KRR1/YCL059C S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YCL059C_S288C   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_AWRI1631   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_AWRI796   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_BC187   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_BY4741   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_BY4742   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_CEN.PK   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_CLIB215   1   -----------------------------------------MTLFPKYRE   9
YCL059C_CLIB382   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_D273-10B   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_DBVPG6044   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_EC1118   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_FL100   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_FY1679   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_FostersB   
   --------------------------------------------------   
YCL059C_FostersO   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_JAY291   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_JK9-3d   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_K11   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_Kyokai7   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_L1528   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_LalvinQA23   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_PW5   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_RM11-1a   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_RedStar   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_SEY6210   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_SK1   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_T7   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_T73   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_UC5   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_UWOPS05_217_3   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_VL3   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_Vin13   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_W303   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_X2180-1A   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_Y55   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_YJM269   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_YJM339   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_YJM789   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_YPH499   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_YPS128   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_YPS163   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_YS9   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
YCL059C_ZTW1   1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRE   50
         

YCL059C_S288C   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_AWRI1631   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_AWRI796   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_BC187   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_BY4741   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_BY4742   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_CEN.PK   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_CLIB215   10   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   59
YCL059C_CLIB382   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_D273-10B   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_DBVPG6044   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_EC1118   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_FL100   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_FY1679   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_FostersB   
   --------------------------------------------------   
YCL059C_FostersO   51   SYLKTIWNDVTRALDKHNIXCXLDLVEGSMTVKTTRKNIRSRYHFESQRF   100
YCL059C_JAY291   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_JK9-3d   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_K11   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_Kyokai7   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_L1528   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_LalvinQA23   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_PW5   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_RM11-1a   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_RedStar   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_SEY6210   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_SK1   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_T7   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_T73   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_UC5   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_UWOPS05_217_3   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_VL3   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_Vin13   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_W303   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_X2180-1A   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_Y55   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_YJM269   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_YJM339   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_YJM789   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_YPH499   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_YPS128   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_YPS163   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_YS9   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
YCL059C_ZTW1   51   SYLKTIWNDVTRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDL   100
         

YCL059C_S288C   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_AWRI1631   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_AWRI796   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_BC187   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_BY4741   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_BY4742   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_CEN.PK   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_CLIB215   60   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   109
YCL059C_CLIB382   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_D273-10B   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_DBVPG6044   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_EC1118   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_FL100   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_FY1679   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_FostersB   1   --------------------MACDVXKIGNFVTNKERFVKRRQRLVGPNG   30
YCL059C_FostersO   101   DQIIGEIRSFPASR------------------------------------   114
YCL059C_JAY291   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_JK9-3d   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_K11   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_Kyokai7   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_L1528   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_LalvinQA23   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_PW5   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_RM11-1a   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_RedStar   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_SEY6210   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_SK1   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_T7   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_T73   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_UC5   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_UWOPS05_217_3   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_VL3   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_Vin13   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_W303   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_X2180-1A   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_Y55   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_YJM269   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_YJM339   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_YJM789   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_YPH499   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_YPS128   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_YPS163   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_YS9   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
YCL059C_ZTW1   101   IKLLARSVPFPQAVKILQDDMACDVIKIGNFVTNKERFVKRRQRLVGPNG   150
         

