LYS21/YDL131W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YDL131W_S288C   1   MSENNEFQSVTESTTAPTTSNPYGPNPADYLSNVKNFQLIDSTLREGEQF   50
YDL131W_AWRI796   1   MSENNEFQSVTESTTAPTTSNPYGPNPADYLSNVKNFQLIDSTLREGEQF   50
YDL131W_BC187   
   --------------------------------------------------   
YDL131W_BY4741   
   --------------------------------------------------   
YDL131W_BY4742   
   --------------------------------------------------   
YDL131W_CBS7960   1   MSENNEFQSVTESTTAPTTNNPYGPNPADYLSNVKNFQLIDSTLREGEQF   50
YDL131W_CEN.PK   
   --------------------------------------------------   
YDL131W_CLIB324   1   MSENNEFQSVTESTTAPTTSNPYGPNPADYLSNVKNFQLIDSTLREGEQF   50
YDL131W_D273-10B   
   --------------------------------------------------   
YDL131W_DBVPG6044   
   --------------------------------------------------   
YDL131W_EC1118   1   MSENNEFQSVTESTTAPTTSNPYGPNPADYLSNVKNFQLIDSTLREGEQF   50
YDL131W_FL100   
   --------------------------------------------------   
YDL131W_FY1679   
   --------------------------------------------------   
YDL131W_FostersB   
   --------------------------------------------------   
YDL131W_FostersO   
   --------------------------------------------------   
YDL131W_JK9-3d   
   --------------------------------------------------   
YDL131W_K11   
   --------------------------------------------------   
YDL131W_Kyokai7   1   MSENNEFQSVTESTTAPTTSNPYGPNPADYLSNVKNFQLIDSTLREGEQF   50
YDL131W_L1528   
   --------------------------------------------------   
YDL131W_LalvinQA23   1   MSENNEFQSVTESTTAPTTSNPYGPNPADYLSNVKNFQLIDSTLREGEQF   50
YDL131W_RM11-1a   
   --------------------------------------------------   
YDL131W_RedStar   
   --------------------------------------------------   
YDL131W_SEY6210   
   --------------------------------------------------   
YDL131W_SK1   
   --------------------------------------------------   
YDL131W_VL3   1   MSENNEFQSVTESTTAPTTSNPYGPNPADYLSNVKNFQLIDSTLREGEQF   50
YDL131W_Vin13   1   MSENNEFQSVTESTTAPTTSNPYGPNPADYLSNVKNFQLIDSTLREGEQF   50
YDL131W_W303   
   --------------------------------------------------   
YDL131W_X2180-1A   
   --------------------------------------------------   
YDL131W_Y55   
   --------------------------------------------------   
YDL131W_YJM269   1   MSENNEFQSVTESTTAPTTSNPYGPNPADYLSNVKNFQLIDSTLREGEQF   50
YDL131W_YJM339   
   --------------------------------------------------   
YDL131W_YJM789   1   MSENNEFQSVTESTTAPTTSNPYGPNPADYLSNVKNFQLIDSTLREGEQF   50
YDL131W_YPH499   
   --------------------------------------------------   
YDL131W_YPS128   
   --------------------------------------------------   
YDL131W_YPS163   
   --------------------------------------------------   
YDL131W_YS9   
   --------------------------------------------------   
YDL131W_ZTW1   1   MSENNEFQSVTESTTAPTTSNPYGPNPADYLSNVKNFQLIDSTLREGEQF   50
         

YDL131W_S288C   51   ANAFFDTEKKIEIARALDDFGVDYIELTSPVASEQSRKDCEAICKLGLKA   100
YDL131W_AWRI796   51   ANAFFDTEKKIEIARALDDFGVDYIELTSPVASEQSRKDCEAICKLGLKA   100
YDL131W_BC187   
   --------------------------------------------------   
YDL131W_BY4741   
   --------------------------------------------------   
YDL131W_BY4742   
   --------------------------------------------------   
YDL131W_CBS7960   51   ANAFFDTEKKIEIARALDDFGVDYIELTSPVASEQSRKDCEAICKLGLKA   100
YDL131W_CEN.PK   
   --------------------------------------------------   
YDL131W_CLIB324   51   ANAFFDTEKKIEIARALDDFGVDYIELTSPVASEQSRKDCEAICKLGLKA   100
YDL131W_D273-10B   
   --------------------------------------------------   
YDL131W_DBVPG6044   
   --------------------------------------------------   
YDL131W_EC1118   51   ANAFFDTEKKIEIARALDDFGVDYIELTSPVASEQSRKDCEAICKLGLKA   100
YDL131W_FL100   
   --------------------------------------------------   
YDL131W_FY1679   
   --------------------------------------------------   
YDL131W_FostersB   
   --------------------------------------------------   
YDL131W_FostersO   
   --------------------------------------------------   
YDL131W_JK9-3d   
   --------------------------------------------------   
YDL131W_K11   
   --------------------------------------------------   
YDL131W_Kyokai7   51   ANAFFDTEKKIEIARALDDFGVDYIELTSPVASEQSRKDCEAICKLGLKA   100
YDL131W_L1528   
   --------------------------------------------------   
YDL131W_LalvinQA23   51   ANAFFDTEKKIEIARALDDFGVDYIELTSPVASEQSRKDCEAICKLGLKA   100
YDL131W_RM11-1a   
   --------------------------------------------------   
YDL131W_RedStar   
   --------------------------------------------------   
YDL131W_SEY6210   
   --------------------------------------------------   
YDL131W_SK1   
   --------------------------------------------------   
YDL131W_VL3   51   ANAFFDTEKKIEIARALDDFGVDYIELTSPVASEQSRKDCEAICKLGLKA   100
YDL131W_Vin13   51   ANAFFDTEKKIEIARALDDFGVDYIELTSPVASEQSRKDCEAICKLGLKA   100
YDL131W_W303   
   --------------------------------------------------   
YDL131W_X2180-1A   
   --------------------------------------------------   
YDL131W_Y55   
   --------------------------------------------------   
YDL131W_YJM269   51   ANAFFDTEKKIEIARALDDFGVDYIELTSPVASEQSRKDCEAICKLGLKA   100
YDL131W_YJM339   
   --------------------------------------------------   
YDL131W_YJM789   51   ANAFFDTEKKIEIARALDDFGVDYIELTSPVASEQSRKDCEAICKLGLKA   100
YDL131W_YPH499   
   --------------------------------------------------   
YDL131W_YPS128   
   --------------------------------------------------   
YDL131W_YPS163   
   --------------------------------------------------   
YDL131W_YS9   
   --------------------------------------------------   
YDL131W_ZTW1   51   ANAFFDTEKKIEIARALDDFGVDYIELTSPVASEQSRKDCEAICKLGLKA   100
         

