RNQ1/YCL028W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YCL028W_S288C   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_AWRI1631   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_AWRI796   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_BC187   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_BY4741   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_BY4742   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_CBS7960   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_CEN.PK   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_CLIB324   1   MDTDKLISEGESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_D273-10B   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_DBVPG6044   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_EC1118   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_EC9-8   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_FL100   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_FY1679   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_FostersB   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_FostersO   
   --------------------------------------------------   
YCL028W_JAY291   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_JK9-3d   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_K11   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_Kyokai7   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_L1528   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_LalvinQA23   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_PW5   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_RM11-1a   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_RedStar   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_SEY6210   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_SK1   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_T7   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_UC5   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_UWOPS05_217_3   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_VL3   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_Vin13   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_W303   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_X2180-1A   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_Y55   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_YJM269   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_YJM339   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_YJM789   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_YPH499   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_YPS128   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_YPS163   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_YS9   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
YCL028W_ZTW1   1   MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIA   50
         

YCL028W_S288C   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_AWRI1631   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_AWRI796   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_BC187   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_BY4741   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_BY4742   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_CBS7960   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_CEN.PK   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_CLIB324   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_D273-10B   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_DBVPG6044   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_EC1118   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_EC9-8   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_FL100   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_FY1679   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_FostersB   51   GYVMXNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLXKLALLATV   100
YCL028W_FostersO   1   -------------------------MNTLMADSKGSSQTQLXKLALLATV   25
YCL028W_JAY291   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_JK9-3d   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_K11   51   GYVMENRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_Kyokai7   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_L1528   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_LalvinQA23   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_PW5   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_RM11-1a   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_RedStar   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_SEY6210   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_SK1   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_T7   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_UC5   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_UWOPS05_217_3   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_VL3   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_Vin13   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_W303   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_X2180-1A   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_Y55   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_YJM269   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_YJM339   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_YJM789   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_YPH499   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_YPS128   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_YPS163   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_YS9   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
YCL028W_ZTW1   51   GYVMDNRSGGSDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATV   100
         

YCL028W_S288C   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_AWRI1631   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_AWRI796   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_BC187   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_BY4741   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_BY4742   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_CBS7960   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_CEN.PK   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_CLIB324   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_D273-10B   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_DBVPG6044   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_EC1118   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_EC9-8   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_FL100   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_FY1679   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_FostersB   101   MTHSSNKGSSNRGXDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_FostersO   26   MTHSSNKGSSNRGXDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   75
YCL028W_JAY291   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_JK9-3d   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_K11   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_Kyokai7   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_L1528   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_LalvinQA23   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_PW5   101   LTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_RM11-1a   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_RedStar   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_SEY6210   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_SK1   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_T7   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_UC5   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_UWOPS05_217_3   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_VL3   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_Vin13   101   MTHSSNKGSSNRGFDVGTVMSMLSXSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_W303   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_X2180-1A   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_Y55   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_YJM269   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_YJM339   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_YJM789   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_YPH499   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_YPS128   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_YPS163   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_YS9   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
YCL028W_ZTW1   101   MTHSSNKGSSNRGFDVGTVMSMLSGSGGGSQSMGASGLAALASQFFKSGN   150
         

YCL028W_S288C   151   NSQGQGQGQGQGQGQGQGQG----------------QGSFTALASLASSF   184
YCL028W_AWRI1631   151   NSQGQGQGQGQGQGQGQGQG----------------QGSFTALASLASSF   184
YCL028W_AWRI796   151   NSQGQGQGQGQGQGQGQGQG----------------QGSFTALASLASSF   184
YCL028W_BC187   151   NSQGQGQGQGQGQGQGQGQG----------------QGSFTALASLASSF   184
YCL028W_BY4741   151   NSQGQGQGQGQGQGQGQGQG----------------QGSFTALASLASSF   184
YCL028W_BY4742   151   NSQGQGQGQGQGQGQGQGQG----------------QGSFTALASLASSF   184
YCL028W_CBS7960   151   NSQGQGQGQGQ------------------------GQGSFTALASLASSF   176
YCL028W_CEN.PK   151   NSQGQGQGQGQGQGQGQGQG----------------QGSFTALASLASSF   184
YCL028W_CLIB324   151   NSQGQGQGQGQGQGQGQGQG----------------QGSFTALASLASSF   184
YCL028W_D273-10B   151   NSQGQGQGQGQGQGQGQGQGQ----------------GSFTALASLASSF   184
YCL028W_DBVPG6044   151   NSQGQGQSQGQGQGQGQG--------------------SFTALASLASSF   180
YCL028W_EC1118   151   NSQGQGQGQGQGQGQGQGQG----------------QGSFTALASLASSF   184
YCL028W_EC9-8   151   NSQGQGQGQGQGQGQGQGQGQ----------------GSFTALASLASSF   184
YCL028W_FL100   151   NSQGQGQGQGQGQGQGQGQG----------------QGSFTALASLASSF   184
YCL028W_FY1679   151   NSQGQGQGQGQGQGQGQGQG----------------QGSFTALASLASSF   184
YCL028W_FostersB   151   NSQGQGQDQGQGQGQGQGQG--------------QGQGSFTALASLASSF   186
YCL028W_FostersO   76   NSQGQGQGQGQGQGQGQGQG----------------QGSFTALASLASSF   109
YCL028W_JAY291   151   NSQGQGQGQGQGQG------------------------SFTALASLASSF   176
YCL028W_JK9-3d   151   NSQGQGQGQGQGQGQGQGQG----------------QGSFTALASLASSF   184
YCL028W_K11   151   NSQGQGQGQGQGQGQG----------------------SFTALASLASSF   178
YCL028W_Kyokai7   151   NSQGQGQGQGQGQGQGQGQGQ----------------GSFTALASLASSF   184
YCL028W_L1528   151   NSQGQGQGQGQGQGQGQGQG----------------QGSFTALASLASSF   184
YCL028W_LalvinQA23   151   NSQGQGQGQGQGQGQGQGQG----------------QGSFTALASLASSF   184
YCL028W_PW5   151   NSQGQGQSQGQGQGQGQG--------------------SFTALASLASSF   180
YCL028W_RM11-1a   151   NSQGQGQGQGQGQGQGQGQG----------------QGSFTALASLASSF   184
YCL028W_RedStar   151   NSQGQGQGQGQGQGQGQGQG----------------QGSFTALASLASSF   184
YCL028W_SEY6210   151   NSQGQGQGQGQGQGQGQGQG----------------QGSFTALASLASSF   184
YCL028W_SK1   151   NSQGQGQGQGQGQGQGQGQG----------------QGSFTALASLASSF   184
YCL028W_T7   151   NSQGQGQGQGQGQGQGQGQG------------------SFTALASLASSF   182
YCL028W_UC5   151   NSQGQGQGQGQGQGQGQGQGQ----------------GSFTALASLASSF   184
YCL028W_UWOPS05_217_3   151   NSQGQGQGQGQGQGQGQGQGXXXXQGQGQGQGQGQGQGSFTALASLASSF   200
YCL028W_VL3   151   NSQGQGQGQGQGQGQGQGQG----------------QGSFTALASLASSF   184
YCL028W_Vin13   151   NSQGQGQGQGQGQGQGQGQG----------------QGSFTALASLASSF   184
YCL028W_W303   151   NSQGQGQGQGQGQGQGQGQG----------------QGSFTALASLASSF   184
YCL028W_X2180-1A   151   NSQGQGQGQGQGQGQGQGQG----------------QGSFTALASLASSF   184
YCL028W_Y55   151   NSQGQGQGQGQGQGQGQGQG----------------QGSFTALASLASSF   184
YCL028W_YJM269   151   NSQGQGQGQGQGQGQGQGQG------------------SFTALASLASSF   182
YCL028W_YJM339   151   NSQGQGQGQGQGQGQGQGQG----------------QGSFTALASLASSF   184
YCL028W_YJM789   151   NSQGQGQGQGQGQGQGQGQG----------------QGSFTALASLASSF   184
YCL028W_YPH499   151   NSQGQGQGQGQGQGQGQGQG----------------QGSFTALASLASSF   184
YCL028W_YPS128   151   NSQGQGQGQGQGQGQGQGQGQ----------------GSFTALASLASSF   184
YCL028W_YPS163   151   NSQGQGQGQGQGQGQGQGQGQ----------------GSFTALASLASSF   184
YCL028W_YS9   151   NSQGQGQGQGQGQGQ----G----------------QGSFTALASLASSF   180
YCL028W_ZTW1   151   NSQGQGQGQGQGQGQGQGQG------------------SFTALASLASSF   182
         

