PDI1/YCL043C S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YCL043C_S288C   1   MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHD   50
YCL043C_AWRI1631   
   --------------------------------------------------   
YCL043C_AWRI796   1   MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHD   50
YCL043C_BC187   1   MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHD   50
YCL043C_BY4741   1   MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHD   50
YCL043C_BY4742   1   MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHD   50
YCL043C_CBS7960   1   MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHD   50
YCL043C_CEN.PK   1   MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHD   50
YCL043C_CLIB215   1   MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHD   50
YCL043C_CLIB324   1   MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHD   50
YCL043C_D273-10B   1   MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHD   50
YCL043C_DBVPG6044   1   MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHD   50
YCL043C_EC1118   1   MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHD   50
YCL043C_EC9-8   1   MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHD   50
YCL043C_FL100   1   MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHD   50
YCL043C_FY1679   1   MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHD   50
YCL043C_FostersB   
   --------------------------------------------------   
YCL043C_FostersO   
   --------------------------------------------------   
YCL043C_JAY291   1   MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHD   50
YCL043C_JK9-3d   1   MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHD   50
YCL043C_K11   
   --------------------------------------------------   
YCL043C_Kyokai7   1   MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHD   50
YCL043C_L1528   1   MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHD   50
YCL043C_LalvinQA23   1   MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHD   50
YCL043C_PW5   1   MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHD   50
YCL043C_RM11-1a   1   MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHD   50
YCL043C_RedStar   1   MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHD   50
YCL043C_SEY6210   1   MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHD   50
YCL043C_SK1   1   MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHD   50
YCL043C_T7   1   MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHD   50
YCL043C_T73   1   MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHD   50
YCL043C_UC5   1   MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHD   50
YCL043C_UWOPS05_217_3   
   --------------------------------------------------   
YCL043C_VL3   1   MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHD   50
YCL043C_Vin13   1   ------------------------------------------MSTFSRTT   8
YCL043C_W303   1   MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHD   50
YCL043C_X2180-1A   1   MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHD   50
YCL043C_Y10   1   MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHD   50
YCL043C_Y55   1   MKFSAGAVLSWSSLLFASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHD   50
YCL043C_YJM269   1   MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHD   50
YCL043C_YJM339   1   MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHD   50
YCL043C_YJM789   1   MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHD   50
YCL043C_YPH499   1   MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHD   50
YCL043C_YPS128   
   --------------------------------------------------   
YCL043C_YPS163   1   MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHD   50
YCL043C_ZTW1   1   MKFSTGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHD   50
         

YCL043C_S288C   51   LVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   100
YCL043C_AWRI1631   1   -----------------------------------------------MEH   3
YCL043C_AWRI796   51   LVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   100
YCL043C_BC187   51   LVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   100
YCL043C_BY4741   51   LVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   100
YCL043C_BY4742   51   LVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   100
YCL043C_CBS7960   51   LVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   100
YCL043C_CEN.PK   51   LVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   100
YCL043C_CLIB215   51   LVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   100
YCL043C_CLIB324   51   LVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   100
YCL043C_D273-10B   51   LVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   100
YCL043C_DBVPG6044   51   LVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   100
YCL043C_EC1118   51   LVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   100
YCL043C_EC9-8   51   LVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   100
YCL043C_FL100   51   LVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   100
YCL043C_FY1679   51   LVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   100
YCL043C_FostersB   
   --------------------------------------------------   
YCL043C_FostersO   
   --------------------------------------------------   
YCL043C_JAY291   51   LVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   100
YCL043C_JK9-3d   51   LVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   100
YCL043C_K11   1   ----------------MAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   34
YCL043C_Kyokai7   51   LVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   100
YCL043C_L1528   51   LVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   100
YCL043C_LalvinQA23   51   LVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   100
YCL043C_PW5   51   LVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   100
YCL043C_RM11-1a   51   LVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   100
YCL043C_RedStar   51   LVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   100
YCL043C_SEY6210   51   LVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   100
YCL043C_SK1   51   LVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   100
YCL043C_T7   51   LVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   100
YCL043C_T73   51   LVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   100
YCL043C_UC5   51   LVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   100
YCL043C_UWOPS05_217_3   1   ----------------MAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   34
YCL043C_VL3   51   LVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   100
YCL043C_Vin13   9   WCLRSFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   58