YDL131W_S288C   101   KILTHIRCHMDDARVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSA   150
YDL131W_AWRI796   101   KILTHIRCHMDDARVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSA   150
YDL131W_BC187   1   ---------MDDAKVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSA   41
YDL131W_BY4741   1   ---------MDDAKVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSA   41
YDL131W_BY4742   1   ---------MDDARVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSA   41
YDL131W_CBS7960   101   KILTHIRCHMDDARVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSA   150
YDL131W_CEN.PK   1   ---------MDDAKVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSA   41
YDL131W_CLIB324   101   KILTHIRCHMDDARVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSA   150
YDL131W_D273-10B   1   ---------MDDAKVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSA   41
YDL131W_DBVPG6044   1   ---------MDDARVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSA   41
YDL131W_EC1118   101   KILTHIRCHMDDARVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSA   150
YDL131W_FL100   1   ---------MDDARVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSA   41
YDL131W_FY1679   1   ---------MDDARVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSA   41
YDL131W_FostersB   1   ------------------------MLLSAPPNFLRQYSHGKDMNYIAKSA   26
YDL131W_FostersO   1   ------------------------------------------MNYIAKSA   8
YDL131W_JK9-3d   1   ---------MDDAKVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSA   41
YDL131W_K11   1   ---------MDDAKVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSA   41
YDL131W_Kyokai7   101   KILTHIRCHMDDARVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSA   150
YDL131W_L1528   1   ---------MDDAKVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSA   41
YDL131W_LalvinQA23   101   KILTHIRCHMDDARVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSA   150
YDL131W_RM11-1a   1   ---------MDDAKVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSA   41
YDL131W_RedStar   1   ---------MDDAKVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSA   41
YDL131W_SEY6210   1   ---------MDDAKVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSA   41
YDL131W_SK1   1   ---------MDDARVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSA   41
YDL131W_VL3   101   KILTHIRCHMDDARVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSA   150
YDL131W_Vin13   101   KILTHIRCHMDDARVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSA   150
YDL131W_W303   1   ---------MDDAKVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSA   41
YDL131W_X2180-1A   1   ---------MDDAKVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSA   41
YDL131W_Y55   1   ---------MDDARVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSA   41
YDL131W_YJM269   101   KILTHIRCHMDDARVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSA   150
YDL131W_YJM339   1   ---------MDDAKVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSA   41
YDL131W_YJM789   101   KILTHIRCHMDDARVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSA   150
YDL131W_YPH499   1   ---------MDDARVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSA   41
YDL131W_YPS128   1   ---------MDDAKVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSA   41
YDL131W_YPS163   1   ---------MDDAKVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSA   41
YDL131W_YS9   1   ---------MDDARVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSA   41
YDL131W_ZTW1   101   KILTHIRCHMDDARVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSA   150
         

YDL131W_S288C   151   VEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTV   200
YDL131W_AWRI796   151   VEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTV   200
YDL131W_BC187   42   VEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTV   91
YDL131W_BY4741   42   VEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTV   91
YDL131W_BY4742   42   VEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTV   91
YDL131W_CBS7960   151   VEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTV   200
YDL131W_CEN.PK   42   VEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTV   91
YDL131W_CLIB324   151   VEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTV   200
YDL131W_D273-10B   42   VEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTV   91
YDL131W_DBVPG6044   42   VEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTV   91
YDL131W_EC1118   151   VEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTV   200
YDL131W_FL100   42   VEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTV   91
YDL131W_FY1679   42   VEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTV   91
YDL131W_FostersB   27   VEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTV   76
YDL131W_FostersO   9   VEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTV   58
YDL131W_JK9-3d   42   VEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTV   91
YDL131W_K11   42   VEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTV   91
YDL131W_Kyokai7   151   VEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTV   200
YDL131W_L1528   42   VEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTV   91
YDL131W_LalvinQA23   151   VEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTV   200
YDL131W_RM11-1a   42   VEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTV   91
YDL131W_RedStar   42   VEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTV   91
YDL131W_SEY6210   42   VEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTV   91
YDL131W_SK1   42   VEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTV   91
YDL131W_VL3   151   VEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTV   200
YDL131W_Vin13   151   VEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTV   200
YDL131W_W303   42   VEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTV   91
YDL131W_X2180-1A   42   VEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTV   91
YDL131W_Y55   42   VEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTV   91
YDL131W_YJM269   151   VEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTV   200
YDL131W_YJM339   42   VEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTV   91
YDL131W_YJM789   151   VEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTV   200
YDL131W_YPH499   42   VEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTV   91
YDL131W_YPS128   42   VEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTV   91
YDL131W_YPS163   42   VEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTV   91
YDL131W_YS9   42   VEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTV   91
YDL131W_ZTW1   151   VEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTV   200
         

YDL131W_S288C   201   GCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYTALEGGARLID   250
YDL131W_AWRI796   201   GCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYTALEGGARLID   250
YDL131W_BC187   92   GCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYTALEGGARLID   141
YDL131W_BY4741   92   GCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYTALEGGARLID   141
YDL131W_BY4742   92   GCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYTALEGGARLID   141
YDL131W_CBS7960   201   GCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYTALEGGARLID   250
YDL131W_CEN.PK   92   GCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYTALEGGARLID   141
YDL131W_CLIB324   201   GCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYTALKVVPD---   247
YDL131W_D273-10B   92   GCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYTALEGGARLID   141
YDL131W_DBVPG6044   92   GCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYTALEGGARLID   141
YDL131W_EC1118   201   GCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYTALEGGARLID   250
YDL131W_FL100   92   GCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYTALEGGARLID   141
YDL131W_FY1679   92   GCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYTALEGGARLID   141
YDL131W_FostersB   77   GCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYTALEGGARLID   126
YDL131W_FostersO   59   GCANPRQVYELIRTLKSVXSCDIECHFHNDXGCAIANAYTALEGGARLID   108
YDL131W_JK9-3d   92   GCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYTALEGGARLID   141
YDL131W_K11   92   GCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYTALEGGARLID   141
YDL131W_Kyokai7   201   GCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYTALEGGARLID   250
YDL131W_L1528   92   GCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYTALEGGARLID   141
YDL131W_LalvinQA23   201   GCANPRQVYELIRTLKSVXSCDIECHFHNDXGCAIANAYXALEGGARLID   250
YDL131W_RM11-1a   92   GCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYTALEGGARLID   141
YDL131W_RedStar   92   GCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYTALEGGARLID   141
YDL131W_SEY6210   92   GCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYTALEGGARLID   141
YDL131W_SK1   92   GCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYTALEGGARLID   141
YDL131W_VL3   201   GCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYTALEGGARLID   250
YDL131W_Vin13   201   GCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYTALEGGARLID   250
YDL131W_W303   92   GCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYTALEGGARLID   141
YDL131W_X2180-1A   92   GCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYTALEGGARLID   141
YDL131W_Y55   92   GCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYTALEGGARLID   141
YDL131W_YJM269   201   GCANPKTSI-----------------------------------------   209
YDL131W_YJM339   92   GCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYTALEGGARLID   141
YDL131W_YJM789   201   GCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYTALEGGARLID   250
YDL131W_YPH499   92   GCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYTALEGGARLID   141
YDL131W_YPS128   92   GCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYTALEGGARLID   141
YDL131W_YPS163   92   GCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYTALEGGARLID   141
YDL131W_YS9   92   GCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYTALEGGARLID   141
YDL131W_ZTW1   201   GCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYTALEGGARLID   250
         