YCL028W_S288C   185   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   234
YCL028W_AWRI1631   185   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   234
YCL028W_AWRI796   185   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   234
YCL028W_BC187   185   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   234
YCL028W_BY4741   185   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   234
YCL028W_BY4742   185   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   234
YCL028W_CBS7960   177   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   226
YCL028W_CEN.PK   185   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   234
YCL028W_CLIB324   185   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   234
YCL028W_D273-10B   185   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   234
YCL028W_DBVPG6044   181   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   230
YCL028W_EC1118   185   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   234
YCL028W_EC9-8   185   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   234
YCL028W_FL100   185   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   234
YCL028W_FY1679   185   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   234
YCL028W_FostersB   187   MNSNNNNQQGQNQSSGGSSFGAXASMAISFMHSNNNQNSNNSQQGYNQS-   235
YCL028W_FostersO   110   MNSNNNNQQGQNQSSGGSSFGAXASMAISFMHSNNNQNSNNSQQGYNQSY   159
YCL028W_JAY291   177   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   226
YCL028W_JK9-3d   185   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   234
YCL028W_K11   179   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   228
YCL028W_Kyokai7   185   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   234
YCL028W_L1528   185   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   234
YCL028W_LalvinQA23   185   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   234
YCL028W_PW5   181   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   230
YCL028W_RM11-1a   185   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   234
YCL028W_RedStar   185   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   234
YCL028W_SEY6210   185   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   234
YCL028W_SK1   185   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   234
YCL028W_T7   183   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   232
YCL028W_UC5   185   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   234
YCL028W_UWOPS05_217_3   201   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   250
YCL028W_VL3   185   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   234
YCL028W_Vin13   185   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   234
YCL028W_W303   185   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   234
YCL028W_X2180-1A   185   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   234
YCL028W_Y55   185   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   234
YCL028W_YJM269   183   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   232
YCL028W_YJM339   185   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   234
YCL028W_YJM789   185   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   234
YCL028W_YPH499   185   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   234
YCL028W_YPS128   185   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGCNQSY   234
YCL028W_YPS163   185   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGCNQSY   234
YCL028W_YS9   181   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   230
YCL028W_ZTW1   183   MNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSY   232
         

YCL028W_S288C   235   QNGNQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   284
YCL028W_AWRI1631   235   QNGNQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   284
YCL028W_AWRI796   235   QNGNQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   284
YCL028W_BC187   235   QNGNQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   284
YCL028W_BY4741   235   QNGNQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   284
YCL028W_BY4742   235   QNGNQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   284
YCL028W_CBS7960   
   --------------------------------------------------   
YCL028W_CEN.PK   235   QNGNQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   284
YCL028W_CLIB324   235   QNGNQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   284
YCL028W_D273-10B   235   QNGNQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   284
YCL028W_DBVPG6044   231   QNGSQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   280
YCL028W_EC1118   235   QNGNQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   284
YCL028W_EC9-8   235   QNGNQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   284
YCL028W_FL100   235   QNGNQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   284
YCL028W_FY1679   235   QNGNQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   284
YCL028W_FostersB   
   --------------------------------------------------   
YCL028W_FostersO   160   QNGNQNSQGYNNQQYQGXNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   209
YCL028W_JAY291   
   --------------------------------------------------   
YCL028W_JK9-3d   235   QNGNQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   284
YCL028W_K11   229   QNGNQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   278
YCL028W_Kyokai7   235   QNGNQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   284
YCL028W_L1528   235   QNGNQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   284
YCL028W_LalvinQA23   235   QNGNQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   284
YCL028W_PW5   231   QNGSQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   280
YCL028W_RM11-1a   235   QNGNQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   284
YCL028W_RedStar   235   QNGNQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   284
YCL028W_SEY6210   235   QNGNQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   284
YCL028W_SK1   235   QNGNQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   284
YCL028W_T7   233   QNGNQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   282
YCL028W_UC5   235   QNGNQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   284
YCL028W_UWOPS05_217_3   251   QNGNQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQT-   299
YCL028W_VL3   235   QNGNQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   284
YCL028W_Vin13   235   QNGNQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   284
YCL028W_W303   235   QNGNQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   284
YCL028W_X2180-1A   235   QNGNQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   284
YCL028W_Y55   235   QNGNQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   284
YCL028W_YJM269   233   QNGNQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   282
YCL028W_YJM339   235   QNGNQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   284
YCL028W_YJM789   235   QNGNQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   284
YCL028W_YPH499   235   QNGNQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   284
YCL028W_YPS128   235   QNGNQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   284
YCL028W_YPS163   235   QNGNQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   284
YCL028W_YS9   231   QNGNQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   280
YCL028W_ZTW1   233   QNGNQNSQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQ   282
         

YCL028W_S288C   285   SNQQQYNQQGQNNQQQYQQQGQNYQHQQQGQQQQQGHSSSFSALASMASS   334
YCL028W_AWRI1631   285   SNQQQYNQQGQNNQQQYQQQGQNYQHQQQGQQQQQGHSSSFSALASMASS   334
YCL028W_AWRI796   285   SNQQQYNQQGQNNQQQYQQQGQNYQHQQQGQQQQQGHSSSFSALASMASS   334
YCL028W_BC187   285   SNQQQYNQQGQNNQQQYQQQGQNYQHQQQGQQQQQGHSSSFSALASMASS   334
YCL028W_BY4741   285   SNQQQYNQQGQNNQQQYQQQGQNYQHQQQGQQQQQGHSSSFSALASMASS   334
YCL028W_BY4742   285   SNQQQYNQQGQNNQQQYQQQGQNYQHQQQGQQQQQGHSSSFSALASMASS   334
YCL028W_CBS7960   
   --------------------------------------------------   
YCL028W_CEN.PK   285   SNQQQYNQQGQNNQQQYQQQGQNYQHQQQGQQQQQGHSSSFSALASMASS   334
YCL028W_CLIB324   285   SNQQQYNQQGQNNQQQYQQQGQNYQHQQQGQQQQQGHSSSFSALASMASS   334
YCL028W_D273-10B   285   SNQQQYNQQGQNNQQQYQQQGQNYQHQQQGQQQQQGHSSSFSALASMASS   334
YCL028W_DBVPG6044   281   SNQQ-----------QYQQQGQNYQHQQQGQQQQQGHSSSFSALASMASS   319
YCL028W_EC1118   285   SNQQQYNQQGQNNQQQYQQQGQNYQHQQQGQQQQQGHSSSFSALASMASS   334
YCL028W_EC9-8   285   SNQQQYNQQGQNNQQQYQQQGQNYQHQQQGQQQQQGHSSSFSALASMASS   334
YCL028W_FL100   285   SNQQQYNQQGQNNQQQYQQQGQNYQHQQQGQQQQQGHSSSFSALASMASS   334
YCL028W_FY1679   285   SNQQQYNQQGQNNQQQYQQQGQNYQHQQQGQQQQQGHSSSFSALASMASS   334
YCL028W_FostersB   
   --------------------------------------------------   
YCL028W_FostersO   210   SNQQQYNQQGQNNQQQYQQQGQELISTNNRVSSSNKATPVHSQLWLPWQV   259
YCL028W_JAY291   
   --------------------------------------------------   
YCL028W_JK9-3d   285   SNQQQYNQQGQNNQQQYQQQGQNYQHQQQGQQQQQGHSSSFSALASMASS   334
YCL028W_K11   279   SNQQQYNQQGQNNQQQYQQQGQNYQHQQQGQQQQQGHSSSFSALASMASS   328
YCL028W_Kyokai7   285   SNQQQYNQQGQNNQQQYQQQGQNYQHQQQGQQQQQGHSSSFSALASMASS   334
YCL028W_L1528   285   SNQQQYNQQGQNNQQQYQQQGQNYQHQQQGQQQQQGHSSSFSALASMASS   334
YCL028W_LalvinQA23   285   SNQQQYNQQGQNNQQQYQQQGQNYQHQQQGQQQQXGHSSSFSALASMASS   334
YCL028W_PW5   281   SNQQ-----------QYQQQGQNYQHQQQGQQQQQGHSSSFSALASMASS   319
YCL028W_RM11-1a   285   SNQQQYNQQGQNNQQQYQQQGQNYQHQQQGQQQQQGHSSSFSALASMASS   334
YCL028W_RedStar   285   SNQQQYNQQGQNNQQQYQQQGQNYQHQQQGQQQQQGHSSSFSALASMASS   334
YCL028W_SEY6210   285   SNQQQYNQQGQNNQQQYQQQGQNYQHQQQGQQQQQGHSSSFSALASMASS   334
YCL028W_SK1   285   SNQQQYNQQGQNNQQQYQQQGQNYQHQQQGQQQQQGHSSSFSALASMASS   334
YCL028W_T7   283   SNQQQYNQQGQNNQQQYQQQGQNYQHQQQGQQQQQGHSSSFSALASMASS   332
YCL028W_UC5   285   SNQQQYNQQGQNNQQQYQQQGQNYQHQQQGQQQQQGHSSSFSALASMASS   334
YCL028W_UWOPS05_217_3   300   ----------QSNQQQYQQQGQNYQHQQQGQQQQQGHSSSFSALASMASS   339
YCL028W_VL3   285   SNQQQYNQQGQNNQQQYQQQGQNYQHQQQGQQQQQGHSSSFSALASMASS   334
YCL028W_Vin13   285   SNQQQYNQQGQNNQQQYQQQGQNYQHQQQGQQQQXGHSSSFSALASMASS   334
YCL028W_W303   285   SNQQQYNQQGQNNQQQYQQQGQNYQHQQQGQQQQQGHSSSFSALASMASS   334
YCL028W_X2180-1A   285   SNQQQYNQQGQNNQQQYQQQGQNYQHQQQGQQQQQGHSSSFSALASMASS   334
YCL028W_Y55   285   SNQQQYNQQGQNNQQQYQQQGQNYQHQQQGQQQQQGHSSSFSALASMASS   334
YCL028W_YJM269   283   SNQQQYNQQGQNNQQQYQQQGQNYQHQQQGQQQQQGHSSSFSALASMASS   332
YCL028W_YJM339   285   SNQQQYNQQGQNNQQQYQQQGQNYQHQQQGQQQQQGHSSSFSALASMASS   334
YCL028W_YJM789   285   SNQQQYNQ-----------QGQNYQHQQQGQQQQQGHSSSFSALASMASS   323
YCL028W_YPH499   285   SNQQQYNQQGQNNQQQYQQQGQNYQHQQQGQQQQQGHSSSFSALASMASS   334
YCL028W_YPS128   285   SNQQQYNQQGQSNQQQYQQQGQNYQHQQQGQQQQQGHSSSFSALASMASS   334
YCL028W_YPS163   285   SNQQQYNQQGQSNQQQYQQQGQNYQHQQQGQQQQQGHSSSFSALASMASS   334
YCL028W_YS9   281   SNQQQYNQQGQNNQQQYQQQGQNYQHQQQGQQQQQGHSSSFSALASMASS   330
YCL028W_ZTW1   283   SNQQQYNQQGQNNQQQYQQQGQNYQHQQQGQQQQQGHSSSFSALASMASS   332
         