YCL043C_W303   51   LVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   100
YCL043C_X2180-1A   51   LVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   100
YCL043C_Y10   51   LVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   100
YCL043C_Y55   51   LVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   100
YCL043C_YJM269   51   LVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   100
YCL043C_YJM339   51   LVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   100
YCL043C_YJM789   51   LVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   100
YCL043C_YPH499   51   LVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   100
YCL043C_YPS128   1   ----------------MAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   34
YCL043C_YPS163   51   LVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   100
YCL043C_ZTW1   51   LVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEH   100
         

YCL043C_S288C   101   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLP   150
YCL043C_AWRI1631   4   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLP   53
YCL043C_AWRI796   101   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVAADLP   150
YCL043C_BC187   101   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLP   150
YCL043C_BY4741   101   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLP   150
YCL043C_BY4742   101   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLP   150
YCL043C_CBS7960   101   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLP   150
YCL043C_CEN.PK   101   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLP   150
YCL043C_CLIB215   101   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVAADLP   150
YCL043C_CLIB324   101   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLP   150
YCL043C_D273-10B   101   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLP   150
YCL043C_DBVPG6044   101   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLP   150
YCL043C_EC1118   101   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVAADLP   150
YCL043C_EC9-8   101   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLP   150
YCL043C_FL100   101   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLP   150
YCL043C_FY1679   101   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLP   150
YCL043C_FostersB   
   --------------------------------------------------   
YCL043C_FostersO   1   ----------------------------------MIKQSQPAVAVVADLP   16
YCL043C_JAY291   101   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVATDLP   150
YCL043C_JK9-3d   101   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLP   150
YCL043C_K11   35   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLP   84
YCL043C_Kyokai7   101   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLP   150
YCL043C_L1528   101   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVAADLP   150
YCL043C_LalvinQA23   101   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVAADLP   150
YCL043C_PW5   101   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLP   150
YCL043C_RM11-1a   101   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLP   150
YCL043C_RedStar   101   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLP   150
YCL043C_SEY6210   101   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLP   150
YCL043C_SK1   101   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLP   150
YCL043C_T7   101   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLP   150
YCL043C_T73   101   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLP   150
YCL043C_UC5   101   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLP   150
YCL043C_UWOPS05_217_3   35   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLP   84
YCL043C_VL3   101   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVATDLP   150
YCL043C_Vin13   59   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLP   108
YCL043C_W303   101   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLP   150
YCL043C_X2180-1A   101   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLP   150
YCL043C_Y10   101   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLP   150
YCL043C_Y55   101   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVAADLP   150
YCL043C_YJM269   101   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLP   150
YCL043C_YJM339   101   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLP   150
YCL043C_YJM789   101   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVAADLP   150
YCL043C_YPH499   101   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLP   150
YCL043C_YPS128   35   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLP   84
YCL043C_YPS163   101   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLP   150
YCL043C_ZTW1   101   NIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLP   150
         

YCL043C_S288C   151   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   200
YCL043C_AWRI1631   54   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   103
YCL043C_AWRI796   151   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   200
YCL043C_BC187   151   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   200
YCL043C_BY4741   151   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   200
YCL043C_BY4742   151   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   200
YCL043C_CBS7960   151   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   200
YCL043C_CEN.PK   151   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   200
YCL043C_CLIB215   151   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   200
YCL043C_CLIB324   151   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   200
YCL043C_D273-10B   151   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   200
YCL043C_DBVPG6044   151   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   200
YCL043C_EC1118   151   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   200
YCL043C_EC9-8   151   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   200
YCL043C_FL100   151   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   200
YCL043C_FY1679   151   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   200
YCL043C_FostersB   
   --------------------------------------------------   
YCL043C_FostersO   17   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   66
YCL043C_JAY291   151   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   200
YCL043C_JK9-3d   151   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   200
YCL043C_K11   85   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   134
YCL043C_Kyokai7   151   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   200
YCL043C_L1528   151   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   200
YCL043C_LalvinQA23   151   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   200
