RPL31A/YDL075W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YDL075W_S288C   1   MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVR   50
YDL075W_AWRI1631   1   MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVR   50
YDL075W_AWRI796   1   MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVR   50
YDL075W_BC187   1   -------------------LHGVSFKKRAPRAVKEIKKFAKLHMGTDDVR   31
YDL075W_BY4741   1   MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVR   50
YDL075W_BY4742   1   MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVR   50
YDL075W_CBS7960   1   MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVR   50
YDL075W_CEN.PK   1   -------------------LHGVSFKKRAPRAVKEIKKFAKLHMGTDDVR   31
YDL075W_CLIB215   1   MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVR   50
YDL075W_D273-10B   1   MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVR   50
YDL075W_DBVPG6044   1   MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVR   50
YDL075W_EC1118   1   MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVR   50
YDL075W_FL100   1   -------------------LHGVSFKKRAPRAVKEIKKFAKLHMGTDDVR   31
YDL075W_FY1679   1   MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVR   50
YDL075W_FostersB   1   MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVR   50
YDL075W_JAY291   1   MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVR   50
YDL075W_JK9-3d   1   -------------------LHGVSFKKRAPRAVKEIKKFAKLHMGTDDVR   31
YDL075W_K11   1   -------------------LHGVSFKKRAPRAVKEIKKFAKLHMGTDDVR   31
YDL075W_Kyokai7   1   MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVR   50
YDL075W_L1528   1   MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVR   50
YDL075W_LalvinQA23   1   MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVR   50
YDL075W_RM11-1a   1   MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVR   50
YDL075W_RedStar   1   MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVR   50
YDL075W_SEY6210   1   MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVR   50
YDL075W_SK1   1   MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVR   50
YDL075W_T7   1   MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVR   50
YDL075W_UC5   1   MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVR   50
YDL075W_VL3   1   MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVR   50
YDL075W_Vin13   1   MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVR   50
YDL075W_W303   1   MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVR   50
YDL075W_X2180-1A   1   MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVR   50
YDL075W_Y55   1   MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVR   50
YDL075W_YJM269   1   MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVR   50
YDL075W_YJM339   1   MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVR   50
YDL075W_YJM789   1   MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVR   50
YDL075W_YPH499   1   -------------------LHGVSFKKRAPRAVKEIKKFAKLHMGTDDVR   31
YDL075W_YPS128   1   MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVR   50
YDL075W_YS9   1   -------------------LHGVSFKKRAPRAVKEIKKFAKLHMGTDDVR   31
YDL075W_ZTW1   1   MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVR   50
         

YDL075W_S288C   51   LAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVAS   100
YDL075W_AWRI1631   51   LAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVAS   100
YDL075W_AWRI796   51   LAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVAS   100
YDL075W_BC187   32   LAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVAS   81
YDL075W_BY4741   51   LAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVAS   100
YDL075W_BY4742   51   LAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVAS   100
YDL075W_CBS7960   51   LAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVAS   100
YDL075W_CEN.PK   32   LAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVAS   81
YDL075W_CLIB215   51   LAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVAS   100
YDL075W_D273-10B   51   LAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVAS   100
YDL075W_DBVPG6044   51   LAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVAS   100
YDL075W_EC1118   51   LAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVAS   100
YDL075W_FL100   32   LAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVAS   81
YDL075W_FY1679   51   LAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVAS   100
YDL075W_FostersB   51   LAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVAS   100
YDL075W_JAY291   51   LAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVAS   100
YDL075W_JK9-3d   32   LAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVAS   81
YDL075W_K11   32   LAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVAS   81
YDL075W_Kyokai7   51   LAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVAS   100
YDL075W_L1528   51   LAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVAS   100
YDL075W_LalvinQA23   51   LAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVAS   100
YDL075W_RM11-1a   51   LAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVAS   100
YDL075W_RedStar   51   LAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVAS   100
YDL075W_SEY6210   51   LAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVAS   100
YDL075W_SK1   51   LAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVAS   100
YDL075W_T7   51   LAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVAS   100
YDL075W_UC5   51   LAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVAS   100
YDL075W_VL3   51   LAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVAS   100
YDL075W_Vin13   51   LAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVAS   100
YDL075W_W303   51   LAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVAS   100
YDL075W_X2180-1A   51   LAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVAS   100
YDL075W_Y55   51   LAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVAS   100
YDL075W_YJM269   51   LAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVAS   100
YDL075W_YJM339   51   LAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVAS   100
YDL075W_YJM789   51   LAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVAS   100
YDL075W_YPH499   32   LAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVAS   81
YDL075W_YPS128   51   LAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVAS   100
YDL075W_YS9   32   LAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVAS   81
YDL075W_ZTW1   51   LAPELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVAS   100
         

