PCA1/YBR295W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YBR295W_S288C   1   MKPEKLFSGLGTSDGEYGVVNSENISIDAMQDNRGECHRRSIEMHANDNL   50
YBR295W_AWRI1631   1   MKPEKLFSGLGTSDGEYGVVNSENISIDAMQDNRGECHRRSIEMHANDNL   50
YBR295W_AWRI796   1   MKPEKLFSGLGTSDGEYGVVNSENISIDAMQDNRGECHRRSIEMHANDNL   50
YBR295W_BC187   1   MKPEKLFSGLGTSDGEYGVVNSENISIDAMQDNRGECHRRSIEMHANDNL   50
YBR295W_BY4741   1   MKPEKLFSGLGTSDGEYGVVNSENISIDAMQDNRGECHRRSIEMHANDNL   50
YBR295W_BY4742   1   MKPEKLFSGLGTSDGEYGVVNSENISIDAMQDNRGECHRRSIEMHANDNL   50
YBR295W_CBS7960   1   MKPEKLFSGLGTSDGEYGVVNSENISIDATQDNRGECHRRSIEMHANDNL   50
YBR295W_CEN.PK   1   MKPEKLFSGLGTSDGEYGVVNSENISIDAMQDNRGECHRRSIEMHANDNL   50
YBR295W_CLIB215   
   --------------------------------------------------   
YBR295W_CLIB324   
   --------------------------------------------------   
YBR295W_D273-10B   1   MKPEKLFSGLGTSDGEYGVVNSENISIDAMQDNRGECHRRSIEMHANDNL   50
YBR295W_DBVPG6044   1   MKPEKLFSGLGTSDGEYGVVNSENISIDAMQDNRGECHRRSIEMHANDNL   50
YBR295W_EC1118   1   MKPEKLFSGLGTSDGEYGVVNSENISIDAMQDNRGECHRRSIEMHANDNL   50
YBR295W_EC9-8   1   MKPEKLFSGLGTSDGEYGVVNSENISIDAMQDNRGECHPRSIEMHANDNL   50
YBR295W_FL100   1   MKPEKLFSGLGTSDGEYGVVNSENISIDAMQDNRGECHRRSIEMHANDNL   50
YBR295W_FY1679   1   MKPEKLFSGLGTSDGEYGVVNSENISIDAMQDNRGECHRRSIEMHANDNL   50
YBR295W_FostersB   
   --------------------------------------------------   
YBR295W_FostersO   1   MKPEKLFSGLGTSDGEYGVVNSENISIDAMQDNRGECHRRSIEMHANDNL   50
YBR295W_JAY291   1   MKPEKLFSGLGTSDGEYGVVNSENISIDAMQDNRGECHRRSIEMHANDNL   50
YBR295W_JK9-3d   1   -------------------------------------------MHANDNL   7
YBR295W_K11   1   MKPEKLFSGLGTSDGEYGVVNSENISIDAMQDNRGECHRRSIEMHANDNL   50
YBR295W_Kyokai7   1   MKPEKLFSGLGTSDGEYGVVNSENISIDAMQDNRGECHRRSIEMHANDNL   50
YBR295W_L1528   1   MKPEKLFSGLGTSDGEYGVVNSENISIDAMQDNRGECHRRSIEMHANDNL   50
YBR295W_LalvinQA23   
   --------------------------------------------------   
YBR295W_PW5   1   MKPEKLFSGLGTSDGEYGVVNSENISIDAMQDNRGECHRRSIEMHANDNL   50
YBR295W_RM11-1a   1   MKPEKLFSGLGTSDGEYGVVNSENISIDAMQDNRGECHRRSIEMHANDNL   50
YBR295W_RedStar   1   MKPEKLFSGLGTSDGEYGVVNSENISIDAMQDNRGECHRRSIEMHANDNL   50
YBR295W_SEY6210   1   MKPEKLFSGLGTSDGEYGVVNSENISIDAMQDNRGECHRRSIEMHANDNL   50
YBR295W_SK1   1   MKPEKLFSGLGTSDGEYGVVNSENISIDAMQDNRGECHRRSIEMHANDNL   50
YBR295W_T7   1   MKPEKLFSGLGTSDGEYGVVNSENISIDAMQDNRGECHRRSIEMHANDNL   50
YBR295W_UC5   1   MKPEKLFSGLGTSDGEYGVVNSENISIDAMQDNRGECHRRSIEMHANDNL   50
YBR295W_UWOPS05_217_3   1   MKPEKLFSGLGTSDGEYGVVNSENISIDAMQDNRGECHRRSIEMHANDNL   50