YCL043C_PW5   151   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   200
YCL043C_RM11-1a   151   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   200
YCL043C_RedStar   151   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   200
YCL043C_SEY6210   151   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   200
YCL043C_SK1   151   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   200
YCL043C_T7   151   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   200
YCL043C_T73   151   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   200
YCL043C_UC5   151   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   200
YCL043C_UWOPS05_217_3   85   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   134
YCL043C_VL3   151   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   200
YCL043C_Vin13   109   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   158
YCL043C_W303   151   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   200
YCL043C_X2180-1A   151   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   200
YCL043C_Y10   151   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   200
YCL043C_Y55   151   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   200
YCL043C_YJM269   151   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   200
YCL043C_YJM339   151   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   200
YCL043C_YJM789   151   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   200
YCL043C_YPH499   151   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   200
YCL043C_YPS128   85   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   134
YCL043C_YPS163   151   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   200
YCL043C_ZTW1   151   AYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAENADDDF   200
         

YCL043C_S288C   201   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   250
YCL043C_AWRI1631   104   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   153
YCL043C_AWRI796   201   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   250
YCL043C_BC187   201   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   250
YCL043C_BY4741   201   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   250
YCL043C_BY4742   201   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   250
YCL043C_CBS7960   201   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   250
YCL043C_CEN.PK   201   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   250
YCL043C_CLIB215   201   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   250
YCL043C_CLIB324   201   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   250
YCL043C_D273-10B   201   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   250
YCL043C_DBVPG6044   201   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   250
YCL043C_EC1118   201   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   250
YCL043C_EC9-8   201   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   250
YCL043C_FL100   201   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   250
YCL043C_FY1679   201   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   250
YCL043C_FostersB   1   ----------------MVRKPISLTLMFLKNGCKWKPCPTLVKSTVPFSP   34
YCL043C_FostersO   67   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   116
YCL043C_JAY291   201   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   250
YCL043C_JK9-3d   201   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   250
YCL043C_K11   135   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   184
YCL043C_Kyokai7   201   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   250
YCL043C_L1528   201   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   250
YCL043C_LalvinQA23   201   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   250
YCL043C_PW5   201   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   250
YCL043C_RM11-1a   201   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   250
YCL043C_RedStar   201   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   250
YCL043C_SEY6210   201   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   250
YCL043C_SK1   201   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   250
YCL043C_T7   201   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   250
YCL043C_T73   201   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   250
YCL043C_UC5   201   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   250
YCL043C_UWOPS05_217_3   135   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   184
YCL043C_VL3   201   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   250
YCL043C_Vin13   159   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   208
YCL043C_W303   201   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   250
YCL043C_X2180-1A   201   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   250
YCL043C_Y10   201   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   250
YCL043C_Y55   201   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   250
YCL043C_YJM269   201   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   250
YCL043C_YJM339   201   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   250
YCL043C_YJM789   201   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   250
YCL043C_YPH499   201   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   250
YCL043C_YPS128   135   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   184
YCL043C_YPS163   201   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   250
YCL043C_ZTW1   201   KLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFA   250
         

YCL043C_S288C   251   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   300
YCL043C_AWRI1631   154   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   203
YCL043C_AWRI796   251   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   300
YCL043C_BC187   251   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   300
YCL043C_BY4741   251   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   300
YCL043C_BY4742   251   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   300
YCL043C_CBS7960   251   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   300
YCL043C_CEN.PK   251   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   300
YCL043C_CLIB215   251   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   300
YCL043C_CLIB324   251   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   300
YCL043C_D273-10B   251   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   300
YCL043C_DBVPG6044   251   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   300
YCL043C_EC1118   251   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   300
YCL043C_EC9-8   251   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   300