YDL075W_S288C   101   AKGLQTVVVEEDA-------------------   113
YDL075W_AWRI1631   101   AKGLQTVVVEEDA-------------------   113
YDL075W_AWRI796   101   AKGLQTVVVEEDA-------------------   113
YDL075W_BC187   82   AKGLQTVVVEEDAMAGLKDVVTREYTINLHKR   113
YDL075W_BY4741   101   AKGLQTVVVEEDA-------------------   113
YDL075W_BY4742   101   AKGLQTVVVEEDA-------------------   113
YDL075W_CBS7960   101   AKGLQTVVVEEDA-------------------   113
YDL075W_CEN.PK   82   AKGLQTVVVEEDAMAGLKDVVTREYTINLHKR   113
YDL075W_CLIB215   101   AKGLQTVVVEEDA-------------------   113
YDL075W_D273-10B   101   AKGLQTVVVEEDA-------------------   113
YDL075W_DBVPG6044   101   AKGLQTVVVEEDA-------------------   113
YDL075W_EC1118   101   AKGLQTVVVEEDA-------------------   113
YDL075W_FL100   82   AKGLQTVVVEEDAMAGLKDVVTREYTINLHKR   113
YDL075W_FY1679   101   AKGLQTVVVEEDA-------------------   113
YDL075W_FostersB   101   AKGLQTVVVEEDA-------------------   113
YDL075W_JAY291   101   AKGLQTVVVEEDA-------------------   113
YDL075W_JK9-3d   82   AKGLQTVVVEEDAMAGLKDVVTREYTINLHKR   113
YDL075W_K11   82   AKGLQTVVVEEDAMAGLKDVVTREYTINLHKR   113
YDL075W_Kyokai7   101   AKGLQTVVVEEDA-------------------   113
YDL075W_L1528   101   AKGLQTVVVEEDA-------------------   113
YDL075W_LalvinQA23   101   AKGLQTVVVEEDA-------------------   113
YDL075W_RM11-1a   101   AKGLQTVVVEEDA-------------------   113
YDL075W_RedStar   101   AKGLQTVVVEEDA-------------------   113
YDL075W_SEY6210   101   AKGLQTVVVEEDA-------------------   113
YDL075W_SK1   101   AKGLQTVVVEEDA-------------------   113
YDL075W_T7   101   AKGLQTVVVEEDA-------------------   113
YDL075W_UC5   101   AKGLQTVVVEEDA-------------------   113
YDL075W_VL3   101   AKGLQTVVVEEDA-------------------   113
YDL075W_Vin13   101   AKGLQTVVVEEDA-------------------   113
YDL075W_W303   101   AKGLQTVVVEEDA-------------------   113
YDL075W_X2180-1A   101   AKGLQTVVVEEDA-------------------   113
YDL075W_Y55   101   AKGLQTVVVEEDA-------------------   113
YDL075W_YJM269   101   AKGLQTVVVEEDA-------------------   113
YDL075W_YJM339   101   AKGLQTVVVEEDA-------------------   113
YDL075W_YJM789   101   AKGLQTVVVEEDA-------------------   113
YDL075W_YPH499   82   AKGLQTVVVEEDAMAGLKDVVTREYTINLHKR   113
YDL075W_YPS128   101   AKGLQTVVVEEDA-------------------   113
YDL075W_YS9   82   AKGLQTVVVEEDAMAGLKDVVTREYTINLHKR   113
YDL075W_ZTW1   101   AKGLQTVVVEEDA-------------------   113
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YDL075W_S288C from SGD:

YDL075W_S288C [source=SGD]  Length: 114  Thu Sep 21 09:24:34 2017  Type: P  Check: 9296  ..

