK

     101  VAVETGVDGV DVVIGTSKFL RQYSHGKDMN YIAKSAVEVI EFVKSKGIEI

     151  RFSSEDSFRS DLVDLLNIYK TVDKIGVNRV GIADTVGCAN PRQVYELIRT

     201  LKSVVSCDIE CHFHNDTGCA IANAYTALEG GARLIDVSVL GIGERNGITP

     251  LGGLMARMIV AAPDYVKSKY KLHKIRDIEN LVADAVEVNI PFNNPITGFC

     301  AFTHKAGIHA KAILANPSTY EILDPHDFGM KRYIHFANRL TGWNAIKARV

     351  DQLNLNLTDD QIKEVTAKIK KLGDVRSLNI DDVDSIIKNF HAEVSTPQVL

     401  SAKKNKKNDS DVPELATIPA AKRTKPSA*

Protein Sequence for YDL182W_W303 from Stanford:

YDL182W_W303 [source=Stanford]  Length: 334  Sat Sep 23 00:44:55 2017  Type: P  Check: 8583  ..

       1  MDDAKVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VRSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKSRVDQLNL NLTDDQIKEV TAKIKKLGDV RSLNIDDVDS IIKNFHAEVS

     301  TPQVLSAKKN KKNDSDVPEL ATIPAAKRTK PSA*

Protein Sequence for YDL182W_X2180-1A from Stanford:

YDL182W_X2180-1A [source=Stanford]  Length: 334  Sat Sep 23 00:44:55 2017  Type: P  Check: 8126  ..

       1  MDDAKVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VKSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKARVDQLNL NLTDDQIKEV TAKIKKLGDV RSLNIDDVDS IIKNFHAEVS

     301  TPQVLSAKKN KKNDSDVPEL ATIPAAKRTK PSA*

Protein Sequence for YDL182W_Y55 from Stanford:

YDL182W_Y55 [source=Stanford]  Length: 334  Sat Sep 23 00:44:55 2017  Type: P  Check: 8161  ..

       1  MDDARVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VKSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKARVDQLNL NLTDDQIKEV TAKIKKLGDV RSLNIDDVDS IIKNFHAEVS

     301  TPQVLSAKKN KKNDSDVPEL ATIPAAKRTK PSA*

Protein Sequence for YDL182W_YJM269 from WashU:

YDL182W_YJM269 [source=WashU]  Length: 355  Sat Sep 23 00:44:55 2017  Type: P  Check: 9190  ..

       1  MTAAKPNPYA AKPGDYLSNV NNFQLIDSTL REGEQFANAF FDTEKKIEIA

      51  RALDDFGVDY IELTSPVASE QSRKDCEAIC KLGLKAKILT HIRCHMDDAK

     101  VAVETGVDGV DVVIGTSKFL RQYSHGKDMN YIAKSAVEVI EFVKSKGIEI

     151  RFSSEDSFRS DLVDLLNIYK TVDKIGVNRV GIADTVGCAN PRQVYELIRT

     201  LKSVVSCDIE CHFHNDTGCA IANAYTALEG GARLIDVSVL GIGERNGITP

     251  LGGLMARMIV AAPDYVKSKY KLHKIRDIEN LVADAVEVNI PFNNPITGFC

     301  AFTHKAGIHA KAILANPSTY EILDPHDFGM KRYIHFANRL LEPSKPECSE

     351  LELG*

Protein Sequence for YDL182W_YJM339 from Stanford:

YDL182W_YJM339 [source=Stanford]  Length: 334  Sat Sep 23 00:44:55 2017  Type: P  Check: 8126  ..

       1  MDDAKVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VKSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKARVDQLNL NLTDDQIKEV TAKIKKLGDV RSLNIDDVDS IIKNFHAEVS

     301  TPQVLSAKKN KKNDSDVPEL ATIPAAKRTK PSA*

Protein Sequence for YDL182W_YJM789 from Stanford:

YDL182W_YJM789 [source=Stanford]  Length: 429  Sat Sep 23 00:44:55 2017  Type: P  Check: 3773  ..