YCL043C_FL100   251   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   300
YCL043C_FY1679   251   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   300
YCL043C_FostersB   35   NTSKAVCLWVTCSTMTRKNWKNTNLSLPSWPKKNRGLMNFVSIDARKFGR   84
YCL043C_FostersO   117   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   166
YCL043C_JAY291   251   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   300
YCL043C_JK9-3d   251   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   300
YCL043C_K11   185   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   234
YCL043C_Kyokai7   251   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   300
YCL043C_L1528   251   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   300
YCL043C_LalvinQA23   251   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   300
YCL043C_PW5   251   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   300
YCL043C_RM11-1a   251   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   300
YCL043C_RedStar   251   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   300
YCL043C_SEY6210   251   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   300
YCL043C_SK1   251   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   300
YCL043C_T7   251   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   300
YCL043C_T73   251   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   300
YCL043C_UC5   251   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   300
YCL043C_UWOPS05_217_3   185   QYVESGLPLGYLFYNDEEELEEYKPIFTELAKKNRGLMNFVSIDARKFGR   234
YCL043C_VL3   251   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   300
YCL043C_Vin13   209   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   258
YCL043C_W303   251   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   300
YCL043C_X2180-1A   251   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   300
YCL043C_Y10   251   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   300
YCL043C_Y55   251   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   300
YCL043C_YJM269   251   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   300
YCL043C_YJM339   251   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   300
YCL043C_YJM789   251   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   300
YCL043C_YPH499   251   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   300
YCL043C_YPS128   185   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   234
YCL043C_YPS163   251   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   300
YCL043C_ZTW1   251   QYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR   300
         

YCL043C_S288C   301   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIE   350
YCL043C_AWRI1631   204   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIE   253
YCL043C_AWRI796   301   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEVFDELSDKIVLESKAIE   350
YCL043C_BC187   301   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIE   350
YCL043C_BY4741   301   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIE   350
YCL043C_BY4742   301   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIE   350
YCL043C_CBS7960   301   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIE   350
YCL043C_CEN.PK   301   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIE   350
YCL043C_CLIB215   301   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIE   350
YCL043C_CLIB324   301   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIE   350
YCL043C_D273-10B   301   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIE   350
YCL043C_DBVPG6044   301   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIE   350
YCL043C_EC1118   301   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEVFDELSDKIVLESKAIE   350
YCL043C_EC9-8   301   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIE   350
YCL043C_FL100   301   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIE   350
YCL043C_FY1679   301   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIE   350
YCL043C_FostersB   85   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEXFDELSDKIVLESKAIE   134
YCL043C_FostersO   167   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIE   216
YCL043C_JAY291   301   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIE   350
YCL043C_JK9-3d   301   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIE   350
YCL043C_K11   235   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIE   284
YCL043C_Kyokai7   301   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIE   350
YCL043C_L1528   301   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEVFDELSDKIVLESKAIE   350
YCL043C_LalvinQA23   301   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEVFDELSDKIVLESKAIE   350
YCL043C_PW5   301   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIE   350
YCL043C_RM11-1a   301   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEVFDELSDKIVLESKAIE   350
YCL043C_RedStar   301   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIE   350
YCL043C_SEY6210   301   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIE   350
YCL043C_SK1   301   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIE   350
YCL043C_T7   301   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIE   350
YCL043C_T73   301   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIE   350
YCL043C_UC5   301   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIE   350
YCL043C_UWOPS05_217_3   235   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIE   284
YCL043C_VL3   301   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEXFDELSDKIVLESKAIE   350
YCL043C_Vin13   259   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEVFDELSDKIVLESKAIE   308
YCL043C_W303   301   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIE   350
YCL043C_X2180-1A   301   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIE   350
YCL043C_Y10   301   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIE   350
YCL043C_Y55   301   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEVFDELSDKIVLESKAIE   350
YCL043C_YJM269   301   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIE   350
YCL043C_YJM339   301   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIE   350
YCL043C_YJM789   301   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEVFDELSDKIVLESKAIE   350
YCL043C_YPH499   301   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIE   350
YCL043C_YPS128   235   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIE   284
YCL043C_YPS163   301   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIE   350
YCL043C_ZTW1   301   HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIE   350
         

YCL043C_S288C   351   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   400