YBR295W_VL3   1   MKPEKLFSGLGTSDGEYGVVNSENISIDAMQDNRGECHRRSIEMHANDNL   50
YBR295W_Vin13   
   --------------------------------------------------   
YBR295W_W303   1   MKPEKLFSGLGTSDGEYGVVNSENISIDAMQDNRGECHRRSIEMHANDNL   50
YBR295W_X2180-1A   1   MKPEKLFSGLGTSDGEYGVVNSENISIDAMQDNRGECHRRSIEMHANDNL   50
YBR295W_Y55   1   MKPEKLFSGLGTSDGEYGVVNSENISIDAMQDNRGECHRRSIEMHANDNL   50
YBR295W_YJM269   1   MKPEKLFSGLGTSDGEYGVVNSENISIDAMQDNRGECHPRSIEMHANDNL   50
YBR295W_YJM789   1   MKPEKLFSGLGTSDGEYGVVNSENISIDAMQDNRGECHRRSIEMHANDNL   50
YBR295W_YPH499   1   MKPEKLFSGLGTSDGEYGVVNSENISIDAMQDNRGECHRRSIEMHANDNL   50
YBR295W_YPS128   1   MKPEKLFSGLGTSDGEYGVVNSENISIDAMQDNRGECHRRSIEMHANDNL   50
YBR295W_YPS163   1   MKPEKLFSGLGTSDGEYGVVNSENISIDAMQDNRGECHRRSIEMHANDNL   50
YBR295W_YS9   1   MKPEKLFSGLGTSDGEYGVVNSENISIDAMQDNRGECHRRSIEMHANDNL   50
YBR295W_ZTW1   1   MKPEKLFSGLGTSDGEYGVVNSENISIDAMQDNRGECHRRSIEMHANDNL   50
         

YBR295W_S288C   51   GLVSQRDCTNRPKITPQECLSETEQICHHGENRTKAGLDVDDAETG----   96
YBR295W_AWRI1631   51   GLVSQRDCTNRPKITPQECLSETEQICHHGENRTKAGLDVDDAETG----   96
YBR295W_AWRI796   51   GLVSQRDCTNRPKITPQECLSETEQICHHGENRTKAGLDVDDAETG----   96
YBR295W_BC187   51   GLVSQRDCTNRPKITPQECLSETEQICHHGENRTKAGLDVDDAETG----   96
YBR295W_BY4741   51   GLVSQRDCTNRPKITPQECLSETEQICHHGENRTKAGLDVDDAETG----   96
YBR295W_BY4742   51   GLVSQRDCTNRPKITPQECLSETEQICHHGENRTKAGLDVDDAETG----   96
YBR295W_CBS7960   51   GLVSQRDCTNRPKITPQECLSETEQICHHGENRTKAGLDVDDAETG----   96
YBR295W_CEN.PK   51   GLVSQRDCTNRPKITPQECLSETEQICHHGENRTKAGLDVDDAETG----   96
YBR295W_CLIB215   
   --------------------------------------------------   
YBR295W_CLIB324   1   ------------------------------MLMTIWDWSPSETVPNRPKI   20
YBR295W_D273-10B   51   GLVSQRDCTNRPKITPQECLSETEQICHHGENRTKAGLDVDDAETG----   96
YBR295W_DBVPG6044   51   GLVSQRDCTNRPKITPQECLSETEQICHHGENRTKAGLDVDDAETG----   96
YBR295W_EC1118   51   GLVSQRDCTNRPKITPQECLSETEQICHHGENRTKAGLDVDDAETG----   96
YBR295W_EC9-8   51   RLVSERDCTNRPKITPQECLSETEQICHHGENRTKAGLDVDDAETG----   96
YBR295W_FL100   51   GLVSQRDCTNRPKITPQECLSETEQICHHGENRTKAGLDVDDAETG----   96
YBR295W_FY1679   51   GLVSQRDCTNRPKITPQECLSETEQICHHGENRTKAGLDVDDAETG----   96
YBR295W_FostersB   
   --------------------------------------------------   
YBR295W_FostersO   51   GLVSQRDCTNRPKITPQECLSETEQICHHGENRTKAGLDVDDAETG----   96
YBR295W_JAY291   51   GLVSQRDCTNRPKITPQECLSETEQICHHGENRTKAGLDVDDAETG----   96
YBR295W_JK9-3d   8   GLVSQRDCTNRPKITPQECLSETEQICHHGENRTKAGLDVDDAETGGDHT   57
YBR295W_K11   51   GLVSQRDCTNRPKITPQECLSETEQICHHGENRTKAGLDVDDAETG----   96