YCL028W_S288C   335   YLGNNSNSNSSYGGQQQAN--------------EYGRPQQNGQQQSNEYG   370
YCL028W_AWRI1631   335   YLGNNSNSNSSYGGQQQAN--------------EYGRPQQNGQQQSNEYG   370
YCL028W_AWRI796   335   YLGNNSNSNSSYGGQQQAN--------------EYGRPQQNGQQQSNEYG   370
YCL028W_BC187   335   YLGNNSNSNSSYGGQQQAN--------------EYGRPQQNGQQQSNEYG   370
YCL028W_BY4741   335   YLGNNSNSNSSYGGQQQAN--------------EYGRPQQNGQQQSNEYG   370
YCL028W_BY4742   335   YLGNNSNSNSSYGGQQQAN--------------EYGRPQQNGQQQSNEYG   370
YCL028W_CBS7960   
   --------------------------------------------------   
YCL028W_CEN.PK   335   YLGNNSNSNSSYGGQQQAN--------------EYGRPQQNGQQQSNEYG   370
YCL028W_CLIB324   335   YLGNNSNSNSSYGGQQQAN--------------EYGRPQQNGQQQSNEYG   370
YCL028W_D273-10B   335   YLGNNSNSNSSYGGQQQAN--------------EYGRPQHNGQQQSNEYG   370
YCL028W_DBVPG6044   320   YLGNNSNSNSSYGGQQQAN--------------EYGRPQHNGQQQSNEYG   355
YCL028W_EC1118   335   YLGNNSNSNSSYGGQQQAN--------------EYGRPQQNGQQQSNEYG   370
YCL028W_EC9-8   335   YLGNNSNSNSSYGGQQQAN--------------EYGRPQHNGQQQSNEYG   370
YCL028W_FL100   335   YLGNNSNSNSSYGGQQQAN--------------EYGRPQQNGQQQSNEYG   370
YCL028W_FY1679   335   YLGNNSNSNSSYGGQQQAN--------------EYGRPQQNGQQQSNEYG   370
YCL028W_FostersB   
   --------------------------------------------------   
YCL028W_FostersO   260   PTWAITPIQIRVMGASNRLMSMVDX-------------NTNGQQQSNEYG   296
YCL028W_JAY291   
   --------------------------------------------------   
YCL028W_JK9-3d   335   YLGNNSNSNSSYGGQQQAN--------------EYGRPQQNGQQQSNEYG   370
YCL028W_K11   329   YLGNNSNSNSSYGGQQQAN--------------EYGRPQHNGQQQSNEYG   364
YCL028W_Kyokai7   335   YLGNNSNSNSSYGGQQQAN--------------EYGRPQHNGQQQSNEYG   370
YCL028W_L1528   335   YLGNNSNSNSSYGGQQQAN--------------EYGRPQQNGQQQSNEYG   370
YCL028W_LalvinQA23   335   YLGNNSNSNSSYGGQQQAN--------------EYGRPQQNGQQQSNEYG   370
YCL028W_PW5   320   YLGNNSNSNSSYGGQQQAN--------------EYGRPQHNGQQQSNEYG   355
YCL028W_RM11-1a   335   YLGNNSNSNSSYGGQQQAN--------------EYGRPQQNGQQQSNEYG   370
YCL028W_RedStar   335   YLGNNSNSNSSYGGQQQAN--------------EYGRPQQNGQQQSNEYG   370
YCL028W_SEY6210   335   YLGNNSNSNSSYGGQQQAN--------------EYGRPQQNGQQQSNEYG   370
YCL028W_SK1   335   YLGNNSNSNSSYGGQQQAN--------------EYGRPQQNGQQQSNEYG   370
YCL028W_T7   333   YLGNNSNSNSSYGGQQQAN--------------EYGRPQHNGQQQSNEYG   368
YCL028W_UC5   335   YLGNNSNSNSSYGGQQQAN--------------EYGRPQHNGQQQSNEYG   370
YCL028W_UWOPS05_217_3   340   YLGNNSNSNSSYGGQQQANEYGRPQHNGQQQSNEYGRPQHNGQQQSNEYG   389
YCL028W_VL3   335   YLGNNSNSNSSYGGQQQAN--------------EYGRPQQNGQQQSNEYG   370
YCL028W_Vin13   335   YLGNNSNSNSSYGGQQQAN--------------EYGRPQQNGQQQSNEYG   370
YCL028W_W303   335   YLGNNSNSNSSYGGQQQAN--------------EYGRPQQNGQQQSNEYG   370
YCL028W_X2180-1A   335   YLGNNSNSNSSYGGQQQAN--------------EYGRPQQNGQQQSNEYG   370
YCL028W_Y55   335   YLGNNSNSNSSYGGQQQAN--------------EYGRPQQNGQQQSNEYG   370
YCL028W_YJM269   333   YLGNNSNSNSSYGGQQQAN--------------EYGRPQHNGQQQSNEYG   368
YCL028W_YJM339   335   YLGNNSNSNSSYGGQQQAN--------------EYGRPQQNGQQQSNEYG   370
YCL028W_YJM789   324   YLGNNSNSNSSYGGQQQAN--------------EYGRPQQNGQQQSNEYG   359
YCL028W_YPH499   335   YLGNNSNSNSSYGGQQQAN--------------EYGRPQQNGQQQSNEYG   370
YCL028W_YPS128   335   YLGNNSNSNSSYGGQQQAN--------------EYGRPQHNGQQQSNEYG   370
YCL028W_YPS163   335   YLGNNSNSNSSYGGQQQAN--------------EYGRPQHNGQQQSNEYG   370
YCL028W_YS9   331   YLGNNSNSNSSYGGQQQAN--------------EYGRPQQNGQQQSNEYG   366
YCL028W_ZTW1   333   YLGNNSNSNSSYGGQQQAN--------------EYGRPQHNGQQQSNEYG   368
         