YDL131W_S288C   251   VSVLGIGERNGITPLGGLMARMIVAAPDYVRSKYKLHKIRDIENLVADAV   300
YDL131W_AWRI796   251   VSVLGIGERNGITPLGGLMARMIVAAPDYVRSKYKLHKIRDIENLVADAV   300
YDL131W_BC187   142   VSVLGIGERNGITPLGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAV   191
YDL131W_BY4741   142   VSVLGIGERNGITPLGGLMARMIVAAPDYVRSKYKLHKIRDIENLVADAV   191
YDL131W_BY4742   142   VSVLGIGERNGITPLGGLMARMIVAAPDYVRSKYKLHKIRDIENLVADAV   191
YDL131W_CBS7960   251   VSVLGIGERNGITPLGGLMARMIVAAPDYVRSKYKLHKIRDIENLVADAV   300
YDL131W_CEN.PK   142   VSVLGIGERNGITPLGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAV   191
YDL131W_CLIB324   
   --------------------------------------------------   
YDL131W_D273-10B   142   VSVLGIGERNGITPLGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAV   191
YDL131W_DBVPG6044   142   VSVLGIGERNGITPLGGLMARMIVAAPEYVKSKYKLHKIRDIENLVADAV   191
YDL131W_EC1118   251   VSVLGIGERNGITPLGGLMARMIVAAPDYVRSKYKLHKIRDIENLVADAV   300
YDL131W_FL100   142   VSVLGIGERNGITPLGGLMARMIVAAPDYVRSKYKLHKIRDIENLVADAV   191
YDL131W_FY1679   142   VSVLGIGERNGITPLGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAV   191
YDL131W_FostersB   127   VSVLGIGERNGITPLGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAV   176
YDL131W_FostersO   109   VSVLXIGERNGITPLGGLMARMXVAAPDYVXXKYKXHKIRDXENLVADAV   158
YDL131W_JK9-3d   142   VSVLGIGERNGITPLGGLMARMIVAAPDYVRSKYKLHKIRDIENLVADAV   191
YDL131W_K11   142   VSVLGIGERNGITPLGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAV   191
YDL131W_Kyokai7   251   VSVLGIGERNGITPLGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAV   300
YDL131W_L1528   142   VSVLGIGERNGITPLGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAV   191
YDL131W_LalvinQA23   251   VSVLGIGERNGITPLGGLMARMIVAAPDYVXXKYKXHKIRDXENLVADAV   300
YDL131W_RM11-1a   142   VSVLGIGERNGITPLGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAV   191
YDL131W_RedStar   142   VSVLGIGERNGITPLGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAV   191
YDL131W_SEY6210   142   VSVLGIGERNGITPLGGLMARMIVAAPDYVRSKYKLHKIRDIENLVADAV   191
YDL131W_SK1   142   VSVLGIGERNGITPLGGLMARMIVAAPDYVRSKYKLHKIRDIENLVADAV   191
YDL131W_VL3   251   VSVLGIGERNGITPLGGLMARMIVAAPDYVRSKYKLHKIRDIENLVADAV   300
YDL131W_Vin13   251   VSVLGIGERNGITPLGGLMARMIVAAPDYVRSKYKLHKIRDIENLVADAV   300
YDL131W_W303   142   VSVLGIGERNGITPLGGLMARMIVAAPDYVRSKYKLHKIRDIENLVADAV   191
YDL131W_X2180-1A   142   VSVLGIGERNGITPLGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAV   191
YDL131W_Y55   142   VSVLGIGERNGITPLGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAV   191
YDL131W_YJM269   
   --------------------------------------------------   
YDL131W_YJM339   142   VSVLGIGERNGITPLGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAV   191
YDL131W_YJM789   251   VSVLGIGERNGITPLGGLMARMIVAAPDYVRSKYKLHKIRDIENLVADAV   300
YDL131W_YPH499   142   VSVLGIGERNGITPLGGLMARMIVAAPDYVRSKYKLHKIRDIENLVADAV   191
YDL131W_YPS128   142   VSVLGIGERNGITPLGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAV   191
YDL131W_YPS163   142   VSVLGIGERNGITPLGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAV   191
YDL131W_YS9   142   VSVLGIGERNGITPLGGLMARMIVAAPDYVRSKYKLHKIRDIENLVADAV   191
YDL131W_ZTW1   251   VSVLGIGERNGITPLGGLMARMIVAAPDYVRSKYKLHKIRDIENLVADAV   300
         

YDL131W_S288C   301   EVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHF   350
YDL131W_AWRI796   301   EVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHF   350
YDL131W_BC187   192   EVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHF   241
YDL131W_BY4741   192   EVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHF   241
YDL131W_BY4742   192   EVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHF   241
YDL131W_CBS7960   301   EVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHF   350
YDL131W_CEN.PK   192   EVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHF   241
YDL131W_CLIB324   
   --------------------------------------------------   
YDL131W_D273-10B   192   EVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHF   241
YDL131W_DBVPG6044   192   EVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHF   241
YDL131W_EC1118   301   EVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHF   350
YDL131W_FL100   192   EVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHF   241
YDL131W_FY1679   192   EVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHF   241
YDL131W_FostersB   177   EVNIPFNNPIXGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHF   226
YDL131W_FostersO   159   EVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYXHF   208
YDL131W_JK9-3d   192   EVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHF   241
YDL131W_K11   192   EVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHF   241
YDL131W_Kyokai7   301   EVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHF   350
YDL131W_L1528   192   EVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHF   241
YDL131W_LalvinQA23   301   EVNIPFNNPIXGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHF   350
YDL131W_RM11-1a   192   EVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHF   241
YDL131W_RedStar   192   EVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHF   241
YDL131W_SEY6210   192   EVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHF   241
YDL131W_SK1   192   EVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHF   241
YDL131W_VL3   301   EVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHF   350
YDL131W_Vin13   301   EVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHF   350
YDL131W_W303   192   EVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHF   241
YDL131W_X2180-1A   192   EVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHF   241
YDL131W_Y55   192   EVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHF   241
YDL131W_YJM269   
   --------------------------------------------------   
YDL131W_YJM339   192   EVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHF   241
YDL131W_YJM789   301   EVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHF   350
YDL131W_YPH499   192   EVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHF   241
YDL131W_YPS128   192   EVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHF   241
YDL131W_YPS163   192   EVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHF   241
YDL131W_YS9   192   EVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYXHF   241
YDL131W_ZTW1   301   EVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHF   350
         