YBR295W_Kyokai7   51   GLVSQRDCTNRPKITPQECLSETEQICHHGENRTKAGLDVDDAETG----   96
YBR295W_L1528   51   GLVSQRDCTNRPKITPQECLSETEQICHHGENRTKAGLDVDDAETG----   96
YBR295W_LalvinQA23   
   --------------------------------------------------   
YBR295W_PW5   51   GLVSQRDCTNRPKITPQECLSETEQICHHGENRTKAGLDVDDAETG----   96
YBR295W_RM11-1a   51   GLVSQRDCTNRPKITPQECLSETEQICHHGENRTKAGLDVDDAETG----   96
YBR295W_RedStar   51   GLVSQRDCTNRPKITPQECLSETEQICHHGENRTKAGLDVDDAETG----   96
YBR295W_SEY6210   51   GLVSQRDCTNRPKITPQECLSETEQICHHGENRTKAGLDVDDAETG----   96
YBR295W_SK1   51   GLVSQRDCTNRPKITPQECLSETEQICHHGENRTKAGLDVDDAETG----   96
YBR295W_T7   51   GLVSQRDCTNRPKITPQECLSETEQICHHGENRTKAGLDVDDAETG----   96
YBR295W_UC5   51   GLVSQRDCTNRPKITPQECLSETEQICHHGENRTKAGLDVDDAETG----   96
YBR295W_UWOPS05_217_3   51   GLVSQRDCTNRPKITPQECLSETEQICHHGENRTKAGLDVDDAETG----   96
YBR295W_VL3   51   GLVSQRDCTNRPKITPQECLSETEQICHHGENRTKAGLDVDDAETG----   96
YBR295W_Vin13   
   --------------------------------------------------   
YBR295W_W303   51   GLVSQRDCTNRPKITPQECLSETEQICHHGENRTKAGLDVDDAETG----   96
YBR295W_X2180-1A   51   GLVSQRDCTNRPKITPQECLSETEQICHHGENRTKAGLDVDDAETG----   96
YBR295W_Y55   51   GLVSQRDCTNRPKITPQECLSETEQICHHGENRTKAGLDVDDAETG----   96
YBR295W_YJM269   51   RLVSERDCTNRPKITPQECLSETEQICHHGENRTKAGLDVDDAETGGDHT   100
YBR295W_YJM789   51   GLVSQRDCTNRPKITPQECLSETEQICHHGENRTKAGLDVDDAETG----   96
YBR295W_YPH499   51   GLVSQRDCTNRPKITPQECLSETEQICHHGENRTKAGLDVDDAETG----   96
YBR295W_YPS128   51   GLVSQRDCTNRPKITPQECLSETEQICHHGENRTKAGLDVDDAETG----   96
YBR295W_YPS163   51   GLVSQRDCTNRPKITPQECLSETEQICHHGENRTKAGLDVDDAETG----   96
YBR295W_YS9   51   GLVSQRDCTNRPKITPQECLSETEQICHHGENRTKAGLDVDDAETG----   96
YBR295W_ZTW1   51   GLVSQRDCTNRPKITPQECLSETEQICHHGENRTKAGLDVDDAETG----   96
         

YBR295W_S288C   97   --------------------------------GDHTNESRVDECCAEKVN   114
YBR295W_AWRI1631   97   --------------------------------GDHTNESRVDECCAEKVN   114
YBR295W_AWRI796   97   --------------------------------GDHTNESRVDECCAEKVN   114
YBR295W_BC187   97   --------------------------------GDHTNESRVDECCAEKVN   114
YBR295W_BY4741   97   --------------------------------GDHTNESRVDECCAEKVN   114
YBR295W_BY4742   97   --------------------------------GDHTNESRVDECCAEKVN   114
YBR295W_CBS7960   97   --------------------------------GDHTNESRVDECCAEKVN   114
YBR295W_CEN.PK   97   --------------------------------GDHTNESRVDECCAEKVN   114
YBR295W_CLIB215   
   --------------------------------------------------   
YBR295W_CLIB324   21   TPQECLSETEQICHHGENRTKAGLDVDDAETGGDHTNESRVDECCAEKVN   70