YCL059C_S288C   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
YCL059C_AWRI1631   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
YCL059C_AWRI796   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKKYSPLSII   200
YCL059C_BC187   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
YCL059C_BY4741   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
YCL059C_BY4742   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
YCL059C_CEN.PK   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
YCL059C_CLIB215   110   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   159
YCL059C_CLIB382   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
YCL059C_D273-10B   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
YCL059C_DBVPG6044   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
YCL059C_EC1118   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
YCL059C_FL100   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
YCL059C_FY1679   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
YCL059C_FostersB   31   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   80
YCL059C_FostersO   
   --------------------------------------------------   
YCL059C_JAY291   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEARRVVEDCMKNIHPIYHI   200
YCL059C_JK9-3d   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
YCL059C_K11   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
YCL059C_Kyokai7   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
YCL059C_L1528   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
YCL059C_LalvinQA23   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
YCL059C_PW5   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
YCL059C_RM11-1a   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
YCL059C_RedStar   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
YCL059C_SEY6210   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
YCL059C_SK1   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
YCL059C_T7   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
YCL059C_T73   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
YCL059C_UC5   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
YCL059C_UWOPS05_217_3   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
YCL059C_VL3   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
YCL059C_Vin13   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
YCL059C_W303   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
YCL059C_X2180-1A   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
YCL059C_Y55   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
YCL059C_YJM269   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
YCL059C_YJM339   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
YCL059C_YJM789   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
YCL059C_YPH499   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
YCL059C_YPS128   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
YCL059C_YPS163   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
YCL059C_YS9   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
YCL059C_ZTW1   151   NTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNIHPIYHI   200
         

YCL059C_S288C   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
YCL059C_AWRI1631   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
YCL059C_AWRI796   201   SRN-----------------------------------------------   203
YCL059C_BC187   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
YCL059C_BY4741   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
YCL059C_BY4742   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
YCL059C_CEN.PK   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
YCL059C_CLIB215   160   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   209
YCL059C_CLIB382   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
YCL059C_D273-10B   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
YCL059C_DBVPG6044   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
YCL059C_EC1118   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
YCL059C_FL100   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
YCL059C_FY1679   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
YCL059C_FostersB   81   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   130
YCL059C_FostersO   
   --------------------------------------------------   
YCL059C_JAY291   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
YCL059C_JK9-3d   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
YCL059C_K11   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
YCL059C_Kyokai7   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
YCL059C_L1528   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
YCL059C_LalvinQA23   201   KELMIKRELAKXARVSQ---------------------------------   217
YCL059C_PW5   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
YCL059C_RM11-1a   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
YCL059C_RedStar   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
YCL059C_SEY6210   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
YCL059C_SK1   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
YCL059C_T7   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
YCL059C_T73   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
YCL059C_UC5   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
YCL059C_UWOPS05_217_3   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
YCL059C_VL3   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
YCL059C_Vin13   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
YCL059C_W303   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
YCL059C_X2180-1A   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
YCL059C_Y55   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
YCL059C_YJM269   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
YCL059C_YJM339   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
YCL059C_YJM789   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
YCL059C_YPH499   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
YCL059C_YPS128   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
YCL059C_YPS163   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
YCL059C_YS9   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
YCL059C_ZTW1   201   KELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKIRNVEKKVYTP   250
         

YCL059C_S288C   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
YCL059C_AWRI1631   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
YCL059C_AWRI796   
   --------------------------------------------------   
YCL059C_BC187   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
YCL059C_BY4741   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
YCL059C_BY4742   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
YCL059C_CEN.PK   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
YCL059C_CLIB215   210   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   259
YCL059C_CLIB382   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
YCL059C_D273-10B   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
YCL059C_DBVPG6044   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
YCL059C_EC1118   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
YCL059C_FL100   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
YCL059C_FY1679   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
YCL059C_FostersB   131   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   180
YCL059C_FostersO   
   --------------------------------------------------   
YCL059C_JAY291   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
YCL059C_JK9-3d   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
YCL059C_K11   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
YCL059C_Kyokai7   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
YCL059C_L1528   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
YCL059C_LalvinQA23   
   --------------------------------------------------   
YCL059C_PW5   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
YCL059C_RM11-1a   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
YCL059C_RedStar   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
YCL059C_SEY6210   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
YCL059C_SK1   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
YCL059C_T7   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
YCL059C_T73   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
YCL059C_UC5   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
YCL059C_UWOPS05_217_3   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
YCL059C_VL3   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
YCL059C_Vin13   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
YCL059C_W303   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
YCL059C_X2180-1A   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
YCL059C_Y55   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
YCL059C_YJM269   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
YCL059C_YJM339   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
YCL059C_YJM789   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
YCL059C_YPH499   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
YCL059C_YPS128   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
YCL059C_YPS163   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
YCL059C_YS9   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
YCL059C_ZTW1   251   FPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA   300
         