YDL131W_S288C   351   ANRLTGWNAIKSRVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSI   400
YDL131W_AWRI796   351   ANRLTGWNAIKSRVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSI   400
YDL131W_BC187   242   ANRLTGWNAIKARVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSI   291
YDL131W_BY4741   242   ANRLTGWNAIKSRVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSI   291
YDL131W_BY4742   242   ANRLTGWNAIKSRVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSI   291
YDL131W_CBS7960   351   ANRLTGWNAIKSRVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSI   400
YDL131W_CEN.PK   242   ANRLTGWNAIKARVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSI   291
YDL131W_CLIB324   
   --------------------------------------------------   
YDL131W_D273-10B   242   ANRLTGWNAIKSRVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSI   291
YDL131W_DBVPG6044   242   ANRLTGWNAIKSRVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSI   291
YDL131W_EC1118   351   ANRLTGWNAIKSRVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSI   400
YDL131W_FL100   242   ANRLTGWNAIKSRVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSI   291
YDL131W_FY1679   242   ANRLTGWNAIKSRVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSI   291
YDL131W_FostersB   227   ANRLTGWNAIKSRVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSI   276
YDL131W_FostersO   209   ANRLTGWNAIKSRVDQLNLNLXDDQIKEVTAKIKKLGDVRPLNIDDVDSI   258
YDL131W_JK9-3d   242   ANRLTGWNAIKARVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSI   291
YDL131W_K11   242   ANRLTGWNAIKARVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSI   291
YDL131W_Kyokai7   351   ANRLTGWNAIKSRVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSI   400
YDL131W_L1528   242   ANRLTGWNAIKARVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSI   291
YDL131W_LalvinQA23   351   ANRLTGWNAIKSRVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSI   400
YDL131W_RM11-1a   242   ANRLTGWNAIKSRVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSI   291
YDL131W_RedStar   242   ANRLTGWNAIKSRVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSI   291
YDL131W_SEY6210   242   ANRLTGWNAIKSRVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSI   291
YDL131W_SK1   242   ANRLTGWNAIKSRVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSI   291
YDL131W_VL3   351   ANRLTGWNAIKSRVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSI   400
YDL131W_Vin13   351   ANRLTGWNAIKSRVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSI   400
YDL131W_W303   242   ANRLTGWNAIKSRVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSI   291
YDL131W_X2180-1A   242   ANRLTGWNAIKARVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSI   291
YDL131W_Y55   242   ANRLTGWNAIKARVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSI   291
YDL131W_YJM269   
   --------------------------------------------------   
YDL131W_YJM339   242   ANRLTGWNAIKARVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSI   291
YDL131W_YJM789   351   ANRLTGWNAIKSRVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSI   400
YDL131W_YPH499   242   ANRLTGWNAIKSRVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSI   291
YDL131W_YPS128   242   ANRLTGWNAIKARVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSI   291
YDL131W_YPS163   242   ANRLTGWNAIKARVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSI   291
YDL131W_YS9   242   ANRLTGWNAIKSRVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSI   291
YDL131W_ZTW1   351   ANRLTGWNAIKSRVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSI   400
         

YDL131W_S288C   401   IKDFHAELSTPLLKPVNKGTDDDNIDISNGHVSKKAKVTK   440
YDL131W_AWRI796   401   IKDFHAELSTPLLKPVNKGTDDDNIDISNGHVSKKAKVTK   440
YDL131W_BC187   292   IKDFHAELSTPLLKPVNKGTDDDNIDISNGHVSKKAKVTK   331
YDL131W_BY4741   292   IKDFHAELSTPLLKPVNKGTDDDNIDISNGHVSKKAKVTK   331
YDL131W_BY4742   292   IKDFHAELSTPLLKPVNKGTDDDNIDISNGHVSKKAKVTK   331
YDL131W_CBS7960   401   IKDFHAELSTPLLKPVNKGTDDDNIDISNGHVSKKAKVTK   440
YDL131W_CEN.PK   292   IKDFHAELSTPLLKPVNKGTDDDNIDISNGHVSKKAKVTK   331
YDL131W_CLIB324   
   ----------------------------------------   
YDL131W_D273-10B   292   IKDFHAELSTPLLKPVNKGTDDDNIDISNGHVSKKAKVTK   331
YDL131W_DBVPG6044   292   IKDFHAELSTPLLKPVNKGTDDDNIDISNGHVSKKAKVTK   331
YDL131W_EC1118   401   IKDFHAELSTPLLKPVNKGTDDDNIDISNGHVSKKAKVTK   440
YDL131W_FL100   292   IKDFHAELSTPLLKPVNKGTDDDNIDISNGHVSKKAKVTK   331
YDL131W_FY1679   292   IKDFHAELSTPLLKPVNKGTDDDNIDISNGHVSKKAKVTK   331
YDL131W_FostersB   277   IKDFHAELSTPLLKPVNKGTDDDNIDISNGHVSKKAKVTK   316
YDL131W_FostersO   259   IKDFHAELSTPFLKPVNKGTDDDNIDISNGHVSKKAKVTK   298
YDL131W_JK9-3d   292   IKDFHAELSTPLLKPVNKGTDDDNIDISNGHVSKKAKVTK   331
YDL131W_K11   292   IKDFHAELSTPLLKPVNKGTDDDNIDISNGHVSKKAKVTK   331
YDL131W_Kyokai7   401   IKDFHAELSTPLLKPVNKGTDDDNIDISNGHVSKKAKVTK   440
YDL131W_L1528   292   IKDFHAELSTPLLKPVNKGTDDDNIDISNGHVSKKAKVTK   331
YDL131W_LalvinQA23   401   IKDFHAELSTPLLKPVNKGTDDDNIDISNGHVSKKAKVTK   440
YDL131W_RM11-1a   292   IKDFHAELSTPLLKPVNKGTDDDNIDISNGHVSKKAKVTK   331
YDL131W_RedStar   292   IKDFHAELSTPFLKPVNKGTDDDNIDISNGHVSKKAKVTK   331
YDL131W_SEY6210   292   IKDFHAELSTPLLKPVNKGTDDDNIDISNGHVSKKAKVTK   331
YDL131W_SK1   292   IKDFHAELSTPLLKPVNKGTDDDNIDISNGHVSKKAKVTK   331
YDL131W_VL3   401   IKDFHAELSTPLLKPVNKGTDDDNIDISNGHVSKKAKVTK   440
YDL131W_Vin13   401   IKDFHAELSTPLLKPVNKGTDDDNIDISNGHVSKKAKVTK   440
YDL131W_W303   292   IKDFHAELSTPLLKPVNKGTDDDNIDISNGHVSKKAKVTK   331
YDL131W_X2180-1A   292   IKDFHAELSTPLLKPVNKGTDDDNIDISNGHVSKKAKVTK   331
YDL131W_Y55   292   IKDFHAELSTPLLKPVNKGTDDDNIDISNGHVSKKAKVTK   331
YDL131W_YJM269   
   ----------------------------------------   
YDL131W_YJM339   292   IKDFHAELSTPLLKPVNKGTDDDNIDISNGHVSKKAKVTK   331
YDL131W_YJM789   401   IKDFHAELSTPLLKPVNKGTDDDNIDISNGHVSKKAKVTK   440
YDL131W_YPH499   292   IKDFHAELSTPLLKPVNKGTDDDNIDISNGHVSKKAKVTK   331
YDL131W_YPS128   292   IKDFHAELSTPLLKPVNKGTDDDNIDISNGHVSKKAKVTK   331
YDL131W_YPS163   292   IKDFHAELSTPLLKPVNKGTDDDNIDISNGHVSKKAKVTK   331
YDL131W_YS9   292   IKDFHAELSTPFLKPVNKGTDDDNIDISNGHVSKKAKVTK   331
YDL131W_ZTW1   401   IKDFHAELSTPLLKPVNKGTDDDSIDISNGHVSKKAKVTK   440
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YDL131W_S288C from SGD:

YDL131W_S288C [source=SGD]  Length: 441  Tue Sep 19 05:27:42 2017  Type: P  Check: 601  ..