YBR295W_D273-10B   97   --------------------------------GDHTNESRVDECCAEKVN   114
YBR295W_DBVPG6044   97   --------------------------------GDHTNESRVDECCAEKVN   114
YBR295W_EC1118   97   --------------------------------GDHTNESRVDECCPEKVN   114
YBR295W_EC9-8   97   --------------------------------GDHTNESCADECYAKKAN   114
YBR295W_FL100   97   --------------------------------GDHTNESRVDECCAEKVN   114
YBR295W_FY1679   97   --------------------------------GDHTNESRVDECCAEKVN   114
YBR295W_FostersB   
   --------------------------------------------------   
YBR295W_FostersO   97   --------------------------------GDHTNESRVDECCAEKVN   114
YBR295W_JAY291   97   --------------------------------GDHTNESRVDECCAEKVN   114
YBR295W_JK9-3d   58   NESRVDECCAEKVNDTETGLDVDSCCGDAQTGGDHTNESCADECCAKKAN   107
YBR295W_K11   97   --------------------------------GDHTNESRVDECCAEKVN   114
YBR295W_Kyokai7   97   --------------------------------GDHTNESRVDECCAEKVN   114
YBR295W_L1528   97   --------------------------------GDHTNESRVDECCAEKVN   114
YBR295W_LalvinQA23   
   --------------------------------------------------   
YBR295W_PW5   97   --------------------------------GDHTNESRVDECCAEKVN   114
YBR295W_RM11-1a   97   --------------------------------GDHTNESRVDECCAEKVN   114
YBR295W_RedStar   97   --------------------------------GDHTNESRVDECCAEKVN   114
YBR295W_SEY6210   97   --------------------------------GDHTNESRVDECCAEKVN   114
YBR295W_SK1   97   --------------------------------GDHTNESRVDECCAEKVN   114
YBR295W_T7   97   --------------------------------GDHTNESRVDECCAEKVN   114
YBR295W_UC5   97   --------------------------------GDHTNESRVDECCAEKVN   114
YBR295W_UWOPS05_217_3   97   --------------------------------GDHTNESRVDECCAEKVN   114
YBR295W_VL3   97   --------------------------------GDHTNESRVDECCAEKVN   114
YBR295W_Vin13   1   ---------------------------MLKPVVITPMNPRVDECCAEKVN   23
YBR295W_W303   97   --------------------------------GDHTNESRVDECCAEKVN   114
YBR295W_X2180-1A   97   --------------------------------GDHTNESRVDECCAEKVN   114
YBR295W_Y55   97   --------------------------------GDHTNESRVDECCAEKVN   114
YBR295W_YJM269   101   NESCADECCAKKANGTETGLDVDSCCGDAQTGGDHTNESCADECCAKKAN   150
YBR295W_YJM789   97   --------------------------------GDHTNESRVDECCAEKVN   114
YBR295W_YPH499   97   --------------------------------GDHTNESRVDECCAEKVN   114
YBR295W_YPS128   97   --------------------------------GDHTNESRVDECCAEKVN   114
YBR295W_YPS163   97   --------------------------------GDHTNESRVDECCAEKVN   114
YBR295W_YS9   97   --------------------------------GDHTNESRVDECCAEKVN   114