       1  MAGLKDVVTR EYTINLHKRL HGVSFKKRAP RAVKEIKKFA KLHMGTDDVR

      51  LAPELNQAIW KRGVKGVEYR LRLRISRKRN EEEDAKNPLF SYVEPVLVAS

     101  AKGLQTVVVE EDA*

Protein Sequence for YDL075W_AWRI1631 from AWRI:

YDL075W_AWRI1631 [source=AWRI]  Length: 114  Thu Sep 21 09:24:34 2017  Type: P  Check: 9296  ..

       1  MAGLKDVVTR EYTINLHKRL HGVSFKKRAP RAVKEIKKFA KLHMGTDDVR

      51  LAPELNQAIW KRGVKGVEYR LRLRISRKRN EEEDAKNPLF SYVEPVLVAS

     101  AKGLQTVVVE EDA*

Protein Sequence for YDL075W_AWRI796 from AWRI:

YDL075W_AWRI796 [source=AWRI]  Length: 114  Thu Sep 21 09:24:34 2017  Type: P  Check: 9296  ..

       1  MAGLKDVVTR EYTINLHKRL HGVSFKKRAP RAVKEIKKFA KLHMGTDDVR

      51  LAPELNQAIW KRGVKGVEYR LRLRISRKRN EEEDAKNPLF SYVEPVLVAS

     101  AKGLQTVVVE EDA*

Protein Sequence for YDL075W_BC187 from Stanford:

YDL075W_BC187 [source=Stanford]  Length: 114  Thu Sep 21 09:24:34 2017  Type: P  Check: 2830  ..

       1  LHGVSFKKRA PRAVKEIKKF AKLHMGTDDV RLAPELNQAI WKRGVKGVEY

      51  RLRLRISRKR NEEEDAKNPL FSYVEPVLVA SAKGLQTVVV EEDA*MAGLK

     101  DVVTREYTIN LHKR

Protein Sequence for YDL075W_BY4741 from Stanford:

YDL075W_BY4741 [source=Stanford]  Length: 114  Thu Sep 21 09:24:34 2017  Type: P  Check: 9296  ..

       1  MAGLKDVVTR EYTINLHKRL HGVSFKKRAP RAVKEIKKFA KLHMGTDDVR

      51  LAPELNQAIW KRGVKGVEYR LRLRISRKRN EEEDAKNPLF SYVEPVLVAS

     101  AKGLQTVVVE EDA*

Protein Sequence for YDL075W_BY4742 from Stanford:

YDL075W_BY4742 [source=Stanford]  Length: 114  Thu Sep 21 09:24:34 2017  Type: P  Check: 9296  ..

       1  MAGLKDVVTR EYTINLHKRL HGVSFKKRAP RAVKEIKKFA KLHMGTDDVR

      51  LAPELNQAIW KRGVKGVEYR LRLRISRKRN EEEDAKNPLF SYVEPVLVAS

     101  AKGLQTVVVE EDA*

Protein Sequence for YDL075W_CBS7960 from WashU:

YDL075W_CBS7960 [source=WashU]  Length: 114  Thu Sep 21 09:24:34 2017  Type: P  Check: 9296  ..

       1  MAGLKDVVTR EYTINLHKRL HGVSFKKRAP RAVKEIKKFA KLHMGTDDVR

      51  LAPELNQAIW KRGVKGVEYR LRLRISRKRN EEEDAKNPLF SYVEPVLVAS

     101  AKGLQTVVVE EDA*

Protein Sequence for YDL075W_CEN.PK from Stanford:

YDL075W_CEN.PK [source=Stanford]  Length: 114  Thu Sep 21 09:24:34 2017  Type: P  Check: 2830  ..