       1  MSENNEFQSV TESTTAPTTS NPYGPNPADY LSNVKNFQLI DSTLREGEQF

      51  ANAFFDTEKK IEIARALDDF GVDYIELTSP VASEQSRKDC EAICKLGLKA

     101  KILTHIRCHM DDARVAVETG VDGVDVVIGT SKFLRQYSHG KDMNYIAKSA

     151  VEVIEFVKSK GIEIRFSSED SFRSDLVDLL NIYKTVDKIG VNRVGIADTV

     201  GCANPRQVYE LIRTLKSVVS CDIECHFHND TGCAIANAYT ALEGGARLID

     251  VSVLGIGERN GITPLGGLMA RMIVAAPDYV RSKYKLHKIR DIENLVADAV

     301  EVNIPFNNPI TGFCAFTHKA GIHAKAILAN PSTYEILDPH DFGMKRYIHF

     351  ANRLTGWNAI KSRVDQLNLN LTDDQIKEVT AKIKKLGDVR PLNIDDVDSI

     401  IKDFHAELST PLLKPVNKGT DDDNIDISNG HVSKKAKVTK *


Protein Sequence for YDL131W_AWRI796 from AWRI:

YDL131W_AWRI796 [source=AWRI]  Length: 441  Tue Sep 19 05:27:42 2017  Type: P  Check: 601  ..

       1  MSENNEFQSV TESTTAPTTS NPYGPNPADY LSNVKNFQLI DSTLREGEQF

      51  ANAFFDTEKK IEIARALDDF GVDYIELTSP VASEQSRKDC EAICKLGLKA

     101  KILTHIRCHM DDARVAVETG VDGVDVVIGT SKFLRQYSHG KDMNYIAKSA

     151  VEVIEFVKSK GIEIRFSSED SFRSDLVDLL NIYKTVDKIG VNRVGIADTV

     201  GCANPRQVYE LIRTLKSVVS CDIECHFHND TGCAIANAYT ALEGGARLID

     251  VSVLGIGERN GITPLGGLMA RMIVAAPDYV RSKYKLHKIR DIENLVADAV

     301  EVNIPFNNPI TGFCAFTHKA GIHAKAILAN PSTYEILDPH DFGMKRYIHF

     351  ANRLTGWNAI KSRVDQLNLN LTDDQIKEVT AKIKKLGDVR PLNIDDVDSI

     401  IKDFHAELST PLLKPVNKGT DDDNIDISNG HVSKKAKVTK *


Protein Sequence for YDL131W_BC187 from Stanford:

YDL131W_BC187 [source=Stanford]  Length: 332  Tue Sep 19 05:27:42 2017  Type: P  Check: 866  ..

       1  MDDAKVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VKSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKARVDQLNL NLTDDQIKEV TAKIKKLGDV RPLNIDDVDS IIKDFHAELS

     301  TPLLKPVNKG TDDDNIDISN GHVSKKAKVT K*

Protein Sequence for YDL131W_BY4741 from Stanford:

YDL131W_BY4741 [source=Stanford]  Length: 332  Tue Sep 19 05:27:42 2017  Type: P  Check: 1323  ..

       1  MDDAKVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VRSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKSRVDQLNL NLTDDQIKEV TAKIKKLGDV RPLNIDDVDS IIKDFHAELS

     301  TPLLKPVNKG TDDDNIDISN GHVSKKAKVT K*

Protein Sequence for YDL131W_BY4742 from Stanford:

YDL131W_BY4742 [source=Stanford]  Length: 332  Tue Sep 19 05:27:42 2017  Type: P  Check: 1358  ..

       1  MDDARVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VRSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKSRVDQLNL NLTDDQIKEV TAKIKKLGDV RPLNIDDVDS IIKDFHAELS

     301  TPLLKPVNKG TDDDNIDISN GHVSKKAKVT K*

Protein Sequence for YDL131W_CBS7960 from WashU:

YDL131W_CBS7960 [source=WashU]  Length: 441  Tue Sep 19 05:27:42 2017  Type: P  Check: 501  ..

       1  MSENNEFQSV TESTTAPTTN NPYGPNPADY LSNVKNFQLI DSTLREGEQF

      51  ANAFFDTEKK IEIARALDDF GVDYIELTSP VASEQSRKDC EAICKLGLKA

     101  KILTHIRCHM DDARVAVETG VDGVDVVIGT SKFLRQYSHG KDMNYIAKSA

     151  VEVIEFVKSK GIEIRFSSED SFRSDLVDLL NIYKTVDKIG VNRVGIADTV

     201  GCANPRQVYE LIRTLKSVVS CDIECHFHND TGCAIANAYT ALEGGARLID

     251  VSVLGIGERN GITPLGGLMA RMIVAAPDYV RSKYKLHKIR DIENLVADAV

     301  EVNIPFNNPI TGFCAFTHKA GIHAKAILAN PSTYEILDPH DFGMKRYIHF

     351  ANRLTGWNAI KSRVDQLNLN LTDDQIKEVT AKIKKLGDVR PLNIDDVDSI

     401  IKDFHAELST PLLKPVNKGT DDDNIDISNG HVSKKAKVTK *


Protein Sequence for YDL131W_CEN.PK from Stanford:

YDL131W_CEN.PK [source=Stanford]  Length: 332  Tue Sep 19 05:27:42 2017  Type: P  Check: 866  ..

       1  MDDAKVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VKSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKARVDQLNL NLTDDQIKEV TAKIKKLGDV RPLNIDDVDS IIKDFHAELS

     301  TPLLKPVNKG TDDDNIDISN GHVSKKAKVT K*

Protein Sequence for YDL131W_CLIB324 from WashU:

YDL131W_CLIB324 [source=WashU]  Length: 248  Tue Sep 19 05:27:42 2017  Type: P  Check: 4404  ..

       1  MSENNEFQSV TESTTAPTTS NPYGPNPADY LSNVKNFQLI DSTLREGEQF

      51  ANAFFDTEKK IEIARALDDF GVDYIELTSP VASEQSRKDC EAICKLGLKA

     101  KILTHIRCHM DDARVAVETG VDGVDVVIGT SKFLRQYSHG KDMNYIAKSA

     151  VEVIEFVKSK GIEIRFSSED SFRSDLVDLL NIYKTVDKIG VNRVGIADTV

     201  GCANPRQVYE LIRTLKSVVS CDIECHFHND TGCAIANAYT ALKVVPD*


Protein Sequence for YDL131W_D273-10B from Stanford:

YDL131W_D273-10B [source=Stanford]  Length: 332  Tue Sep 19 05:27:42 2017  Type: P  Check: 1316  ..