YBR295W_ZTW1   97   --------------------------------GDHTNESRVDECCAEKVN   114
         

YBR295W_S288C   115   DTETGLDVDSCCGDAQTGGDHTNESCVDGCCVRDSSVMVEEVTGSCEAVS   164
YBR295W_AWRI1631   115   DTETGLDVDSCCGDAQTGGDHTNESCVDGCCVRDSSVMVEEVTGSCEAVS   164
YBR295W_AWRI796   115   DTETGLDVDSCCGDAQTGGDHTNESCVDGCCVRDSSVMVEEVTGSCEAVS   164
YBR295W_BC187   115   DTETGLDVDSCCGDAQTGGDHTNESCVDGCCVRDSSVMVEEVTGSCEAVS   164
YBR295W_BY4741   115   DTETGLDVDSCCGDAQTGGDHTNESCVDGCCVRDSSVMVEEVTGSCEAVS   164
YBR295W_BY4742   115   DTETGLDVDSCCGDAQTGGDHTNESCVDGCCVRDSSVMVEEVTGSCEAVS   164
YBR295W_CBS7960   115   DTETGLDVDSCCGDAQTGGDHTNESCVDGCCVRDSSVMVEEVTGSCEAVS   164
YBR295W_CEN.PK   115   DTETGLDVDSCCGDAQTGGDHTNESCVDGCCVRDSSVMVEEVTGSCEAVS   164
YBR295W_CLIB215   
   --------------------------------------------------   
YBR295W_CLIB324   71   DTETGLDVDSCCGDAQTGGDHTNESCVDGCCVRDSSVMVEEVTGSCEAVS   120
YBR295W_D273-10B   115   DTETGLDVDSCCGDAQTGGDHTNESCVDGCCVRDSSVMVEEVTGSCEAVS   164
YBR295W_DBVPG6044   115   DTETGLDVDSCCGDAQTGGDHTNESCVDECCVRDSSVMVEEGTGSCEAVS   164
YBR295W_EC1118   115   DTETGLDVDSCCGDAQTGGDHTNESCVDGCCVRDSSVMVEEVTGSCEAVS   164
YBR295W_EC9-8   115   GTETGLDVDSCCGDAQTGGDHTNESCVDECCVRDSSVMVEEVTGSCEAVS   164
YBR295W_FL100   115   DTETGLDVDSCCGDAQTGGDHTNESCVDECCVRDSSVMVEEGTGSCEAVS   164
YBR295W_FY1679   115   DTETGLDVDSCCGDAQTGGDHTNESCVDGCCVRDSSVMVEEVTGSCEAVS   164
YBR295W_FostersB   
   --------------------------------------------------   
YBR295W_FostersO   115   DTETGLDVDSCCGDAQTGGDHTNESCVDGCCVRDSSVMVEEVTGSCEAVS   164
YBR295W_JAY291   115   DTETGLDVDSCCGDAQTGGDHTNESCVDGCCVRDSSVMVEEVTGSCEAVS   164
YBR295W_JK9-3d   108   DTETGLDVDSCCGDAQTGGDHTNESCVDECCVRDSSVMVEEGTGSCEAVS   157
YBR295W_K11   115   DTETGLDVDSCCGDAQTGGDHTNESCVDECCVRDSSVMVEEGTGSCEAVS   164
YBR295W_Kyokai7   115   DTETGLDVDSCCGDAQTGGDHTNESCVDECCVRDSSVMVEEGTGSCEAVS   164
YBR295W_L1528   115   DTETGLDVDSCCGDAQTGGDHTNESCVDGCCVRDSSVMVEEVTGSCEAVS   164
YBR295W_LalvinQA23   
   --------------------------------------------------   
YBR295W_PW5   115   DTETGLDVDSCCGDAQTGGDHTNESCVDECCVRDSSVMVEEGTGSCEAVS   164
YBR295W_RM11-1a   115   DTETGLDVDSCCGDAQTGGDHTNESCVDGCCVRDSSVMVEEVTGSCEAVS   164
YBR295W_RedStar   115   DTETGLDVDSCCGDAQTGGDHTNESCVDGCCVRDSSVMVEEVTGSCEAVS   164
YBR295W_SEY6210   115   DTETGLDVDSCCGDAQTGGDHTNESCVDGCCVRDSSVMVEEVTGSCEAVS   164
YBR295W_SK1   115   DTETGLDVDSCCGDAQTGGDHTNESCVDECCVRDSSVMVEEGTGSCEAVS   164
YBR295W_T7   115   DTETGLDVDSCCGDAQTGGDHTNESCVDECCVRDSSVMVEEGTGSCEAVS   164
YBR295W_UC5   115   DTETGLDVDSCCGDAQTGGDHTNESCVDECCVRDSSVMVEEGTGSCEAVS   164