       1  LHGVSFKKRA PRAVKEIKKF AKLHMGTDDV RLAPELNQAI WKRGVKGVEY

      51  RLRLRISRKR NEEEDAKNPL FSYVEPVLVA SAKGLQTVVV EEDA*MAGLK

     101  DVVTREYTIN LHKR

Protein Sequence for YDL075W_CLIB215 from WashU:

YDL075W_CLIB215 [source=WashU]  Length: 114  Thu Sep 21 09:24:34 2017  Type: P  Check: 9296  ..

       1  MAGLKDVVTR EYTINLHKRL HGVSFKKRAP RAVKEIKKFA KLHMGTDDVR

      51  LAPELNQAIW KRGVKGVEYR LRLRISRKRN EEEDAKNPLF SYVEPVLVAS

     101  AKGLQTVVVE EDA*

Protein Sequence for YDL075W_D273-10B from Stanford:

YDL075W_D273-10B [source=Stanford]  Length: 114  Thu Sep 21 09:24:34 2017  Type: P  Check: 9296  ..

       1  MAGLKDVVTR EYTINLHKRL HGVSFKKRAP RAVKEIKKFA KLHMGTDDVR

      51  LAPELNQAIW KRGVKGVEYR LRLRISRKRN EEEDAKNPLF SYVEPVLVAS

     101  AKGLQTVVVE EDA*

Protein Sequence for YDL075W_DBVPG6044 from Stanford:

YDL075W_DBVPG6044 [source=Stanford]  Length: 114  Thu Sep 21 09:24:34 2017  Type: P  Check: 9296  ..

       1  MAGLKDVVTR EYTINLHKRL HGVSFKKRAP RAVKEIKKFA KLHMGTDDVR

      51  LAPELNQAIW KRGVKGVEYR LRLRISRKRN EEEDAKNPLF SYVEPVLVAS

     101  AKGLQTVVVE EDA*

Protein Sequence for YDL075W_EC1118 from Genoscope:

YDL075W_EC1118 [source=Genoscope]  Length: 114  Thu Sep 21 09:24:34 2017  Type: P  Check: 9296  ..

       1  MAGLKDVVTR EYTINLHKRL HGVSFKKRAP RAVKEIKKFA KLHMGTDDVR

      51  LAPELNQAIW KRGVKGVEYR LRLRISRKRN EEEDAKNPLF SYVEPVLVAS

     101  AKGLQTVVVE EDA*

Protein Sequence for YDL075W_FL100 from Stanford:

YDL075W_FL100 [source=Stanford]  Length: 114  Thu Sep 21 09:24:34 2017  Type: P  Check: 2830  ..

       1  LHGVSFKKRA PRAVKEIKKF AKLHMGTDDV RLAPELNQAI WKRGVKGVEY

      51  RLRLRISRKR NEEEDAKNPL FSYVEPVLVA SAKGLQTVVV EEDA*MAGLK

     101  DVVTREYTIN LHKR

Protein Sequence for YDL075W_FY1679 from Stanford:

YDL075W_FY1679 [source=Stanford]  Length: 114  Thu Sep 21 09:24:34 2017  Type: P  Check: 9296  ..

       1  MAGLKDVVTR EYTINLHKRL HGVSFKKRAP RAVKEIKKFA KLHMGTDDVR

      51  LAPELNQAIW KRGVKGVEYR LRLRISRKRN EEEDAKNPLF SYVEPVLVAS

     101  AKGLQTVVVE EDA*

Protein Sequence for YDL075W_FostersB from AWRI:

YDL075W_FostersB [source=AWRI]  Length: 114  Thu Sep 21 09:24:34 2017  Type: P  Check: 9296  ..

       1  MAGLKDVVTR EYTINLHKRL HGVSFKKRAP RAVKEIKKFA KLHMGTDDVR

      51  LAPELNQAIW KRGVKGVEYR LRLRISRKRN EEEDAKNPLF SYVEPVLVAS

     101  AKGLQTVVVE EDA*

Protein Sequence for YDL075W_JAY291 from Duke:

YDL075W_JAY291 [source=Duke]  Length: 114  Thu Sep 21 09:24:34 2017  Type: P  Check: 9296  ..