       1  MDDAKVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VKSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKSRVDQLNL NLTDDQIKEV TAKIKKLGDV RPLNIDDVDS IIKDFHAELS

     301  TPLLKPVNKG TDDDNIDISN GHVSKKAKVT K*

Protein Sequence for YDL131W_DBVPG6044 from Stanford:

YDL131W_DBVPG6044 [source=Stanford]  Length: 332  Tue Sep 19 05:27:42 2017  Type: P  Check: 1406  ..

       1  MDDARVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPEY VKSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKSRVDQLNL NLTDDQIKEV TAKIKKLGDV RPLNIDDVDS IIKDFHAELS

     301  TPLLKPVNKG TDDDNIDISN GHVSKKAKVT K*

Protein Sequence for YDL131W_EC1118 from Genoscope:

YDL131W_EC1118 [source=Genoscope]  Length: 441  Tue Sep 19 05:27:42 2017  Type: P  Check: 601  ..

       1  MSENNEFQSV TESTTAPTTS NPYGPNPADY LSNVKNFQLI DSTLREGEQF

      51  ANAFFDTEKK IEIARALDDF GVDYIELTSP VASEQSRKDC EAICKLGLKA

     101  KILTHIRCHM DDARVAVETG VDGVDVVIGT SKFLRQYSHG KDMNYIAKSA

     151  VEVIEFVKSK GIEIRFSSED SFRSDLVDLL NIYKTVDKIG VNRVGIADTV

     201  GCANPRQVYE LIRTLKSVVS CDIECHFHND TGCAIANAYT ALEGGARLID

     251  VSVLGIGERN GITPLGGLMA RMIVAAPDYV RSKYKLHKIR DIENLVADAV

     301  EVNIPFNNPI TGFCAFTHKA GIHAKAILAN PSTYEILDPH DFGMKRYIHF

     351  ANRLTGWNAI KSRVDQLNLN LTDDQIKEVT AKIKKLGDVR PLNIDDVDSI

     401  IKDFHAELST PLLKPVNKGT DDDNIDISNG HVSKKAKVTK *


Protein Sequence for YDL131W_FL100 from Stanford:

YDL131W_FL100 [source=Stanford]  Length: 332  Tue Sep 19 05:27:42 2017  Type: P  Check: 1358  ..

       1  MDDARVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VRSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKSRVDQLNL NLTDDQIKEV TAKIKKLGDV RPLNIDDVDS IIKDFHAELS

     301  TPLLKPVNKG TDDDNIDISN GHVSKKAKVT K*

Protein Sequence for YDL131W_FY1679 from Stanford:

YDL131W_FY1679 [source=Stanford]  Length: 332  Tue Sep 19 05:27:42 2017  Type: P  Check: 1351  ..

       1  MDDARVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VKSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKSRVDQLNL NLTDDQIKEV TAKIKKLGDV RPLNIDDVDS IIKDFHAELS

     301  TPLLKPVNKG TDDDNIDISN GHVSKKAKVT K*

Protein Sequence for YDL131W_FostersB from AWRI:

YDL131W_FostersB [source=AWRI]  Length: 317  Tue Sep 19 05:27:42 2017  Type: P  Check: 9773  ..

       1  MLLSAPPNFL RQYSHGKDMN YIAKSAVEVI EFVKSKGIEI RFSSEDSFRS

      51  DLVDLLNIYK TVDKIGVNRV GIADTVGCAN PRQVYELIRT LKSVVSCDIE

     101  CHFHNDTGCA IANAYTALEG GARLIDVSVL GIGERNGITP LGGLMARMIV

     151  AAPDYVKSKY KLHKIRDIEN LVADAVEVNI PFNNPIXGFC AFTHKAGIHA

     201  KAILANPSTY EILDPHDFGM KRYIHFANRL TGWNAIKSRV DQLNLNLTDD

     251  QIKEVTAKIK KLGDVRPLNI DDVDSIIKDF HAELSTPLLK PVNKGTDDDN

     301  IDISNGHVSK KAKVTK*

Protein Sequence for YDL131W_FostersO from AWRI:

YDL131W_FostersO [source=AWRI]  Length: 299  Tue Sep 19 05:27:42 2017  Type: P  Check: 5247  ..

       1  MNYIAKSAVE VIEFVKSKGI EIRFSSEDSF RSDLVDLLNI YKTVDKIGVN

      51  RVGIADTVGC ANPRQVYELI RTLKSVXSCD IECHFHNDXG CAIANAYTAL

     101  EGGARLIDVS VLXIGERNGI TPLGGLMARM XVAAPDYVXX KYKXHKIRDX

     151  ENLVADAVEV NIPFNNPITG FCAFTHKAGI HAKAILANPS TYEILDPHDF

     201  GMKRYXHFAN RLTGWNAIKS RVDQLNLNLX DDQIKEVTAK IKKLGDVRPL

     251  NIDDVDSIIK DFHAELSTPF LKPVNKGTDD DNIDISNGHV SKKAKVTK*


Protein Sequence for YDL131W_JK9-3d from Stanford:

YDL131W_JK9-3d [source=Stanford]  Length: 332  Tue Sep 19 05:27:42 2017  Type: P  Check: 873  ..

       1  MDDAKVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VRSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKARVDQLNL NLTDDQIKEV TAKIKKLGDV RPLNIDDVDS IIKDFHAELS

     301  TPLLKPVNKG TDDDNIDISN GHVSKKAKVT K*

Protein Sequence for YDL131W_K11 from Stanford:

YDL131W_K11 [source=Stanford]  Length: 332  Tue Sep 19 05:27:42 2017  Type: P  Check: 866  ..

       1  MDDAKVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VKSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKARVDQLNL NLTDDQIKEV TAKIKKLGDV RPLNIDDVDS IIKDFHAELS

     301  TPLLKPVNKG TDDDNIDISN GHVSKKAKVT K*

Protein Sequence for YDL131W_Kyokai7 from NRIB:

YDL131W_Kyokai7 [source=NRIB]  Length: 441  Tue Sep 19 05:27:42 2017  Type: P  Check: 230  ..

       1  MSENNEFQSV TESTTAPTTS NPYGPNPADY LSNVKNFQLI DSTLREGEQF

      51  ANAFFDTEKK IEIARALDDF GVDYIELTSP VASEQSRKDC EAICKLGLKA

     101  KILTHIRCHM DDARVAVETG VDGVDVVIGT SKFLRQYSHG KDMNYIAKSA

     151  VEVIEFVKSK GIEIRFSSED SFRSDLVDLL NIYKTVDKIG VNRVGIADTV

     201  GCANPRQVYE LIRTLKSVVS CDIECHFHND TGCAIANAYT ALEGGARLID

     251  VSVLGIGERN GITPLGGLMA RMIVAAPDYV KSKYKLHKIR DIENLVADAV

     301  EVNIPFNNPI TGFCAFTHKA GIHAKAILAN PSTYEILDPH DFGMKRYIHF

     351  ANRLTGWNAI KSRVDQLNLN LTDDQIKEVT AKIKKLGDVR PLNIDDVDSI

     401  IKDFHAELST PLLKPVNKGT DDDNIDISNG HVSKKAKVTK *


Protein Sequence for YDL131W_L1528 from Stanford:

YDL131W_L1528 [source=Stanford]  Length: 332  Tue Sep 19 05:27:42 2017  Type: P  Check: 866  ..