YBR295W_UWOPS05_217_3   115   DTETGLDVDSCCGDAQTGGDHTNESCVDECCVRDSSVMVEEGTGSCEAVS   164
YBR295W_VL3   115   DTETGLDVDSCCGDAQTGGDHTNESCVDGCCVRDSSVMVEEVTGSCEAVS   164
YBR295W_Vin13   24   DTETGLDVDSCCGDAQTGGDHTNESCVDGCCVRDSSVMVEEVTGSCEAVS   73
YBR295W_W303   115   DTETGLDVDSCCGDAQTGGDHTNESCVDGCCVRDSSVMVEEVTGSCEAVS   164
YBR295W_X2180-1A   115   DTETGLDVDSCCGDAQTGGDHTNESCVDGCCVRDSSVMVEEVTGSCEAVS   164
YBR295W_Y55   115   DTETGLDVDSCCGDAQTGGDHTNESCVDGCCVRDSSVMVEEVTGSCEAVS   164
YBR295W_YJM269   151   GTETGLDVDSCCGDAQTGGDHTNESCVDECCVRDSSVMVEEVTGSCEAVS   200
YBR295W_YJM789   115   DTETGLDVDSCCGDAQTGGDHTNESCVDGCCVRDSSVMVEEVTGSCEAVS   164
YBR295W_YPH499   115   DTETGLDVDSCCGDAQTGGDHTNESCVDGCCVRDSSVMVEEVTGSCEAVS   164
YBR295W_YPS128   115   DTETGLDVDSCCGDAQTGGDHTNESCVDECCVRDSSVMVEEGTGSCEAVS   164
YBR295W_YPS163   115   DTETGLDVDSCCGDAQTGGDHTNESCVDECCVRDSSVMVEEGTGSCEAVS   164
YBR295W_YS9   115   DTETGLDVDSCCGDAQTGGDHTNESCVDGCCVRDSSVMVEEVTGSCEAVS   164
YBR295W_ZTW1   115   DTETGLDVDSCCGDAQTGGDHTNESCVDECCVRDSSVMVEEGTGSCEAVS   164
         

YBR295W_S288C   165   SKEQLLTSFEVVPSKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCIESSD   214
YBR295W_AWRI1631   165   SKEQLLTSFEVVPSKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCIESSD   214
YBR295W_AWRI796   165   SKEQLLTSFEVVPSKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCIESSD   214
YBR295W_BC187   165   SKEQLLTSFEVVPSKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCIESSD   214
YBR295W_BY4741   165   SKEQLLTSFEVVPSKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCIESSD   214
YBR295W_BY4742   165   SKEQLLTSFEVVPSKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCIESSD   214
YBR295W_CBS7960   165   SKEQLLTSFEVVPSKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCIESSD   214
YBR295W_CEN.PK   165   SKEQLLTSFEVVPSKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCIESSD   214
YBR295W_CLIB215   
   --------------------------------------------------   
YBR295W_CLIB324   121   SKEQLLTSFEVVPSKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCIESSD   170
YBR295W_D273-10B   165   SKEQLLTSFEVVPSKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCIESSD   214
YBR295W_DBVPG6044   165   SKEQLLTSFEVVPSKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCLESSD   214
YBR295W_EC1118   165   SKEQLLTSFEVVPSKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCIESSD   214
YBR295W_EC9-8   165   SKEQLLTSFEVVPSKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCLESSD   214