       1  MTAAKPNPYA AKPGDYLSNV NNFQLIDSTL REGEQFANAF FDTEKKIEIA

      51  RALDDFGVDY IELTSPVASE QSRKDCEAIC KLGLKAKILT HIRCHMDDAK

     101  VAVETGVDGV DVVIGTSKFL RQYSHGKDMN YIAKSAVEVI EFVKSKGIEI

     151  RFSSEDSFRS DLVDLLNIYK TVDKIGVNRV GIADTVGCAN PRQVYELIRT

     201  LKSVVSCDIE CHFHNDTGCA IANAYTALEG GARLIDVSVL GIGERNGITP

     251  LGGLMARMIV AAPDYVKSKY KLHKIRDIEN LVADAVEVNI PFNNPITGFC

     301  AFTHKAGIHA KAILANPSTY EILDPHDFGM KRYIHFANRL TGWNAIKARV

     351  DQLNLNLTDD QIKEVTAKIK KLGDVRSLNI DDVDSIIKNF HAEVSTPQVL

     401  SAKKNKKNDS DVPELATIPA AKRTKPSA*

Protein Sequence for YDL182W_YPH499 from Stanford:

YDL182W_YPH499 [source=Stanford]  Length: 334  Sat Sep 23 00:44:55 2017  Type: P  Check: 8618  ..

       1  MDDARVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VRSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKSRVDQLNL NLTDDQIKEV TAKIKKLGDV RSLNIDDVDS IIKNFHAEVS

     301  TPQVLSAKKN KKNDSDVPEL ATIPAAKRTK PSA*

Protein Sequence for YDL182W_YPS128 from Stanford:

YDL182W_YPS128 [source=Stanford]  Length: 334  Sat Sep 23 00:44:55 2017  Type: P  Check: 8126  ..

       1  MDDAKVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VKSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKARVDQLNL NLTDDQIKEV TAKIKKLGDV RSLNIDDVDS IIKNFHAEVS

     301  TPQVLSAKKN KKNDSDVPEL ATIPAAKRTK PSA*

Protein Sequence for YDL182W_YPS163 from Stanford:

YDL182W_YPS163 [source=Stanford]  Length: 334  Sat Sep 23 00:44:55 2017  Type: P  Check: 8126  ..

       1  MDDAKVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VKSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKARVDQLNL NLTDDQIKEV TAKIKKLGDV RSLNIDDVDS IIKNFHAEVS

     301  TPQVLSAKKN KKNDSDVPEL ATIPAAKRTK PSA*

Protein Sequence for YDL182W_YS9 from Stanford:

YDL182W_YS9 [source=Stanford]  Length: 334  Sat Sep 23 00:44:55 2017  Type: P  Check: 8168  ..

       1  MDDARVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VRSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKARVDQLNL NLTDDQIKEV TAKIKKLGDV RSLNIDDVDS IIKNFHAEVS

     301  TPQVLSAKKN KKNDSDVPEL ATIPAAKRTK PSA*

Protein Sequence for YDL182W_ZTW1 from Zhejiang:

YDL182W_ZTW1 [source=Zhejiang]  Length: 236  Sat Sep 23 00:44:55 2017  Type: P  Check: 7683  ..

       1  MTAAKPNPYA AKPGDYLSNV NNFQLIDSTL REGEQFANAF FDTEKKIEIA

      51  RALDDFGVDY IELTSPVASE QSRKDCEAIC KLGLKAKILT HIRCHMDDAK

     101  VAVETGVDGV DVVIGTSKFL RQYSHGKDMN YIAKSAVEVI EFVKSKGIEI

     151  RFSSEDSFRS DLVDLLNIYK TVDKIGVNRV GIADTVGCAN PRQVYELIRT

     201  LKSVVSCDIE CHFHNDTGLC HCKRLHCFGR WCQID*