YCL028W_S288C   371   RPQYGGNQNSNGQHESFNFSGNFSQQNNNGNQNRY   405
YCL028W_AWRI1631   371   RPQYGGNQNSNGQHESFNFSGNFSQQNNNGNQNRY   405
YCL028W_AWRI796   371   RPQYGGNQNSNGQHESFNFSGNFSQQNNNGNQNRY   405
YCL028W_BC187   371   RPQYGGNQNSNGQHESFNFSGNFSQQNNNGNQNRY   405
YCL028W_BY4741   371   RPQYGGNQNSNGQHESFNFSGNFSQQNNNGNQNRY   405
YCL028W_BY4742   371   RPQYGGNQNSNGQHESFNFSGNFSQQNNNGNQNRY   405
YCL028W_CBS7960   
   -----------------------------------   
YCL028W_CEN.PK   371   RPQYGGNQNSNGQHESFNFSGNFSQQNNNGNQNRY   405
YCL028W_CLIB324   371   RPQYGGNQNSNGQHESFNFSGNFSQQNNNGNQNRY   405
YCL028W_D273-10B   371   RPQYGGNQNSNGQHESFNFSGNFSQQNNNGNQNRY   405
YCL028W_DBVPG6044   356   RPQYGGNQNSNGHHESFNFSGNFSQQNNNGNQNRY   390
YCL028W_EC1118   371   RPQYGGNQNSNGQHESFNFSGNFSQQNNNGNQNRY   405
YCL028W_EC9-8   371   RPQYGGNQNSNGQHESFNFSGNFSQQNNNGNQNRY   405
YCL028W_FL100   371   RPQYGGNQNSNGQHESFNFSGNFSQQNNNGNQNRY   405
YCL028W_FY1679   371   RPQYGGNQNSNGQHESFNFSGNFSQQNNNGNQNRY   405
YCL028W_FostersB   
   -----------------------------------   
YCL028W_FostersO   297   RPQYGGNQNSNGQHESXNFSGNFSQQNNNGNQNRY   331
YCL028W_JAY291   
   -----------------------------------   
YCL028W_JK9-3d   371   RPQYGGNQNSNGQHESFNFSGNFSQQNNNGNQNRY   405
YCL028W_K11   365   RPQYGGNQNSNGQHESFNFSGNFSQQNNNGNQNRY   399
YCL028W_Kyokai7   371   RPQYGGNQNSNGQHESFNFSGNFSQQNNNGNQNRY   405
YCL028W_L1528   371   RPQYGGNQNSNGQHESFNFSGNFSQQNNNGNQNRY   405
YCL028W_LalvinQA23   371   RPQYGGNQNSNGQHESFNFSGNFSQQNNNGNQNRY   405
YCL028W_PW5   356   RPQYGGNQNSNGHHESFNFSGNFSQQNNNGNQNRY   390
YCL028W_RM11-1a   371   RPQYGGNQNSNGQHESFNFSGNFSQQNNNGNQNRY   405
YCL028W_RedStar   371   RPQYGGNQNSNGQHESFNFSGNFSQQNNNGNQNRY   405
YCL028W_SEY6210   371   RPQYGGNQNSNGQHESFNFSGNFSQQNNNGNQNRY   405
YCL028W_SK1   371   RPQYGGNQNSNGQHESFNFSGNFSQQNNNGNQNRY   405
YCL028W_T7   369   RPQYGGNQNSNGHHESFNFSGNFSQQNNNGNQNRY   403
YCL028W_UC5   371   RPQYGGNQNSNGQHESFNFSGNFSQQNNNGNQNRY   405
YCL028W_UWOPS05_217_3   390   RPQYGGNQNSNGQHESFNFSGNFSQQNNNGNQNRY   424
YCL028W_VL3   371   RPQYGGNQNSNGQHESFNFSGNFSQQNNNGNQNRY   405
YCL028W_Vin13   371   RPQYGGNQNSNGQHESFNFSGNFFSTEQ-------   398
YCL028W_W303   371   RPQYGGNQNSNGQHESFNFSGNFSQQNNNGNQNRY   405
YCL028W_X2180-1A   371   RPQYGGNQNSNGQHESFNFSGNFSQQNNNGNQNRY   405
YCL028W_Y55   371   RPQYGGNQNSNGQHESFNFSGNFSQQNNNGNQNRY   405
YCL028W_YJM269   369   RPQYGGNQNSNGHHESFNFSGNFSQQNNNGNQNRY   403
YCL028W_YJM339   371   RPQYGGNQNSNGQHESFNFSGNFSQQNNNGNQNRY   405
YCL028W_YJM789   360   RPQYGGNQNSNGQHESFNFSGNFSQQNNNGNQNRY   394
YCL028W_YPH499   371   RPQYGGNQNSNGQHESFNFSGNFSQQNNNGNQNRY   405
YCL028W_YPS128   371   RPQYGGNQNSNGHHESFNFSGNFSQQNNNGNQNRY   405
YCL028W_YPS163   371   RPQYGGNQNSNGHHESFNFSGNFSQQNNNGNQNRY   405
YCL028W_YS9   367   RPQYGGNQNSNGQHESFNFSGNFSQQNNNGNQNRY   401
YCL028W_ZTW1   369   RPQYGGNQNSNGQHESFNFSGNFSQQNNNGNQNRY   403
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YCL028W_S288C from SGD:

YCL028W_S288C [source=SGD]  Length: 406  Thu Sep 21 06:03:03 2017  Type: P  Check: 4539  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGQGQGQG QGSFTALASL ASSFMNSNNN NQQGQNQSSG

     201  GSSFGALASM ASSFMHSNNN QNSNNSQQGY NQSYQNGNQN SQGYNNQQYQ

     251  GGNGGYQQQQ GQSGGAFSSL ASMAQSYLGG GQTQSNQQQY NQQGQNNQQQ

     301  YQQQGQNYQH QQQGQQQQQG HSSSFSALAS MASSYLGNNS NSNSSYGGQQ

     351  QANEYGRPQQ NGQQQSNEYG RPQYGGNQNS NGQHESFNFS GNFSQQNNNG

     401  NQNRY*

Protein Sequence for YCL028W_AWRI1631 from AWRI:

YCL028W_AWRI1631 [source=AWRI]  Length: 406  Thu Sep 21 06:03:03 2017  Type: P  Check: 4539  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGQGQGQG QGSFTALASL ASSFMNSNNN NQQGQNQSSG

     201  GSSFGALASM ASSFMHSNNN QNSNNSQQGY NQSYQNGNQN SQGYNNQQYQ

     251  GGNGGYQQQQ GQSGGAFSSL ASMAQSYLGG GQTQSNQQQY NQQGQNNQQQ

     301  YQQQGQNYQH QQQGQQQQQG HSSSFSALAS MASSYLGNNS NSNSSYGGQQ

     351  QANEYGRPQQ NGQQQSNEYG RPQYGGNQNS NGQHESFNFS GNFSQQNNNG

     401  NQNRY*

Protein Sequence for YCL028W_AWRI796 from AWRI:

YCL028W_AWRI796 [source=AWRI]  Length: 406  Thu Sep 21 06:03:03 2017  Type: P  Check: 4539  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGQGQGQG QGSFTALASL ASSFMNSNNN NQQGQNQSSG

     201  GSSFGALASM ASSFMHSNNN QNSNNSQQGY NQSYQNGNQN SQGYNNQQYQ

     251  GGNGGYQQQQ GQSGGAFSSL ASMAQSYLGG GQTQSNQQQY NQQGQNNQQQ

     301  YQQQGQNYQH QQQGQQQQQG HSSSFSALAS MASSYLGNNS NSNSSYGGQQ

     351  QANEYGRPQQ NGQQQSNEYG RPQYGGNQNS NGQHESFNFS GNFSQQNNNG

     401  NQNRY*

Protein Sequence for YCL028W_BC187 from Stanford:

YCL028W_BC187 [source=Stanford]  Length: 406  Thu Sep 21 06:03:03 2017  Type: P  Check: 4539  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGQGQGQG QGSFTALASL ASSFMNSNNN NQQGQNQSSG