YBR295W_FL100   165   SKEQLLTSFEVVPGKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCLESSD   214
YBR295W_FY1679   165   SKEQLLTSFEVVPSKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCIESSD   214
YBR295W_FostersB   
   --------------------------------------------------   
YBR295W_FostersO   165   SKEQLLTSFEVVPSKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCIESSD   214
YBR295W_JAY291   165   SKEQLLTSFEVVPSKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCIESSD   214
YBR295W_JK9-3d   158   SKELLLTSFEVVPSKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCLESSD   207
YBR295W_K11   165   SKEQLLTSFEVVPGKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCLESSD   214
YBR295W_Kyokai7   165   SKEQLLTSFEVVPGKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCLESSD   214
YBR295W_L1528   165   SKEQLLTSFEVVPSKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCIESSD   214
YBR295W_LalvinQA23   
   --------------------------------------------------   
YBR295W_PW5   165   SKEQLLTSFEVVPSKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCLESSD   214
YBR295W_RM11-1a   165   SKEQLLTSFEVVPSKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCIESSD   214
YBR295W_RedStar   165   SKEQLLTSFEVVPSKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCIESSD   214
YBR295W_SEY6210   165   SKEQLLTSFEVVPSKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCIESSD   214
YBR295W_SK1   165   SKEQLLTSFEVVPSKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCLESSD   214
YBR295W_T7   165   SKEQLLTSFEVVPSKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCLESSD   214
YBR295W_UC5   165   SKEQLLTSFEVVPGKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCLESSD   214
YBR295W_UWOPS05_217_3   165   SKEQLLTSFEVVPSKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCLESSD   214
YBR295W_VL3   165   SKEQLLTSFEVVPSKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCIESSD   214
YBR295W_Vin13   74   SKEQLLTSFEVVPSKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCIESSD   123
YBR295W_W303   165   SKEQLLTSFEVVPSKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCIESSD   214
YBR295W_X2180-1A   165   SKEQLLTSFEVVPSKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCIESSD   214
YBR295W_Y55   165   SKEQLLTSFEVVPSKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCIESSD   214
YBR295W_YJM269   201   SKEQLLTSFEVVPSKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCLESSD   250
YBR295W_YJM789   165   SKEQLLTSFEVVPSKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCIESSD   214
YBR295W_YPH499   165   SKEQLLTSFEVVPSKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCIESSD   214