YCL043C_AWRI1631   254   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   303
YCL043C_AWRI796   351   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   400
YCL043C_BC187   351   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   400
YCL043C_BY4741   351   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   400
YCL043C_BY4742   351   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   400
YCL043C_CBS7960   351   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   400
YCL043C_CEN.PK   351   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   400
YCL043C_CLIB215   351   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   400
YCL043C_CLIB324   351   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   400
YCL043C_D273-10B   351   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   400
YCL043C_DBVPG6044   351   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   400
YCL043C_EC1118   351   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   400
YCL043C_EC9-8   351   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   400
YCL043C_FL100   351   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   400
YCL043C_FY1679   351   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   400
YCL043C_FostersB   135   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   184
YCL043C_FostersO   217   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   266
YCL043C_JAY291   351   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   400
YCL043C_JK9-3d   351   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   400
YCL043C_K11   285   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   334
YCL043C_Kyokai7   351   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   400
YCL043C_L1528   351   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   400
YCL043C_LalvinQA23   351   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   400
YCL043C_PW5   351   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   400
YCL043C_RM11-1a   351   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   400
YCL043C_RedStar   351   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   400
YCL043C_SEY6210   351   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   400
YCL043C_SK1   351   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   400
YCL043C_T7   351   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   400
YCL043C_T73   351   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   400
YCL043C_UC5   351   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   400
YCL043C_UWOPS05_217_3   285   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   334
YCL043C_VL3   351   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   400
YCL043C_Vin13   309   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   358
YCL043C_W303   351   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   400
YCL043C_X2180-1A   351   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   400
YCL043C_Y10   351   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   400
YCL043C_Y55   351   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   400
YCL043C_YJM269   351   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   400
YCL043C_YJM339   351   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   400
YCL043C_YJM789   351   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   400
YCL043C_YPH499   351   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   400
YCL043C_YPS128   285   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   334
YCL043C_YPS163   351   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   400
YCL043C_ZTW1   351   SLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVL   400
         

YCL043C_S288C   401   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   450
YCL043C_AWRI1631   304   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   353
YCL043C_AWRI796   401   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   450
YCL043C_BC187   401   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   450
YCL043C_BY4741   401   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   450
YCL043C_BY4742   401   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   450
YCL043C_CBS7960   401   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   450
YCL043C_CEN.PK   401   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   450
YCL043C_CLIB215   401   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   450
YCL043C_CLIB324   401   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   450
YCL043C_D273-10B   401   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   450
YCL043C_DBVPG6044   401   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   450
YCL043C_EC1118   401   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   450
YCL043C_EC9-8   401   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   450
YCL043C_FL100   401   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   450
YCL043C_FY1679   401   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   450
YCL043C_FostersB   185   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   234
YCL043C_FostersO   267   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   316
YCL043C_JAY291   401   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   450
YCL043C_JK9-3d   401   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   450
YCL043C_K11   335   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   384
YCL043C_Kyokai7   401   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   450
YCL043C_L1528   401   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   450
YCL043C_LalvinQA23   401   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   450
YCL043C_PW5   401   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   450
YCL043C_RM11-1a   401   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   450
YCL043C_RedStar   401   YYAPWCGHCKRLAPTYQELVDTYANATSDVLIAKLDHTENDVRGVVIEGY   450
YCL043C_SEY6210   401   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   450
YCL043C_SK1   401   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   450
YCL043C_T7   401   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   450
YCL043C_T73   401   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   450
YCL043C_UC5   401   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   450
YCL043C_UWOPS05_217_3   335   YYAPWCGHCKRLAPAYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   384
YCL043C_VL3   401   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVXIEGY   450
YCL043C_Vin13   359   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   408
YCL043C_W303   401   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   450