     201  GSSFGALASM ASSFMHSNNN QNSNNSQQGY NQSYQNGNQN SQGYNNQQYQ

     251  GGNGGYQQQQ GQSGGAFSSL ASMAQSYLGG GQTQSNQQQY NQQGQNNQQQ

     301  YQQQGQNYQH QQQGQQQQQG HSSSFSALAS MASSYLGNNS NSNSSYGGQQ

     351  QANEYGRPQQ NGQQQSNEYG RPQYGGNQNS NGQHESFNFS GNFSQQNNNG

     401  NQNRY*

Protein Sequence for YCL028W_BY4741 from Stanford:

YCL028W_BY4741 [source=Stanford]  Length: 406  Thu Sep 21 06:03:03 2017  Type: P  Check: 4539  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGQGQGQG QGSFTALASL ASSFMNSNNN NQQGQNQSSG

     201  GSSFGALASM ASSFMHSNNN QNSNNSQQGY NQSYQNGNQN SQGYNNQQYQ

     251  GGNGGYQQQQ GQSGGAFSSL ASMAQSYLGG GQTQSNQQQY NQQGQNNQQQ

     301  YQQQGQNYQH QQQGQQQQQG HSSSFSALAS MASSYLGNNS NSNSSYGGQQ

     351  QANEYGRPQQ NGQQQSNEYG RPQYGGNQNS NGQHESFNFS GNFSQQNNNG

     401  NQNRY*

Protein Sequence for YCL028W_BY4742 from Stanford:

YCL028W_BY4742 [source=Stanford]  Length: 406  Thu Sep 21 06:03:03 2017  Type: P  Check: 4539  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGQGQGQG QGSFTALASL ASSFMNSNNN NQQGQNQSSG

     201  GSSFGALASM ASSFMHSNNN QNSNNSQQGY NQSYQNGNQN SQGYNNQQYQ

     251  GGNGGYQQQQ GQSGGAFSSL ASMAQSYLGG GQTQSNQQQY NQQGQNNQQQ

     301  YQQQGQNYQH QQQGQQQQQG HSSSFSALAS MASSYLGNNS NSNSSYGGQQ

     351  QANEYGRPQQ NGQQQSNEYG RPQYGGNQNS NGQHESFNFS GNFSQQNNNG

     401  NQNRY*

Protein Sequence for YCL028W_CBS7960 from WashU:

YCL028W_CBS7960 [source=WashU]  Length: 227  Thu Sep 21 06:03:03 2017  Type: P  Check: 861  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGSFTALA SLASSFMNSN NNNQQGQNQS SGGSSFGALA

     201  SMASSFMHSN NNQNSNNSQQ GYNQSY*

Protein Sequence for YCL028W_CEN.PK from Stanford:

YCL028W_CEN.PK [source=Stanford]  Length: 406  Thu Sep 21 06:03:03 2017  Type: P  Check: 4539  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGQGQGQG QGSFTALASL ASSFMNSNNN NQQGQNQSSG

     201  GSSFGALASM ASSFMHSNNN QNSNNSQQGY NQSYQNGNQN SQGYNNQQYQ

     251  GGNGGYQQQQ GQSGGAFSSL ASMAQSYLGG GQTQSNQQQY NQQGQNNQQQ

     301  YQQQGQNYQH QQQGQQQQQG HSSSFSALAS MASSYLGNNS NSNSSYGGQQ

     351  QANEYGRPQQ NGQQQSNEYG RPQYGGNQNS NGQHESFNFS GNFSQQNNNG

     401  NQNRY*

Protein Sequence for YCL028W_CLIB324 from WashU:

YCL028W_CLIB324 [source=WashU]  Length: 406  Thu Sep 21 06:03:03 2017  Type: P  Check: 4599  ..

       1  MDTDKLISEG ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGQGQGQG QGSFTALASL ASSFMNSNNN NQQGQNQSSG

     201  GSSFGALASM ASSFMHSNNN QNSNNSQQGY NQSYQNGNQN SQGYNNQQYQ

     251  GGNGGYQQQQ GQSGGAFSSL ASMAQSYLGG GQTQSNQQQY NQQGQNNQQQ

     301  YQQQGQNYQH QQQGQQQQQG HSSSFSALAS MASSYLGNNS NSNSSYGGQQ

     351  QANEYGRPQQ NGQQQSNEYG RPQYGGNQNS NGQHESFNFS GNFSQQNNNG

     401  NQNRY*

Protein Sequence for YCL028W_D273-10B from Stanford:

YCL028W_D273-10B [source=Stanford]  Length: 406  Thu Sep 21 06:03:03 2017  Type: P  Check: 4377  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGQGQGQG QGSFTALASL ASSFMNSNNN NQQGQNQSSG

     201  GSSFGALASM ASSFMHSNNN QNSNNSQQGY NQSYQNGNQN SQGYNNQQYQ

     251  GGNGGYQQQQ GQSGGAFSSL ASMAQSYLGG GQTQSNQQQY NQQGQNNQQQ

     301  YQQQGQNYQH QQQGQQQQQG HSSSFSALAS MASSYLGNNS NSNSSYGGQQ

     351  QANEYGRPQH NGQQQSNEYG RPQYGGNQNS NGQHESFNFS GNFSQQNNNG

     401  NQNRY*

Protein Sequence for YCL028W_DBVPG6044 from Stanford:

YCL028W_DBVPG6044 [source=Stanford]  Length: 391  Thu Sep 21 06:03:03 2017  Type: P  Check: 9067  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQSQG QGQGQGQGSF TALASLASSF MNSNNNNQQG QNQSSGGSSF

     201  GALASMASSF MHSNNNQNSN NSQQGYNQSY QNGSQNSQGY NNQQYQGGNG

     251  GYQQQQGQSG GAFSSLASMA QSYLGGGQTQ SNQQQYQQQG QNYQHQQQGQ

     301  QQQQGHSSSF SALASMASSY LGNNSNSNSS YGGQQQANEY GRPQHNGQQQ

     351  SNEYGRPQYG GNQNSNGHHE SFNFSGNFSQ QNNNGNQNRY *


Protein Sequence for YCL028W_EC1118 from Genoscope:

YCL028W_EC1118 [source=Genoscope]  Length: 406  Thu Sep 21 06:03:03 2017  Type: P  Check: 4539  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGQGQGQG QGSFTALASL ASSFMNSNNN NQQGQNQSSG

     201  GSSFGALASM ASSFMHSNNN QNSNNSQQGY NQSYQNGNQN SQGYNNQQYQ

     251  GGNGGYQQQQ GQSGGAFSSL ASMAQSYLGG GQTQSNQQQY NQQGQNNQQQ

     301  YQQQGQNYQH QQQGQQQQQG HSSSFSALAS MASSYLGNNS NSNSSYGGQQ

     351  QANEYGRPQQ NGQQQSNEYG RPQYGGNQNS NGQHESFNFS GNFSQQNNNG

     401  NQNRY*

Protein Sequence for YCL028W_EC9-8 from ASinica:

YCL028W_EC9-8 [source=ASinica]  Length: 406  Thu Sep 21 06:03:03 2017  Type: P  Check: 4377  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGQGQGQG QGSFTALASL ASSFMNSNNN NQQGQNQSSG

     201  GSSFGALASM ASSFMHSNNN QNSNNSQQGY NQSYQNGNQN SQGYNNQQYQ

     251  GGNGGYQQQQ GQSGGAFSSL ASMAQSYLGG GQTQSNQQQY NQQGQNNQQQ

     301  YQQQGQNYQH QQQGQQQQQG HSSSFSALAS MASSYLGNNS NSNSSYGGQQ

     351  QANEYGRPQH NGQQQSNEYG RPQYGGNQNS NGQHESFNFS GNFSQQNNNG

     401  NQNRY*

Protein Sequence for YCL028W_FL100 from Stanford:

YCL028W_FL100 [source=Stanford]  Length: 406  Thu Sep 21 06:03:03 2017  Type: P  Check: 4539  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGQGQGQG QGSFTALASL ASSFMNSNNN NQQGQNQSSG

     201  GSSFGALASM ASSFMHSNNN QNSNNSQQGY NQSYQNGNQN SQGYNNQQYQ

     251  GGNGGYQQQQ GQSGGAFSSL ASMAQSYLGG GQTQSNQQQY NQQGQNNQQQ

     301  YQQQGQNYQH QQQGQQQQQG HSSSFSALAS MASSYLGNNS NSNSSYGGQQ

     351  QANEYGRPQQ NGQQQSNEYG RPQYGGNQNS NGQHESFNFS GNFSQQNNNG

     401  NQNRY*

Protein Sequence for YCL028W_FY1679 from Stanford:

YCL028W_FY1679 [source=Stanford]  Length: 406  Thu Sep 21 06:03:03 2017  Type: P  Check: 4539  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGQGQGQG QGSFTALASL ASSFMNSNNN NQQGQNQSSG

     201  GSSFGALASM ASSFMHSNNN QNSNNSQQGY NQSYQNGNQN SQGYNNQQYQ

     251  GGNGGYQQQQ GQSGGAFSSL ASMAQSYLGG GQTQSNQQQY NQQGQNNQQQ

     301  YQQQGQNYQH QQQGQQQQQG HSSSFSALAS MASSYLGNNS NSNSSYGGQQ

     351  QANEYGRPQQ NGQQQSNEYG RPQYGGNQNS NGQHESFNFS GNFSQQNNNG

     401  NQNRY*

Protein Sequence for YCL028W_FostersB from AWRI:

YCL028W_FostersB [source=AWRI]  Length: 236  Thu Sep 21 06:03:03 2017  Type: P  Check: 1069  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMXNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LXKLALLATV

     101  MTHSSNKGSS NRGXDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQDQG QGQGQGQGQG QGQGSFTALA SLASSFMNSN NNNQQGQNQS

     201  SGGSSFGAXA SMAISFMHSN NNQNSNNSQQ GYNQS*

Protein Sequence for YCL028W_FostersO from AWRI:

YCL028W_FostersO [source=AWRI]  Length: 332  Thu Sep 21 06:03:03 2017  Type: P  Check: 3835  ..

       1  MNTLMADSKG SSQTQLXKLA LLATVMTHSS NKGSSNRGXD VGTVMSMLSG

      51  SGGGSQSMGA SGLAALASQF FKSGNNSQGQ GQGQGQGQGQ GQGQGQGSFT

     101  ALASLASSFM NSNNNNQQGQ NQSSGGSSFG AXASMAISFM HSNNNQNSNN

     151  SQQGYNQSYQ NGNQNSQGYN NQQYQGXNGG YQQQQGQSGG AFSSLASMAQ

     201  SYLGGGQTQS NQQQYNQQGQ NNQQQYQQQG QELISTNNRV SSSNKATPVH

     251  SQLWLPWQVP TWAITPIQIR VMGASNRLMS MVDXNTNGQQ QSNEYGRPQY

     301  GGNQNSNGQH ESXNFSGNFS QQNNNGNQNR Y*

Protein Sequence for YCL028W_JAY291 from Duke:

YCL028W_JAY291 [source=Duke]  Length: 227  Thu Sep 21 06:03:03 2017  Type: P  Check: 861  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGSFTALA SLASSFMNSN NNNQQGQNQS SGGSSFGALA

     201  SMASSFMHSN NNQNSNNSQQ GYNQSY*

Protein Sequence for YCL028W_JK9-3d from Stanford:

YCL028W_JK9-3d [source=Stanford]  Length: 406  Thu Sep 21 06:03:03 2017  Type: P  Check: 4539  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGQGQGQG QGSFTALASL ASSFMNSNNN NQQGQNQSSG

     201  GSSFGALASM ASSFMHSNNN QNSNNSQQGY NQSYQNGNQN SQGYNNQQYQ

     251  GGNGGYQQQQ GQSGGAFSSL ASMAQSYLGG GQTQSNQQQY NQQGQNNQQQ

     301  YQQQGQNYQH QQQGQQQQQG HSSSFSALAS MASSYLGNNS NSNSSYGGQQ

     351  QANEYGRPQQ NGQQQSNEYG RPQYGGNQNS NGQHESFNFS GNFSQQNNNG

     401  NQNRY*

Protein Sequence for YCL028W_K11 from Stanford:

YCL028W_K11 [source=Stanford]  Length: 400  Thu Sep 21 06:03:03 2017  Type: P  Check: 5509  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMENRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGQGSFTA LASLASSFMN SNNNNQQGQN QSSGGSSFGA

     201  LASMASSFMH SNNNQNSNNS QQGYNQSYQN GNQNSQGYNN QQYQGGNGGY

     251  QQQQGQSGGA FSSLASMAQS YLGGGQTQSN QQQYNQQGQN NQQQYQQQGQ

     301  NYQHQQQGQQ QQQGHSSSFS ALASMASSYL GNNSNSNSSY GGQQQANEYG

     351  RPQHNGQQQS NEYGRPQYGG NQNSNGQHES FNFSGNFSQQ NNNGNQNRY*


Protein Sequence for YCL028W_Kyokai7 from NRIB:

YCL028W_Kyokai7 [source=NRIB]  Length: 406  Thu Sep 21 06:03:03 2017  Type: P  Check: 4377  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGQGQGQG QGSFTALASL ASSFMNSNNN NQQGQNQSSG

     201  GSSFGALASM ASSFMHSNNN QNSNNSQQGY NQSYQNGNQN SQGYNNQQYQ

     251  GGNGGYQQQQ GQSGGAFSSL ASMAQSYLGG GQTQSNQQQY NQQGQNNQQQ

     301  YQQQGQNYQH QQQGQQQQQG HSSSFSALAS MASSYLGNNS NSNSSYGGQQ

     351  QANEYGRPQH NGQQQSNEYG RPQYGGNQNS NGQHESFNFS GNFSQQNNNG

     401  NQNRY*

Protein Sequence for YCL028W_L1528 from Stanford:

YCL028W_L1528 [source=Stanford]  Length: 406  Thu Sep 21 06:03:03 2017  Type: P  Check: 4539  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGQGQGQG QGSFTALASL ASSFMNSNNN NQQGQNQSSG

     201  GSSFGALASM ASSFMHSNNN QNSNNSQQGY NQSYQNGNQN SQGYNNQQYQ

     251  GGNGGYQQQQ GQSGGAFSSL ASMAQSYLGG GQTQSNQQQY NQQGQNNQQQ

     301  YQQQGQNYQH QQQGQQQQQG HSSSFSALAS MASSYLGNNS NSNSSYGGQQ

     351  QANEYGRPQQ NGQQQSNEYG RPQYGGNQNS NGQHESFNFS GNFSQQNNNG

     401  NQNRY*

Protein Sequence for YCL028W_LalvinQA23 from AWRI:

YCL028W_LalvinQA23 [source=AWRI]  Length: 406  Thu Sep 21 06:03:03 2017  Type: P  Check: 4777  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGQGQGQG QGSFTALASL ASSFMNSNNN NQQGQNQSSG

     201  GSSFGALASM ASSFMHSNNN QNSNNSQQGY NQSYQNGNQN SQGYNNQQYQ

     251  GGNGGYQQQQ GQSGGAFSSL ASMAQSYLGG GQTQSNQQQY NQQGQNNQQQ

     301  YQQQGQNYQH QQQGQQQQXG HSSSFSALAS MASSYLGNNS NSNSSYGGQQ

     351  QANEYGRPQQ NGQQQSNEYG RPQYGGNQNS NGQHESFNFS GNFSQQNNNG

     401  NQNRY*

Protein Sequence for YCL028W_PW5 from WashU:

YCL028W_PW5 [source=WashU]  Length: 391  Thu Sep 21 06:03:03 2017  Type: P  Check: 9023  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  LTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQSQG QGQGQGQGSF TALASLASSF MNSNNNNQQG QNQSSGGSSF

     201  GALASMASSF MHSNNNQNSN NSQQGYNQSY QNGSQNSQGY NNQQYQGGNG

     251  GYQQQQGQSG GAFSSLASMA QSYLGGGQTQ SNQQQYQQQG QNYQHQQQGQ

     301  QQQQGHSSSF SALASMASSY LGNNSNSNSS YGGQQQANEY GRPQHNGQQQ

     351  SNEYGRPQYG GNQNSNGHHE SFNFSGNFSQ QNNNGNQNRY *


Protein Sequence for YCL028W_RM11-1a from Stanford:

YCL028W_RM11-1a [source=Stanford]  Length: 406  Thu Sep 21 06:03:03 2017  Type: P  Check: 4539  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGQGQGQG QGSFTALASL ASSFMNSNNN NQQGQNQSSG