YCL059C_S288C   301   KDFIAPEEEAYKPNQN   316
YCL059C_AWRI1631   301   KDFIAPEEEAYKPNQN   316
YCL059C_AWRI796   
   ----------------   
YCL059C_BC187   301   KDFIAPEEEAYKPNQN   316
YCL059C_BY4741   301   KDFIAPEEEAYKPNQN   316
YCL059C_BY4742   301   KDFIAPEEEAYKPNQN   316
YCL059C_CEN.PK   301   KDFVAPEEEAYKPNQN   316
YCL059C_CLIB215   260   KDFIAPEEEAYKPNQN   275
YCL059C_CLIB382   301   KDFIAPEEEAYKPNQN   316
YCL059C_D273-10B   301   KDFIAPEEEAYKPNQN   316
YCL059C_DBVPG6044   301   KDFIAPEEEAYKPNQN   316
YCL059C_EC1118   301   KDFIAPEEEAYKPNQN   316
YCL059C_FL100   301   KDFVAPEEEAYKPNQN   316
YCL059C_FY1679   301   KDFIAPEEEAYKPNQN   316
YCL059C_FostersB   181   KDFIAPEEEAYKPNQN   196
YCL059C_FostersO   
   ----------------   
YCL059C_JAY291   301   KDFIAPEEEAYKPNQN   316
YCL059C_JK9-3d   301   KDFIAPEEEAYKPNQN   316
YCL059C_K11   301   KDFVAPEEEAYKPNQN   316
YCL059C_Kyokai7   301   KDFIAPEEEAYKPN--   314
YCL059C_L1528   301   KDFIAPEEEAYKPNQN   316
YCL059C_LalvinQA23   
   ----------------   
YCL059C_PW5   301   KDFIAPEEEAYKPNQN   316
YCL059C_RM11-1a   301   KDFIAPEEEAYKPNQN   316
YCL059C_RedStar   301   KDFIAPEEEAYKPNQN   316
YCL059C_SEY6210   301   KDFVAPEEEAYKPNQN   316
YCL059C_SK1   301   KDFIAPEEEAYKPNQN   316
YCL059C_T7   301   KDFIAPEEEAYKPNQN   316
YCL059C_T73   301   KDFIAPEEEAYKPNQN   316
YCL059C_UC5   301   KDFVAPEEEAYKPNQN   316
YCL059C_UWOPS05_217_3   301   KDFIAPEEEAYKPNQN   316
YCL059C_VL3   301   KDFIAPEEEAYKPNQN   316
YCL059C_Vin13   301   KDFIAPEEEAYKPNQN   316
YCL059C_W303   301   KDFIAPEEEAYKPNQN   316
YCL059C_X2180-1A   301   KDFIAPEEEAYKPNQN   316
YCL059C_Y55   301   KDFIAPEEEAYKPNQN   316
YCL059C_YJM269   301   KDFIAPEEEAYKPNQN   316
YCL059C_YJM339   301   KDFIAPEEEAYKPNQN   316
YCL059C_YJM789   301   KDFIAPEEEAYKPNQN   316
YCL059C_YPH499   301   KDFVAPEEEAYKPNQN   316
YCL059C_YPS128   301   KDFIAPEEEAYKPNQN   316
YCL059C_YPS163   301   KDFIAPEEEAYKPNQN   316
YCL059C_YS9   301   KDFIAPEEEAYKPNQN   316
YCL059C_ZTW1   301   KDFIAPEEEAYKPNQN   316
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YCL059C_S288C from SGD:

YCL059C_S288C [source=SGD]  Length: 317  Thu Dec 14 09:06:38 2017  Type: P  Check: 214  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFIAPEEEA YKPNQN*

Protein Sequence for YCL059C_AWRI1631 from AWRI:

YCL059C_AWRI1631 [source=AWRI]  Length: 317  Thu Dec 14 09:06:38 2017  Type: P  Check: 214  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFIAPEEEA YKPNQN*

Protein Sequence for YCL059C_AWRI796 from AWRI:

YCL059C_AWRI796 [source=AWRI]  Length: 204  Thu Dec 14 09:06:38 2017  Type: P  Check: 3486  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKKYSPLSII

     201  SRN*

Protein Sequence for YCL059C_BC187 from Stanford:

YCL059C_BC187 [source=Stanford]  Length: 317  Thu Dec 14 09:06:38 2017  Type: P  Check: 214  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFIAPEEEA YKPNQN*

Protein Sequence for YCL059C_BY4741 from Stanford:

YCL059C_BY4741 [source=Stanford]  Length: 317  Thu Dec 14 09:06:38 2017  Type: P  Check: 214  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFIAPEEEA YKPNQN*

Protein Sequence for YCL059C_BY4742 from Stanford:

YCL059C_BY4742 [source=Stanford]  Length: 317  Thu Dec 14 09:06:38 2017  Type: P  Check: 214  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFIAPEEEA YKPNQN*

Protein Sequence for YCL059C_CEN.PK from Stanford:

YCL059C_CEN.PK [source=Stanford]  Length: 317  Thu Dec 14 09:06:38 2017  Type: P  Check: 461  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFVAPEEEA YKPNQN*

Protein Sequence for YCL059C_CLIB215 from WashU:

YCL059C_CLIB215 [source=WashU]  Length: 276  Thu Dec 14 09:06:38 2017  Type: P  Check: 1643  ..

       1  MTLFPKYRES YLKTIWNDVT RALDKHNIAC VLDLVEGSMT VKTTRKTYDP

      51  AIILKARDLI KLLARSVPFP QAVKILQDDM ACDVIKIGNF VTNKERFVKR

     101  RQRLVGPNGN TLKALELLTK CYILVQGNTV SAMGPFKGLK EVRRVVEDCM

     151  KNIHPIYHIK ELMIKRELAK RPELANEDWS RFLPMFKKRN VARKKPKKIR

     201  NVEKKVYTPF PPAQLPRKVD LEIESGEYFL SKREKQMKKL NEQKEKQMER

     251  EIERQEERAK DFIAPEEEAY KPNQN*

Protein Sequence for YCL059C_CLIB382 from WashU:

YCL059C_CLIB382 [source=WashU]  Length: 317  Thu Dec 14 09:06:38 2017  Type: P  Check: 214  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFIAPEEEA YKPNQN*

Protein Sequence for YCL059C_D273-10B from Stanford:

YCL059C_D273-10B [source=Stanford]  Length: 317  Thu Dec 14 09:06:38 2017  Type: P  Check: 214  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFIAPEEEA YKPNQN*

Protein Sequence for YCL059C_DBVPG6044 from Stanford:

YCL059C_DBVPG6044 [source=Stanford]  Length: 317  Thu Dec 14 09:06:38 2017  Type: P  Check: 214  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFIAPEEEA YKPNQN*

Protein Sequence for YCL059C_EC1118 from Genoscope:

YCL059C_EC1118 [source=Genoscope]  Length: 317  Thu Dec 14 09:06:38 2017  Type: P  Check: 214  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFIAPEEEA YKPNQN*

Protein Sequence for YCL059C_FL100 from Stanford:

YCL059C_FL100 [source=Stanford]  Length: 317  Thu Dec 14 09:06:38 2017  Type: P  Check: 461  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFVAPEEEA YKPNQN*

Protein Sequence for YCL059C_FY1679 from Stanford:

YCL059C_FY1679 [source=Stanford]  Length: 317  Thu Dec 14 09:06:38 2017  Type: P  Check: 214  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFIAPEEEA YKPNQN*

Protein Sequence for YCL059C_FostersB from AWRI:

YCL059C_FostersB [source=AWRI]  Length: 197  Thu Dec 14 09:06:38 2017  Type: P  Check: 4111  ..