       1  MAGLKDVVTR EYTINLHKRL HGVSFKKRAP RAVKEIKKFA KLHMGTDDVR

      51  LAPELNQAIW KRGVKGVEYR LRLRISRKRN EEEDAKNPLF SYVEPVLVAS

     101  AKGLQTVVVE EDA*

Protein Sequence for YDL075W_JK9-3d from Stanford:

YDL075W_JK9-3d [source=Stanford]  Length: 114  Thu Sep 21 09:24:34 2017  Type: P  Check: 2830  ..

       1  LHGVSFKKRA PRAVKEIKKF AKLHMGTDDV RLAPELNQAI WKRGVKGVEY

      51  RLRLRISRKR NEEEDAKNPL FSYVEPVLVA SAKGLQTVVV EEDA*MAGLK

     101  DVVTREYTIN LHKR

Protein Sequence for YDL075W_K11 from Stanford:

YDL075W_K11 [source=Stanford]  Length: 114  Thu Sep 21 09:24:34 2017  Type: P  Check: 2830  ..

       1  LHGVSFKKRA PRAVKEIKKF AKLHMGTDDV RLAPELNQAI WKRGVKGVEY

      51  RLRLRISRKR NEEEDAKNPL FSYVEPVLVA SAKGLQTVVV EEDA*MAGLK

     101  DVVTREYTIN LHKR

Protein Sequence for YDL075W_Kyokai7 from NRIB:

YDL075W_Kyokai7 [source=NRIB]  Length: 114  Thu Sep 21 09:24:34 2017  Type: P  Check: 9296  ..

       1  MAGLKDVVTR EYTINLHKRL HGVSFKKRAP RAVKEIKKFA KLHMGTDDVR

      51  LAPELNQAIW KRGVKGVEYR LRLRISRKRN EEEDAKNPLF SYVEPVLVAS

     101  AKGLQTVVVE EDA*

Protein Sequence for YDL075W_L1528 from Stanford:

YDL075W_L1528 [source=Stanford]  Length: 114  Thu Sep 21 09:24:34 2017  Type: P  Check: 9296  ..

       1  MAGLKDVVTR EYTINLHKRL HGVSFKKRAP RAVKEIKKFA KLHMGTDDVR

      51  LAPELNQAIW KRGVKGVEYR LRLRISRKRN EEEDAKNPLF SYVEPVLVAS

     101  AKGLQTVVVE EDA*

Protein Sequence for YDL075W_LalvinQA23 from AWRI:

YDL075W_LalvinQA23 [source=AWRI]  Length: 114  Thu Sep 21 09:24:34 2017  Type: P  Check: 9296  ..

       1  MAGLKDVVTR EYTINLHKRL HGVSFKKRAP RAVKEIKKFA KLHMGTDDVR

      51  LAPELNQAIW KRGVKGVEYR LRLRISRKRN EEEDAKNPLF SYVEPVLVAS

     101  AKGLQTVVVE EDA*

Protein Sequence for YDL075W_RM11-1a from Stanford:

YDL075W_RM11-1a [source=Stanford]  Length: 114  Thu Sep 21 09:24:34 2017  Type: P  Check: 9296  ..

       1  MAGLKDVVTR EYTINLHKRL HGVSFKKRAP RAVKEIKKFA KLHMGTDDVR

      51  LAPELNQAIW KRGVKGVEYR LRLRISRKRN EEEDAKNPLF SYVEPVLVAS

     101  AKGLQTVVVE EDA*

Protein Sequence for YDL075W_RedStar from Stanford:

YDL075W_RedStar [source=Stanford]  Length: 114  Thu Sep 21 09:24:34 2017  Type: P  Check: 9296  ..

       1  MAGLKDVVTR EYTINLHKRL HGVSFKKRAP RAVKEIKKFA KLHMGTDDVR

      51  LAPELNQAIW KRGVKGVEYR LRLRISRKRN EEEDAKNPLF SYVEPVLVAS

     101  AKGLQTVVVE EDA*

Protein Sequence for YDL075W_SEY6210 from Stanford:

YDL075W_SEY6210 [source=Stanford]  Length: 114  Thu Sep 21 09:24:34 2017  Type: P  Check: 9296  ..