       1  MDDAKVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VKSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKARVDQLNL NLTDDQIKEV TAKIKKLGDV RPLNIDDVDS IIKDFHAELS

     301  TPLLKPVNKG TDDDNIDISN GHVSKKAKVT K*

Protein Sequence for YDL131W_LalvinQA23 from AWRI:

YDL131W_LalvinQA23 [source=AWRI]  Length: 441  Tue Sep 19 05:27:42 2017  Type: P  Check: 1566  ..

       1  MSENNEFQSV TESTTAPTTS NPYGPNPADY LSNVKNFQLI DSTLREGEQF

      51  ANAFFDTEKK IEIARALDDF GVDYIELTSP VASEQSRKDC EAICKLGLKA

     101  KILTHIRCHM DDARVAVETG VDGVDVVIGT SKFLRQYSHG KDMNYIAKSA

     151  VEVIEFVKSK GIEIRFSSED SFRSDLVDLL NIYKTVDKIG VNRVGIADTV

     201  GCANPRQVYE LIRTLKSVXS CDIECHFHND XGCAIANAYX ALEGGARLID

     251  VSVLGIGERN GITPLGGLMA RMIVAAPDYV XXKYKXHKIR DXENLVADAV

     301  EVNIPFNNPI XGFCAFTHKA GIHAKAILAN PSTYEILDPH DFGMKRYIHF

     351  ANRLTGWNAI KSRVDQLNLN LTDDQIKEVT AKIKKLGDVR PLNIDDVDSI

     401  IKDFHAELST PLLKPVNKGT DDDNIDISNG HVSKKAKVTK *


Protein Sequence for YDL131W_RM11-1a from Stanford:

YDL131W_RM11-1a [source=Stanford]  Length: 332  Tue Sep 19 05:27:42 2017  Type: P  Check: 1316  ..

       1  MDDAKVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VKSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKSRVDQLNL NLTDDQIKEV TAKIKKLGDV RPLNIDDVDS IIKDFHAELS

     301  TPLLKPVNKG TDDDNIDISN GHVSKKAKVT K*

Protein Sequence for YDL131W_RedStar from Stanford:

YDL131W_RedStar [source=Stanford]  Length: 332  Tue Sep 19 05:27:42 2017  Type: P  Check: 1208  ..

       1  MDDAKVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VKSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKSRVDQLNL NLTDDQIKEV TAKIKKLGDV RPLNIDDVDS IIKDFHAELS

     301  TPFLKPVNKG TDDDNIDISN GHVSKKAKVT K*

Protein Sequence for YDL131W_SEY6210 from Stanford:

YDL131W_SEY6210 [source=Stanford]  Length: 332  Tue Sep 19 05:27:42 2017  Type: P  Check: 1323  ..

       1  MDDAKVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VRSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKSRVDQLNL NLTDDQIKEV TAKIKKLGDV RPLNIDDVDS IIKDFHAELS

     301  TPLLKPVNKG TDDDNIDISN GHVSKKAKVT K*

Protein Sequence for YDL131W_SK1 from Stanford:

YDL131W_SK1 [source=Stanford]  Length: 332  Tue Sep 19 05:27:42 2017  Type: P  Check: 1358  ..

       1  MDDARVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VRSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKSRVDQLNL NLTDDQIKEV TAKIKKLGDV RPLNIDDVDS IIKDFHAELS

     301  TPLLKPVNKG TDDDNIDISN GHVSKKAKVT K*

Protein Sequence for YDL131W_VL3 from AWRI:

YDL131W_VL3 [source=AWRI]  Length: 441  Tue Sep 19 05:27:42 2017  Type: P  Check: 601  ..

       1  MSENNEFQSV TESTTAPTTS NPYGPNPADY LSNVKNFQLI DSTLREGEQF

      51  ANAFFDTEKK IEIARALDDF GVDYIELTSP VASEQSRKDC EAICKLGLKA

     101  KILTHIRCHM DDARVAVETG VDGVDVVIGT SKFLRQYSHG KDMNYIAKSA

     151  VEVIEFVKSK GIEIRFSSED SFRSDLVDLL NIYKTVDKIG VNRVGIADTV

     201  GCANPRQVYE LIRTLKSVVS CDIECHFHND TGCAIANAYT ALEGGARLID

     251  VSVLGIGERN GITPLGGLMA RMIVAAPDYV RSKYKLHKIR DIENLVADAV

     301  EVNIPFNNPI TGFCAFTHKA GIHAKAILAN PSTYEILDPH DFGMKRYIHF

     351  ANRLTGWNAI KSRVDQLNLN LTDDQIKEVT AKIKKLGDVR PLNIDDVDSI

     401  IKDFHAELST PLLKPVNKGT DDDNIDISNG HVSKKAKVTK *


Protein Sequence for YDL131W_Vin13 from AWRI:

YDL131W_Vin13 [source=AWRI]  Length: 441  Tue Sep 19 05:27:42 2017  Type: P  Check: 601  ..

       1  MSENNEFQSV TESTTAPTTS NPYGPNPADY LSNVKNFQLI DSTLREGEQF

      51  ANAFFDTEKK IEIARALDDF GVDYIELTSP VASEQSRKDC EAICKLGLKA

     101  KILTHIRCHM DDARVAVETG VDGVDVVIGT SKFLRQYSHG KDMNYIAKSA

     151  VEVIEFVKSK GIEIRFSSED SFRSDLVDLL NIYKTVDKIG VNRVGIADTV

     201  GCANPRQVYE LIRTLKSVVS CDIECHFHND TGCAIANAYT ALEGGARLID

     251  VSVLGIGERN GITPLGGLMA RMIVAAPDYV RSKYKLHKIR DIENLVADAV

     301  EVNIPFNNPI TGFCAFTHKA GIHAKAILAN PSTYEILDPH DFGMKRYIHF

     351  ANRLTGWNAI KSRVDQLNLN LTDDQIKEVT AKIKKLGDVR PLNIDDVDSI

     401  IKDFHAELST PLLKPVNKGT DDDNIDISNG HVSKKAKVTK *


Protein Sequence for YDL131W_W303 from Stanford:

YDL131W_W303 [source=Stanford]  Length: 332  Tue Sep 19 05:27:42 2017  Type: P  Check: 1323  ..

       1  MDDAKVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VRSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKSRVDQLNL NLTDDQIKEV TAKIKKLGDV RPLNIDDVDS IIKDFHAELS

     301  TPLLKPVNKG TDDDNIDISN GHVSKKAKVT K*

Protein Sequence for YDL131W_X2180-1A from Stanford:

YDL131W_X2180-1A [source=Stanford]  Length: 332  Tue Sep 19 05:27:42 2017  Type: P  Check: 866  ..