       1  MACDVXKIGN FVTNKERFVK RRQRLVGPNG NTLKALELLT KCYILVQGNT

      51  VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI KELMIKRELA KRPELANEDW

     101  SRFLPMFKKR NVARKKPKKI RNVEKKVYTP FPPAQLPRKV DLEIESGEYF

     151  LSKREKQMKK LNEQKEKQME REIERQEERA KDFIAPEEEA YKPNQN*


Protein Sequence for YCL059C_FostersO from AWRI:

YCL059C_FostersO [source=AWRI]  Length: 115  Thu Dec 14 09:06:38 2017  Type: P  Check: 3625  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIX CXLDLVEGSM TVKTTRKNIR SRYHFESQRF

     101  DQIIGEIRSF PASR*

Protein Sequence for YCL059C_JAY291 from Duke:

YCL059C_JAY291 [source=Duke]  Length: 317  Thu Dec 14 09:06:38 2017  Type: P  Check: 9962  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEARRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFIAPEEEA YKPNQN*

Protein Sequence for YCL059C_JK9-3d from Stanford:

YCL059C_JK9-3d [source=Stanford]  Length: 317  Thu Dec 14 09:06:38 2017  Type: P  Check: 214  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFIAPEEEA YKPNQN*

Protein Sequence for YCL059C_K11 from Stanford:

YCL059C_K11 [source=Stanford]  Length: 317  Thu Dec 14 09:06:38 2017  Type: P  Check: 461  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFVAPEEEA YKPNQN*

Protein Sequence for YCL059C_Kyokai7 from NRIB:

YCL059C_Kyokai7 [source=NRIB]  Length: 315  Thu Dec 14 09:06:38 2017  Type: P  Check: 5282  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFIAPEEEA YKPN*

Protein Sequence for YCL059C_L1528 from Stanford:

YCL059C_L1528 [source=Stanford]  Length: 317  Thu Dec 14 09:06:38 2017  Type: P  Check: 214  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFIAPEEEA YKPNQN*

Protein Sequence for YCL059C_LalvinQA23 from AWRI:

YCL059C_LalvinQA23 [source=AWRI]  Length: 218  Thu Dec 14 09:06:38 2017  Type: P  Check: 5542  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KXARVSQ*

Protein Sequence for YCL059C_PW5 from WashU:

YCL059C_PW5 [source=WashU]  Length: 317  Thu Dec 14 09:06:38 2017  Type: P  Check: 214  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFIAPEEEA YKPNQN*

Protein Sequence for YCL059C_RM11-1a from Stanford:

YCL059C_RM11-1a [source=Stanford]  Length: 317  Thu Dec 14 09:06:38 2017  Type: P  Check: 214  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFIAPEEEA YKPNQN*

Protein Sequence for YCL059C_RedStar from Stanford:

YCL059C_RedStar [source=Stanford]  Length: 317  Thu Dec 14 09:06:38 2017  Type: P  Check: 214  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFIAPEEEA YKPNQN*

Protein Sequence for YCL059C_SEY6210 from Stanford:

YCL059C_SEY6210 [source=Stanford]  Length: 317  Thu Dec 14 09:06:38 2017  Type: P  Check: 461  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFVAPEEEA YKPNQN*

Protein Sequence for YCL059C_SK1 from Stanford:

YCL059C_SK1 [source=Stanford]  Length: 317  Thu Dec 14 09:06:38 2017  Type: P  Check: 214  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFIAPEEEA YKPNQN*

Protein Sequence for YCL059C_T7 from WashU:

YCL059C_T7 [source=WashU]  Length: 317  Thu Dec 14 09:06:38 2017  Type: P  Check: 214  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFIAPEEEA YKPNQN*

Protein Sequence for YCL059C_T73 from WashU:

YCL059C_T73 [source=WashU]  Length: 317  Thu Dec 14 09:06:38 2017  Type: P  Check: 214  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFIAPEEEA YKPNQN*

Protein Sequence for YCL059C_UC5 from WashU:

YCL059C_UC5 [source=WashU]  Length: 317  Thu Dec 14 09:06:38 2017  Type: P  Check: 461  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFVAPEEEA YKPNQN*

Protein Sequence for YCL059C_UWOPS05_217_3 from Stanford:

YCL059C_UWOPS05_217_3 [source=Stanford]  Length: 317  Thu Dec 14 09:06:38 2017  Type: P  Check: 214  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFIAPEEEA YKPNQN*