       1  MAGLKDVVTR EYTINLHKRL HGVSFKKRAP RAVKEIKKFA KLHMGTDDVR

      51  LAPELNQAIW KRGVKGVEYR LRLRISRKRN EEEDAKNPLF SYVEPVLVAS

     101  AKGLQTVVVE EDA*

Protein Sequence for YDL075W_SK1 from Stanford:

YDL075W_SK1 [source=Stanford]  Length: 114  Thu Sep 21 09:24:34 2017  Type: P  Check: 9296  ..

       1  MAGLKDVVTR EYTINLHKRL HGVSFKKRAP RAVKEIKKFA KLHMGTDDVR

      51  LAPELNQAIW KRGVKGVEYR LRLRISRKRN EEEDAKNPLF SYVEPVLVAS

     101  AKGLQTVVVE EDA*

Protein Sequence for YDL075W_T7 from WashU:

YDL075W_T7 [source=WashU]  Length: 114  Thu Sep 21 09:24:34 2017  Type: P  Check: 9296  ..

       1  MAGLKDVVTR EYTINLHKRL HGVSFKKRAP RAVKEIKKFA KLHMGTDDVR

      51  LAPELNQAIW KRGVKGVEYR LRLRISRKRN EEEDAKNPLF SYVEPVLVAS

     101  AKGLQTVVVE EDA*

Protein Sequence for YDL075W_UC5 from WashU:

YDL075W_UC5 [source=WashU]  Length: 114  Thu Sep 21 09:24:34 2017  Type: P  Check: 9296  ..

       1  MAGLKDVVTR EYTINLHKRL HGVSFKKRAP RAVKEIKKFA KLHMGTDDVR

      51  LAPELNQAIW KRGVKGVEYR LRLRISRKRN EEEDAKNPLF SYVEPVLVAS

     101  AKGLQTVVVE EDA*

Protein Sequence for YDL075W_VL3 from AWRI:

YDL075W_VL3 [source=AWRI]  Length: 114  Thu Sep 21 09:24:34 2017  Type: P  Check: 9296  ..

       1  MAGLKDVVTR EYTINLHKRL HGVSFKKRAP RAVKEIKKFA KLHMGTDDVR

      51  LAPELNQAIW KRGVKGVEYR LRLRISRKRN EEEDAKNPLF SYVEPVLVAS

     101  AKGLQTVVVE EDA*

Protein Sequence for YDL075W_Vin13 from AWRI:

YDL075W_Vin13 [source=AWRI]  Length: 114  Thu Sep 21 09:24:34 2017  Type: P  Check: 9296  ..

       1  MAGLKDVVTR EYTINLHKRL HGVSFKKRAP RAVKEIKKFA KLHMGTDDVR

      51  LAPELNQAIW KRGVKGVEYR LRLRISRKRN EEEDAKNPLF SYVEPVLVAS

     101  AKGLQTVVVE EDA*

Protein Sequence for YDL075W_W303 from Stanford:

YDL075W_W303 [source=Stanford]  Length: 114  Thu Sep 21 09:24:34 2017  Type: P  Check: 9296  ..

       1  MAGLKDVVTR EYTINLHKRL HGVSFKKRAP RAVKEIKKFA KLHMGTDDVR

      51  LAPELNQAIW KRGVKGVEYR LRLRISRKRN EEEDAKNPLF SYVEPVLVAS

     101  AKGLQTVVVE EDA*

Protein Sequence for YDL075W_X2180-1A from Stanford:

YDL075W_X2180-1A [source=Stanford]  Length: 114  Thu Sep 21 09:24:34 2017  Type: P  Check: 9296  ..

       1  MAGLKDVVTR EYTINLHKRL HGVSFKKRAP RAVKEIKKFA KLHMGTDDVR

      51  LAPELNQAIW KRGVKGVEYR LRLRISRKRN EEEDAKNPLF SYVEPVLVAS

     101  AKGLQTVVVE EDA*

Protein Sequence for YDL075W_Y55 from Stanford:

YDL075W_Y55 [source=Stanford]  Length: 114  Thu Sep 21 09:24:34 2017  Type: P  Check: 9296  ..