       1  MDDAKVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VKSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKARVDQLNL NLTDDQIKEV TAKIKKLGDV RPLNIDDVDS IIKDFHAELS

     301  TPLLKPVNKG TDDDNIDISN GHVSKKAKVT K*

Protein Sequence for YDL131W_Y55 from Stanford:

YDL131W_Y55 [source=Stanford]  Length: 332  Tue Sep 19 05:27:42 2017  Type: P  Check: 901  ..

       1  MDDARVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VKSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKARVDQLNL NLTDDQIKEV TAKIKKLGDV RPLNIDDVDS IIKDFHAELS

     301  TPLLKPVNKG TDDDNIDISN GHVSKKAKVT K*

Protein Sequence for YDL131W_YJM269 from WashU:

YDL131W_YJM269 [source=WashU]  Length: 210  Tue Sep 19 05:27:42 2017  Type: P  Check: 1470  ..

       1  MSENNEFQSV TESTTAPTTS NPYGPNPADY LSNVKNFQLI DSTLREGEQF

      51  ANAFFDTEKK IEIARALDDF GVDYIELTSP VASEQSRKDC EAICKLGLKA

     101  KILTHIRCHM DDARVAVETG VDGVDVVIGT SKFLRQYSHG KDMNYIAKSA

     151  VEVIEFVKSK GIEIRFSSED SFRSDLVDLL NIYKTVDKIG VNRVGIADTV

     201  GCANPKTSI*

Protein Sequence for YDL131W_YJM339 from Stanford:

YDL131W_YJM339 [source=Stanford]  Length: 332  Tue Sep 19 05:27:42 2017  Type: P  Check: 866  ..

       1  MDDAKVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VKSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKARVDQLNL NLTDDQIKEV TAKIKKLGDV RPLNIDDVDS IIKDFHAELS

     301  TPLLKPVNKG TDDDNIDISN GHVSKKAKVT K*

Protein Sequence for YDL131W_YJM789 from Stanford:

YDL131W_YJM789 [source=Stanford]  Length: 441  Tue Sep 19 05:27:42 2017  Type: P  Check: 601  ..

       1  MSENNEFQSV TESTTAPTTS NPYGPNPADY LSNVKNFQLI DSTLREGEQF

      51  ANAFFDTEKK IEIARALDDF GVDYIELTSP VASEQSRKDC EAICKLGLKA

     101  KILTHIRCHM DDARVAVETG VDGVDVVIGT SKFLRQYSHG KDMNYIAKSA

     151  VEVIEFVKSK GIEIRFSSED SFRSDLVDLL NIYKTVDKIG VNRVGIADTV

     201  GCANPRQVYE LIRTLKSVVS CDIECHFHND TGCAIANAYT ALEGGARLID

     251  VSVLGIGERN GITPLGGLMA RMIVAAPDYV RSKYKLHKIR DIENLVADAV

     301  EVNIPFNNPI TGFCAFTHKA GIHAKAILAN PSTYEILDPH DFGMKRYIHF

     351  ANRLTGWNAI KSRVDQLNLN LTDDQIKEVT AKIKKLGDVR PLNIDDVDSI

     401  IKDFHAELST PLLKPVNKGT DDDNIDISNG HVSKKAKVTK *


Protein Sequence for YDL131W_YPH499 from Stanford:

YDL131W_YPH499 [source=Stanford]  Length: 332  Tue Sep 19 05:27:42 2017  Type: P  Check: 1358  ..

       1  MDDARVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VRSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKSRVDQLNL NLTDDQIKEV TAKIKKLGDV RPLNIDDVDS IIKDFHAELS

     301  TPLLKPVNKG TDDDNIDISN GHVSKKAKVT K*

Protein Sequence for YDL131W_YPS128 from Stanford:

YDL131W_YPS128 [source=Stanford]  Length: 332  Tue Sep 19 05:27:42 2017  Type: P  Check: 866  ..

       1  MDDAKVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VKSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKARVDQLNL NLTDDQIKEV TAKIKKLGDV RPLNIDDVDS IIKDFHAELS

     301  TPLLKPVNKG TDDDNIDISN GHVSKKAKVT K*

Protein Sequence for YDL131W_YPS163 from Stanford:

YDL131W_YPS163 [source=Stanford]  Length: 332  Tue Sep 19 05:27:42 2017  Type: P  Check: 866  ..

       1  MDDAKVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VKSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYIH FANRLTGWNA

     251  IKARVDQLNL NLTDDQIKEV TAKIKKLGDV RPLNIDDVDS IIKDFHAELS

     301  TPLLKPVNKG TDDDNIDISN GHVSKKAKVT K*

Protein Sequence for YDL131W_YS9 from Stanford:

YDL131W_YS9 [source=Stanford]  Length: 332  Tue Sep 19 05:27:42 2017  Type: P  Check: 1415  ..

       1  MDDARVAVET GVDGVDVVIG TSKFLRQYSH GKDMNYIAKS AVEVIEFVKS

      51  KGIEIRFSSE DSFRSDLVDL LNIYKTVDKI GVNRVGIADT VGCANPRQVY

     101  ELIRTLKSVV SCDIECHFHN DTGCAIANAY TALEGGARLI DVSVLGIGER

     151  NGITPLGGLM ARMIVAAPDY VRSKYKLHKI RDIENLVADA VEVNIPFNNP

     201  ITGFCAFTHK AGIHAKAILA NPSTYEILDP HDFGMKRYXH FANRLTGWNA

     251  IKSRVDQLNL NLTDDQIKEV TAKIKKLGDV RPLNIDDVDS IIKDFHAELS

     301  TPFLKPVNKG TDDDNIDISN GHVSKKAKVT K*

Protein Sequence for YDL131W_ZTW1 from Zhejiang:

YDL131W_ZTW1 [source=Zhejiang]  Length: 441  Tue Sep 19 05:27:42 2017  Type: P  Check: 726  ..

       1  MSENNEFQSV TESTTAPTTS NPYGPNPADY LSNVKNFQLI DSTLREGEQF

      51  ANAFFDTEKK IEIARALDDF GVDYIELTSP VASEQSRKDC EAICKLGLKA

     101  KILTHIRCHM DDARVAVETG VDGVDVVIGT SKFLRQYSHG KDMNYIAKSA

     151  VEVIEFVKSK GIEIRFSSED SFRSDLVDLL NIYKTVDKIG VNRVGIADTV

     201  GCANPRQVYE LIRTLKSVVS CDIECHFHND TGCAIANAYT ALEGGARLID

     251  VSVLGIGERN GITPLGGLMA RMIVAAPDYV RSKYKLHKIR DIENLVADAV

     301  EVNIPFNNPI TGFCAFTHKA GIHAKAILAN PSTYEILDPH DFGMKRYIHF

     351  ANRLTGWNAI KSRVDQLNLN LTDDQIKEVT AKIKKLGDVR PLNIDDVDSI

     401  IKDFHAELST PLLKPVNKGT DDDSIDISNG HVSKKAKVTK *