Protein Sequence for YCL059C_VL3 from AWRI:

YCL059C_VL3 [source=AWRI]  Length: 317  Thu Dec 14 09:06:38 2017  Type: P  Check: 214  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFIAPEEEA YKPNQN*

Protein Sequence for YCL059C_Vin13 from AWRI:

YCL059C_Vin13 [source=AWRI]  Length: 317  Thu Dec 14 09:06:38 2017  Type: P  Check: 214  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFIAPEEEA YKPNQN*

Protein Sequence for YCL059C_W303 from Stanford:

YCL059C_W303 [source=Stanford]  Length: 317  Thu Dec 14 09:06:38 2017  Type: P  Check: 214  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFIAPEEEA YKPNQN*

Protein Sequence for YCL059C_X2180-1A from Stanford:

YCL059C_X2180-1A [source=Stanford]  Length: 317  Thu Dec 14 09:06:38 2017  Type: P  Check: 214  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFIAPEEEA YKPNQN*

Protein Sequence for YCL059C_Y55 from Stanford:

YCL059C_Y55 [source=Stanford]  Length: 317  Thu Dec 14 09:06:38 2017  Type: P  Check: 214  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFIAPEEEA YKPNQN*

Protein Sequence for YCL059C_YJM269 from WashU:

YCL059C_YJM269 [source=WashU]  Length: 317  Thu Dec 14 09:06:38 2017  Type: P  Check: 214  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFIAPEEEA YKPNQN*

Protein Sequence for YCL059C_YJM339 from Stanford:

YCL059C_YJM339 [source=Stanford]  Length: 317  Thu Dec 14 09:06:38 2017  Type: P  Check: 214  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFIAPEEEA YKPNQN*

Protein Sequence for YCL059C_YJM789 from Stanford:

YCL059C_YJM789 [source=Stanford]  Length: 317  Thu Dec 14 09:06:38 2017  Type: P  Check: 214  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFIAPEEEA YKPNQN*

Protein Sequence for YCL059C_YPH499 from Stanford:

YCL059C_YPH499 [source=Stanford]  Length: 317  Thu Dec 14 09:06:38 2017  Type: P  Check: 461  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFVAPEEEA YKPNQN*

Protein Sequence for YCL059C_YPS128 from Stanford:

YCL059C_YPS128 [source=Stanford]  Length: 317  Thu Dec 14 09:06:38 2017  Type: P  Check: 214  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFIAPEEEA YKPNQN*

Protein Sequence for YCL059C_YPS163 from Stanford:

YCL059C_YPS163 [source=Stanford]  Length: 317  Thu Dec 14 09:06:38 2017  Type: P  Check: 214  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFIAPEEEA YKPNQN*

Protein Sequence for YCL059C_YS9 from Stanford:

YCL059C_YS9 [source=Stanford]  Length: 317  Thu Dec 14 09:06:38 2017  Type: P  Check: 214  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFIAPEEEA YKPNQN*

Protein Sequence for YCL059C_ZTW1 from Zhejiang:

YCL059C_ZTW1 [source=Zhejiang]  Length: 317  Thu Dec 14 09:06:38 2017  Type: P  Check: 214  ..

       1  MVSTHNRDKP WDTDDIDKWK IEEFKEEDNA SGQPFAEESS FMTLFPKYRE

      51  SYLKTIWNDV TRALDKHNIA CVLDLVEGSM TVKTTRKTYD PAIILKARDL

     101  IKLLARSVPF PQAVKILQDD MACDVIKIGN FVTNKERFVK RRQRLVGPNG

     151  NTLKALELLT KCYILVQGNT VSAMGPFKGL KEVRRVVEDC MKNIHPIYHI

     201  KELMIKRELA KRPELANEDW SRFLPMFKKR NVARKKPKKI RNVEKKVYTP

     251  FPPAQLPRKV DLEIESGEYF LSKREKQMKK LNEQKEKQME REIERQEERA

     301  KDFIAPEEEA YKPNQN*