       1  MAGLKDVVTR EYTINLHKRL HGVSFKKRAP RAVKEIKKFA KLHMGTDDVR

      51  LAPELNQAIW KRGVKGVEYR LRLRISRKRN EEEDAKNPLF SYVEPVLVAS

     101  AKGLQTVVVE EDA*

Protein Sequence for YDL075W_YJM269 from WashU:

YDL075W_YJM269 [source=WashU]  Length: 114  Thu Sep 21 09:24:34 2017  Type: P  Check: 9296  ..

       1  MAGLKDVVTR EYTINLHKRL HGVSFKKRAP RAVKEIKKFA KLHMGTDDVR

      51  LAPELNQAIW KRGVKGVEYR LRLRISRKRN EEEDAKNPLF SYVEPVLVAS

     101  AKGLQTVVVE EDA*

Protein Sequence for YDL075W_YJM339 from Stanford:

YDL075W_YJM339 [source=Stanford]  Length: 114  Thu Sep 21 09:24:34 2017  Type: P  Check: 9296  ..

       1  MAGLKDVVTR EYTINLHKRL HGVSFKKRAP RAVKEIKKFA KLHMGTDDVR

      51  LAPELNQAIW KRGVKGVEYR LRLRISRKRN EEEDAKNPLF SYVEPVLVAS

     101  AKGLQTVVVE EDA*

Protein Sequence for YDL075W_YJM789 from Stanford:

YDL075W_YJM789 [source=Stanford]  Length: 114  Thu Sep 21 09:24:34 2017  Type: P  Check: 9296  ..

       1  MAGLKDVVTR EYTINLHKRL HGVSFKKRAP RAVKEIKKFA KLHMGTDDVR

      51  LAPELNQAIW KRGVKGVEYR LRLRISRKRN EEEDAKNPLF SYVEPVLVAS

     101  AKGLQTVVVE EDA*

Protein Sequence for YDL075W_YPH499 from Stanford:

YDL075W_YPH499 [source=Stanford]  Length: 114  Thu Sep 21 09:24:34 2017  Type: P  Check: 2830  ..

       1  LHGVSFKKRA PRAVKEIKKF AKLHMGTDDV RLAPELNQAI WKRGVKGVEY

      51  RLRLRISRKR NEEEDAKNPL FSYVEPVLVA SAKGLQTVVV EEDA*MAGLK

     101  DVVTREYTIN LHKR

Protein Sequence for YDL075W_YPS128 from Stanford:

YDL075W_YPS128 [source=Stanford]  Length: 114  Thu Sep 21 09:24:34 2017  Type: P  Check: 9296  ..

       1  MAGLKDVVTR EYTINLHKRL HGVSFKKRAP RAVKEIKKFA KLHMGTDDVR

      51  LAPELNQAIW KRGVKGVEYR LRLRISRKRN EEEDAKNPLF SYVEPVLVAS

     101  AKGLQTVVVE EDA*

Protein Sequence for YDL075W_YS9 from Stanford:

YDL075W_YS9 [source=Stanford]  Length: 114  Thu Sep 21 09:24:34 2017  Type: P  Check: 2830  ..

       1  LHGVSFKKRA PRAVKEIKKF AKLHMGTDDV RLAPELNQAI WKRGVKGVEY

      51  RLRLRISRKR NEEEDAKNPL FSYVEPVLVA SAKGLQTVVV EEDA*MAGLK

     101  DVVTREYTIN LHKR

Protein Sequence for YDL075W_ZTW1 from Zhejiang:

YDL075W_ZTW1 [source=Zhejiang]  Length: 114  Thu Sep 21 09:24:34 2017  Type: P  Check: 9296  ..

       1  MAGLKDVVTR EYTINLHKRL HGVSFKKRAP RAVKEIKKFA KLHMGTDDVR

      51  LAPELNQAIW KRGVKGVEYR LRLRISRKRN EEEDAKNPLF SYVEPVLVAS

     101  AKGLQTVVVE EDA*