YCL043C_X2180-1A   401   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   450
YCL043C_Y10   401   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   450
YCL043C_Y55   401   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   450
YCL043C_YJM269   401   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   450
YCL043C_YJM339   401   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   450
YCL043C_YJM789   401   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   450
YCL043C_YPH499   401   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   450
YCL043C_YPS128   335   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   384
YCL043C_YPS163   401   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   450
YCL043C_ZTW1   401   YYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHTENDVRGVVIEGY   450
         

YCL043C_S288C   451   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   500
YCL043C_AWRI1631   354   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   403
YCL043C_AWRI796   451   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   500
YCL043C_BC187   451   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   500
YCL043C_BY4741   451   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   500
YCL043C_BY4742   451   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   500
YCL043C_CBS7960   451   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   500
YCL043C_CEN.PK   451   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   500
YCL043C_CLIB215   451   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   500
YCL043C_CLIB324   451   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   500
YCL043C_D273-10B   451   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   500
YCL043C_DBVPG6044   451   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   500
YCL043C_EC1118   451   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   500
YCL043C_EC9-8   451   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   500
YCL043C_FL100   451   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   500
YCL043C_FY1679   451   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   500
YCL043C_FostersB   235   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   284
YCL043C_FostersO   317   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   366
YCL043C_JAY291   451   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   500
YCL043C_JK9-3d   451   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   500
YCL043C_K11   385   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   434
YCL043C_Kyokai7   451   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   500
YCL043C_L1528   451   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   500
YCL043C_LalvinQA23   451   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   500
YCL043C_PW5   451   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   500
YCL043C_RM11-1a   451   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   500
YCL043C_RedStar   451   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   500
YCL043C_SEY6210   451   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   500
YCL043C_SK1   451   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   500
YCL043C_T7   451   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   500
YCL043C_T73   451   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   500
YCL043C_UC5   451   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   500
YCL043C_UWOPS05_217_3   385   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIRENGHFDVDGKALYEEAQEK   434
YCL043C_VL3   451   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   500
YCL043C_Vin13   409   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   458
YCL043C_W303   451   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   500
YCL043C_X2180-1A   451   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   500
YCL043C_Y10   451   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   500
YCL043C_Y55   451   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   500
YCL043C_YJM269   451   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   500
YCL043C_YJM339   451   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   500
YCL043C_YJM789   451   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   500
YCL043C_YPH499   451   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   500
YCL043C_YPS128   385   PTIVLYPGGKKSESVVYQGSRSLNSLFDFIKENGHFDVDGKALYEEAQEK   434
YCL043C_YPS163   451   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   500
YCL043C_ZTW1   451   PTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALYEEAQEK   500
         

YCL043C_S288C   501   AAEEADAD----------AELADEEDAIHDEL   522
YCL043C_AWRI1631   404   AAEEADAD----------AELADEEDAIHDEL   425
YCL043C_AWRI796   501   AAEEADAD----------AELADEEDAIHDEL   522
YCL043C_BC187   501   AAEEADAD----------AELADEEDAIHDEL   522
YCL043C_BY4741   501   AAEEADAD----------AELADEEDAIHDEL   522
YCL043C_BY4742   501   AAEEADAD----------AELADEEDAIHDEL   522
YCL043C_CBS7960   501   AAEEADAD----------AELADEEDAIHDEL   522
YCL043C_CEN.PK   501   AAEEADAD----------AELADEEDAIHDEL   522
YCL043C_CLIB215   501   AAEEADAD----------AELADEEDAIHDEL   522
YCL043C_CLIB324   501   AAEEADAD----------AELADEEDAIHDEL   522
YCL043C_D273-10B   501   AAEEADAD----------AELADEEDAIHDEL   522
YCL043C_DBVPG6044   501   AAEEAEADAEAEADA--DAELADEEDAIHDEL   530
YCL043C_EC1118   501   AAEEADAD----------AELADEEDAIHDEL   522
YCL043C_EC9-8   501   AAEEAEADAEAEADA--DAELADEEDAIHDEL   530
YCL043C_FL100   501   AAEEAEADAEAEADA--DAELADEEDAIHDEL   530
YCL043C_FY1679   501   AAEEADAD----------AELADEEDAIHDEL   522
YCL043C_FostersB   285   AAEEADAD----------AELADEEDAIHDEL   306
YCL043C_FostersO   367   AAEEADAD----------AELADEEDAIHDEL   388
YCL043C_JAY291   501   AAEEADAD----------AELADEEDAIHDEL   522
YCL043C_JK9-3d   501   AAEEADAD----------AELADEEDAIHDEL   522
YCL043C_K11   435   AAEEAEADAEAEADAD--AELADEEDAIHDEL   464
YCL043C_Kyokai7   501   AAEEAEADAEAEADA--DAELADEEDAIHDEL   530
YCL043C_L1528   501   AAEEADAD----------AELADEEDAIHDEL   522
YCL043C_LalvinQA23   501   AAEEADAD----------AELADEEDAIHDEL   522
YCL043C_PW5   501   AAEEAEADAEAEADA--DAELADEEDAIHDEL   530
YCL043C_RM11-1a   501   AAEEADAD----------AELADEEDAIHDEL   522
YCL043C_RedStar   501   AAEEADAD----------AELADEEDAIHDEL   522
YCL043C_SEY6210   501   AAEEAEADAEAEADA--DAELADEEDAIHDEL   530
YCL043C_SK1   501   AAEEADAD----------AELADEEDAIHDEL   522
YCL043C_T7   501   AAEEAEADAEAEADA--DAELADEEDAIHDEL   530
YCL043C_T73   501   AAEEADAD----------AELADEEDAIHDEL   522
YCL043C_UC5   501   AAEEAEADAEAEADA--DAELADEEDAIHDEL   530
YCL043C_UWOPS05_217_3   435   AAEEAEADA----------ELADEEDAIHDEL   456
YCL043C_VL3   501   AAEEADAD----------AELADEEDAIHDEL   522
YCL043C_Vin13   459   AAEEADA