     201  GSSFGALASM ASSFMHSNNN QNSNNSQQGY NQSYQNGNQN SQGYNNQQYQ

     251  GGNGGYQQQQ GQSGGAFSSL ASMAQSYLGG GQTQSNQQQY NQQGQNNQQQ

     301  YQQQGQNYQH QQQGQQQQQG HSSSFSALAS MASSYLGNNS NSNSSYGGQQ

     351  QANEYGRPQQ NGQQQSNEYG RPQYGGNQNS NGQHESFNFS GNFSQQNNNG

     401  NQNRY*

Protein Sequence for YCL028W_RedStar from Stanford:

YCL028W_RedStar [source=Stanford]  Length: 406  Thu Sep 21 06:03:03 2017  Type: P  Check: 4539  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGQGQGQG QGSFTALASL ASSFMNSNNN NQQGQNQSSG

     201  GSSFGALASM ASSFMHSNNN QNSNNSQQGY NQSYQNGNQN SQGYNNQQYQ

     251  GGNGGYQQQQ GQSGGAFSSL ASMAQSYLGG GQTQSNQQQY NQQGQNNQQQ

     301  YQQQGQNYQH QQQGQQQQQG HSSSFSALAS MASSYLGNNS NSNSSYGGQQ

     351  QANEYGRPQQ NGQQQSNEYG RPQYGGNQNS NGQHESFNFS GNFSQQNNNG

     401  NQNRY*

Protein Sequence for YCL028W_SEY6210 from Stanford:

YCL028W_SEY6210 [source=Stanford]  Length: 406  Thu Sep 21 06:03:03 2017  Type: P  Check: 4539  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGQGQGQG QGSFTALASL ASSFMNSNNN NQQGQNQSSG

     201  GSSFGALASM ASSFMHSNNN QNSNNSQQGY NQSYQNGNQN SQGYNNQQYQ

     251  GGNGGYQQQQ GQSGGAFSSL ASMAQSYLGG GQTQSNQQQY NQQGQNNQQQ

     301  YQQQGQNYQH QQQGQQQQQG HSSSFSALAS MASSYLGNNS NSNSSYGGQQ

     351  QANEYGRPQQ NGQQQSNEYG RPQYGGNQNS NGQHESFNFS GNFSQQNNNG

     401  NQNRY*

Protein Sequence for YCL028W_SK1 from Stanford:

YCL028W_SK1 [source=Stanford]  Length: 406  Thu Sep 21 06:03:03 2017  Type: P  Check: 4539  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGQGQGQG QGSFTALASL ASSFMNSNNN NQQGQNQSSG

     201  GSSFGALASM ASSFMHSNNN QNSNNSQQGY NQSYQNGNQN SQGYNNQQYQ

     251  GGNGGYQQQQ GQSGGAFSSL ASMAQSYLGG GQTQSNQQQY NQQGQNNQQQ

     301  YQQQGQNYQH QQQGQQQQQG HSSSFSALAS MASSYLGNNS NSNSSYGGQQ

     351  QANEYGRPQQ NGQQQSNEYG RPQYGGNQNS NGQHESFNFS GNFSQQNNNG

     401  NQNRY*

Protein Sequence for YCL028W_T7 from WashU:

YCL028W_T7 [source=WashU]  Length: 404  Thu Sep 21 06:03:03 2017  Type: P  Check: 3454  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGQGQGQG SFTALASLAS SFMNSNNNNQ QGQNQSSGGS

     201  SFGALASMAS SFMHSNNNQN SNNSQQGYNQ SYQNGNQNSQ GYNNQQYQGG

     251  NGGYQQQQGQ SGGAFSSLAS MAQSYLGGGQ TQSNQQQYNQ QGQNNQQQYQ

     301  QQGQNYQHQQ QGQQQQQGHS SSFSALASMA SSYLGNNSNS NSSYGGQQQA

     351  NEYGRPQHNG QQQSNEYGRP QYGGNQNSNG HHESFNFSGN FSQQNNNGNQ

     401  NRY*

Protein Sequence for YCL028W_UC5 from WashU:

YCL028W_UC5 [source=WashU]  Length: 406  Thu Sep 21 06:03:03 2017  Type: P  Check: 4377  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGQGQGQG QGSFTALASL ASSFMNSNNN NQQGQNQSSG

     201  GSSFGALASM ASSFMHSNNN QNSNNSQQGY NQSYQNGNQN SQGYNNQQYQ

     251  GGNGGYQQQQ GQSGGAFSSL ASMAQSYLGG GQTQSNQQQY NQQGQNNQQQ

     301  YQQQGQNYQH QQQGQQQQQG HSSSFSALAS MASSYLGNNS NSNSSYGGQQ

     351  QANEYGRPQH NGQQQSNEYG RPQYGGNQNS NGQHESFNFS GNFSQQNNNG

     401  NQNRY*

Protein Sequence for YCL028W_UWOPS05_217_3 from Stanford:

YCL028W_UWOPS05_217_3 [source=Stanford]  Length: 425  Thu Sep 21 06:03:03 2017  Type: P  Check: 9534  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGQGQGQG XXXXQGQGQG QGQGQGQGSF TALASLASSF

     201  MNSNNNNQQG QNQSSGGSSF GALASMASSF MHSNNNQNSN NSQQGYNQSY

     251  QNGNQNSQGY NNQQYQGGNG GYQQQQGQSG GAFSSLASMA QSYLGGGQTQ

     301  SNQQQYQQQG QNYQHQQQGQ QQQQGHSSSF SALASMASSY LGNNSNSNSS

     351  YGGQQQANEY GRPQHNGQQQ SNEYGRPQHN GQQQSNEYGR PQYGGNQNSN

     401  GQHESFNFSG NFSQQNNNGN QNRY*

Protein Sequence for YCL028W_VL3 from AWRI:

YCL028W_VL3 [source=AWRI]  Length: 406  Thu Sep 21 06:03:03 2017  Type: P  Check: 4539  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGQGQGQG QGSFTALASL ASSFMNSNNN NQQGQNQSSG

     201  GSSFGALASM ASSFMHSNNN QNSNNSQQGY NQSYQNGNQN SQGYNNQQYQ

     251  GGNGGYQQQQ GQSGGAFSSL ASMAQSYLGG GQTQSNQQQY NQQGQNNQQQ

     301  YQQQGQNYQH QQQGQQQQQG HSSSFSALAS MASSYLGNNS NSNSSYGGQQ

     351  QANEYGRPQQ NGQQQSNEYG RPQYGGNQNS NGQHESFNFS GNFSQQNNNG

     401  NQNRY*

Protein Sequence for YCL028W_Vin13 from AWRI:

YCL028W_Vin13 [source=AWRI]  Length: 399  Thu Sep 21 06:03:03 2017  Type: P  Check: 157  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSXSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGQGQGQG QGSFTALASL ASSFMNSNNN NQQGQNQSSG

     201  GSSFGALASM ASSFMHSNNN QNSNNSQQGY NQSYQNGNQN SQGYNNQQYQ

     251  GGNGGYQQQQ GQSGGAFSSL ASMAQSYLGG GQTQSNQQQY NQQGQNNQQQ

     301  YQQQGQNYQH QQQGQQQQXG HSSSFSALAS MASSYLGNNS NSNSSYGGQQ

     351  QANEYGRPQQ NGQQQSNEYG RPQYGGNQNS NGQHESFNFS GNFFSTEQ*


Protein Sequence for YCL028W_W303 from Stanford:

YCL028W_W303 [source=Stanford]  Length: 406  Thu Sep 21 06:03:03 2017  Type: P  Check: 4539  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGQGQGQG QGSFTALASL ASSFMNSNNN NQQGQNQSSG

     201  GSSFGALASM ASSFMHSNNN QNSNNSQQGY NQSYQNGNQN SQGYNNQQYQ

     251  GGNGGYQQQQ GQSGGAFSSL ASMAQSYLGG GQTQSNQQQY NQQGQNNQQQ

     301  YQQQGQNYQH QQQGQQQQQG HSSSFSALAS MASSYLGNNS NSNSSYGGQQ

     351  QANEYGRPQQ NGQQQSNEYG RPQYGGNQNS NGQHESFNFS GNFSQQNNNG

     401  NQNRY*

Protein Sequence for YCL028W_X2180-1A from Stanford:

YCL028W_X2180-1A [source=Stanford]  Length: 406  Thu Sep 21 06:03:03 2017  Type: P  Check: 4539  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGQGQGQG QGSFTALASL ASSFMNSNNN NQQGQNQSSG

     201  GSSFGALASM ASSFMHSNNN QNSNNSQQGY NQSYQNGNQN SQGYNNQQYQ

     251  GGNGGYQQQQ GQSGGAFSSL ASMAQSYLGG GQTQSNQQQY NQQGQNNQQQ

     301  YQQQGQNYQH QQQGQQQQQG HSSSFSALAS MASSYLGNNS NSNSSYGGQQ

     351  QANEYGRPQQ NGQQQSNEYG RPQYGGNQNS NGQHESFNFS GNFSQQNNNG

     401  NQNRY*

Protein Sequence for YCL028W_Y55 from Stanford:

YCL028W_Y55 [source=Stanford]  Length: 406  Thu Sep 21 06:03:03 2017  Type: P  Check: 4539  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGQGQGQG QGSFTALASL ASSFMNSNNN NQQGQNQSSG

     201  GSSFGALASM ASSFMHSNNN QNSNNSQQGY NQSYQNGNQN SQGYNNQQYQ

     251  GGNGGYQQQQ GQSGGAFSSL ASMAQSYLGG GQTQSNQQQY NQQGQNNQQQ

     301  YQQQGQNYQH QQQGQQQQQG HSSSFSALAS MASSYLGNNS NSNSSYGGQQ

     351  QANEYGRPQQ NGQQQSNEYG RPQYGGNQNS NGQHESFNFS GNFSQQNNNG

     401  NQNRY*

Protein Sequence for YCL028W_YJM269 from WashU:

YCL028W_YJM269 [source=WashU]  Length: 404  Thu Sep 21 06:03:03 2017  Type: P  Check: 3454  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGQGQGQG SFTALASLAS SFMNSNNNNQ QGQNQSSGGS

     201  SFGALASMAS SFMHSNNNQN SNNSQQGYNQ SYQNGNQNSQ GYNNQQYQGG

     251  NGGYQQQQGQ SGGAFSSLAS MAQSYLGGGQ TQSNQQQYNQ QGQNNQQQYQ

     301  QQGQNYQHQQ QGQQQQQGHS SSFSALASMA SSYLGNNSNS NSSYGGQQQA

     351  NEYGRPQHNG QQQSNEYGRP QYGGNQNSNG HHESFNFSGN FSQQNNNGNQ

     401  NRY*

Protein Sequence for YCL028W_YJM339 from Stanford:

YCL028W_YJM339 [source=Stanford]  Length: 406  Thu Sep 21 06:03:03 2017  Type: P  Check: 4539  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGQGQGQG QGSFTALASL ASSFMNSNNN NQQGQNQSSG

     201  GSSFGALASM ASSFMHSNNN QNSNNSQQGY NQSYQNGNQN SQGYNNQQYQ

     251  GGNGGYQQQQ GQSGGAFSSL ASMAQSYLGG GQTQSNQQQY NQQGQNNQQQ

     301  YQQQGQNYQH QQQGQQQQQG HSSSFSALAS MASSYLGNNS NSNSSYGGQQ

     351  QANEYGRPQQ NGQQQSNEYG RPQYGGNQNS NGQHESFNFS GNFSQQNNNG

     401  NQNRY*

Protein Sequence for YCL028W_YJM789 from Stanford:

YCL028W_YJM789 [source=Stanford]  Length: 395  Thu Sep 21 06:03:03 2017  Type: P  Check: 3607  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGQGQGQG QGSFTALASL ASSFMNSNNN NQQGQNQSSG

     201  GSSFGALASM ASSFMHSNNN QNSNNSQQGY NQSYQNGNQN SQGYNNQQYQ

     251  GGNGGYQQQQ GQSGGAFSSL ASMAQSYLGG GQTQSNQQQY NQQGQNYQHQ

     301  QQGQQQQQGH SSSFSALASM ASSYLGNNSN SNSSYGGQQQ ANEYGRPQQN

     351  GQQQSNEYGR PQYGGNQNSN GQHESFNFSG NFSQQNNNGN QNRY*


Protein Sequence for YCL028W_YPH499 from Stanford:

YCL028W_YPH499 [source=Stanford]  Length: 406  Thu Sep 21 06:03:03 2017  Type: P  Check: 4539  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGQGQGQG QGSFTALASL ASSFMNSNNN NQQGQNQSSG

     201  GSSFGALASM ASSFMHSNNN QNSNNSQQGY NQSYQNGNQN SQGYNNQQYQ

     251  GGNGGYQQQQ GQSGGAFSSL ASMAQSYLGG GQTQSNQQQY NQQGQNNQQQ

     301  YQQQGQNYQH QQQGQQQQQG HSSSFSALAS MASSYLGNNS NSNSSYGGQQ

     351  QANEYGRPQQ NGQQQSNEYG RPQYGGNQNS NGQHESFNFS GNFSQQNNNG

     401  NQNRY*

Protein Sequence for YCL028W_YPS128 from Stanford:

YCL028W_YPS128 [source=Stanford]  Length: 406  Thu Sep 21 06:03:03 2017  Type: P  Check: 4019  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGQGQGQG QGSFTALASL ASSFMNSNNN NQQGQNQSSG

     201  GSSFGALASM ASSFMHSNNN QNSNNSQQGC NQSYQNGNQN SQGYNNQQYQ

     251  GGNGGYQQQQ GQSGGAFSSL ASMAQSYLGG GQTQSNQQQY NQQGQSNQQQ

     301  YQQQGQNYQH QQQGQQQQQG HSSSFSALAS MASSYLGNNS NSNSSYGGQQ

     351  QANEYGRPQH NGQQQSNEYG RPQYGGNQNS NGHHESFNFS GNFSQQNNNG

     401  NQNRY*

Protein Sequence for YCL028W_YPS163 from Stanford:

YCL028W_YPS163 [source=Stanford]  Length: 406  Thu Sep 21 06:03:03 2017  Type: P  Check: 4019  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGQGQGQG QGSFTALASL ASSFMNSNNN NQQGQNQSSG

     201  GSSFGALASM ASSFMHSNNN QNSNNSQQGC NQSYQNGNQN SQGYNNQQYQ

     251  GGNGGYQQQQ GQSGGAFSSL ASMAQSYLGG GQTQSNQQQY NQQGQSNQQQ

     301  YQQQGQNYQH QQQGQQQQQG HSSSFSALAS MASSYLGNNS NSNSSYGGQQ

     351  QANEYGRPQH NGQQQSNEYG RPQYGGNQNS NGHHESFNFS GNFSQQNNNG

     401  NQNRY*

Protein Sequence for YCL028W_YS9 from Stanford:

YCL028W_YS9 [source=Stanford]  Length: 402  Thu Sep 21 06:03:03 2017  Type: P  Check: 4974  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGQGQGSF TALASLASSF MNSNNNNQQG QNQSSGGSSF

     201  GALASMASSF MHSNNNQNSN NSQQGYNQSY QNGNQNSQGY NNQQYQGGNG

     251  GYQQQQGQSG GAFSSLASMA QSYLGGGQTQ SNQQQYNQQG QNNQQQYQQQ

     301  GQNYQHQQQG QQQQQGHSSS FSALASMASS YLGNNSNSNS SYGGQQQANE

     351  YGRPQQNGQQ QSNEYGRPQY GGNQNSNGQH ESFNFSGNFS QQNNNGNQNR

     401  Y*

Protein Sequence for YCL028W_ZTW1 from Zhejiang:

YCL028W_ZTW1 [source=Zhejiang]  Length: 404  Thu Sep 21 06:03:03 2017  Type: P  Check: 3805  ..

       1  MDTDKLISEA ESHFSQGNHA EAVAKLTSAA QSNPNDEQMS TIESLIQKIA

      51  GYVMDNRSGG SDASQDRAAG GGSSFMNTLM ADSKGSSQTQ LGKLALLATV

     101  MTHSSNKGSS NRGFDVGTVM SMLSGSGGGS QSMGASGLAA LASQFFKSGN

     151  NSQGQGQGQG QGQGQGQGQG SFTALASLAS SFMNSNNNNQ QGQNQSSGGS

     201  SFGALASMAS SFMHSNNNQN SNNSQQGYNQ SYQNGNQNSQ GYNNQQYQGG

     251  NGGYQQQQGQ SGGAFSSLAS MAQSYLGGGQ TQSNQQQYNQ QGQNNQQQYQ

     301  QQGQNYQHQQ QGQQQQQGHS SSFSALASMA SSYLGNNSNS NSSYGGQQQA

     351  NEYGRPQHNG QQQSNEYGRP QYGGNQNSNG QHESFNFSGN FSQQNNNGNQ

     401  NRY*