YBR295W_YPS128   165   SKEQLLTSFEVVPSKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCLESSD   214
YBR295W_YPS163   165   SKEQLLTSFEVVPSKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCLESSD   214
YBR295W_YS9   165   SKEQLLTSFEVVPSKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCIESSD   214
YBR295W_ZTW1   165   SKEQLLTSFEVVPGKSEGLQSIHDIRETTRCNTNSNQHTGKGRLCLESSD   214
         

YBR295W_S288C   215   STLKKRSCKVSRQKIEVSSKPECCNISCVERIASRSCEKRTFKGSTNVGI   264
YBR295W_AWRI1631   215   STLKKRSCKVSRQKIEVSSKPECCNISCVERIESRSCEKRTFKGSTNVGI   264
YBR295W_AWRI796   215   STLKKRSCKVSRQKIEVSSKPECCNISCVERIASRSCEKRTFKGSTNVGI   264
YBR295W_BC187   215   STLKKRSCKVSRQKIEVSSKPECCNISCVERIASRSCEKRTFKGSTNVGI   264
YBR295W_BY4741   215   STLKKRSCKVSRQKIEVSSKPECCNISCVERIASRSCEKRTFKGSTNVGI   264
YBR295W_BY4742   215   STLKKRSCKVSRQKIEVSSKPECCNISCVERIASRSCEKRTFKGSTNVGI   264
YBR295W_CBS7960   215   STLKKRSCKVSRQKIEVSSKPECCNISCVERIASRSCEKRTFKGSTNVGI   264
YBR295W_CEN.PK   215   STLKKRSCKVSRQKIEVSSKPECCNISCVERIASRSCEKRTFKGSTNVGI   264
YBR295W_CLIB215   
   --------------------------------------------------   
YBR295W_CLIB324   171   STLKKRSCKVSRQKIEVSSKPECCNISCVERIASRSCEKRTFKGSTNVGI   220
YBR295W_D273-10B   215   STLKKRSCKVSRQKIEVSSKPECCNISCVERIASRSCEKRTFKGSTNVGI   264
YBR295W_DBVPG6044   215   STLKKRRCKVSRQKIEVSSKPECCNISCVERIASRSCEKRTFKGTTNVGI   264
YBR295W_EC1118   215   STLKKRSCKVSRQKIEVSSKPECCNISCVERIASRSCEKRTFKGSTNVGI   264
YBR295W_EC9-8   215   STLKKRRCKVSRQKIEVSNKPECCNISCVERIASRSCEKRTFKGTTNVGI   264
YBR295W_FL100   215   STLKKRRCKVSRQKIEVSSKPECCNISCVERIASRSCEKRTFKGTTNVGI   264
YBR295W_FY1679   215   STLKKRSCKVSRQKIEVSSKPECCNISCVERIASRSCEKRTFKGSTNVGI   264
YBR295W_FostersB   
   --------------------------------------------------   
YBR295W_FostersO   215   STLKKRSCKVSRQKIEVSSKPECCNISCVERIASRSCEKRTFKGSTNVGI   264
YBR295W_JAY291   215   STLKKRSCKVSRQKIEVSSKPECCNISCVERIASRSCEKRTFKGSTNVGI   264
YBR295W_JK9-3d   208   STLKKRRCKVSRQKIEVSSKPECCNISCVERIASRSCEKRTFKGTTNVGI   257
YBR295W_K11   215   STLKKRRCKVSRQKIEVSSKPECCNISCVERIASRSCEKRTFKGTTNVGI   264
YBR295W_Kyokai7   215   STLKKRRCKVSRQKIEVSSKPECCNISCVERIASRSCEKRTFKGTTKVGI   264
YBR295W_L1528   215   STLKKRSCKVSRQKIEVSSKPECCNISCVERIASRSCEKRTFKGSTNVGI   264
YBR295W_LalvinQA23   
   --------------------------------------------------   
YBR295W_PW5   215   STLKKRRCKVSRQKIEVSSKPECCNISCVERIASRSCEKRTFKGTTNVGI   264
YBR295W_RM11-1a   215   STLKKRSCKVSRQKIEVSSKPECCNISCVERIASRSCEKRTFKGSTNVGI   264
YBR295W_RedStar   215   STLKKRSCKVSRQKIEVSSKPECCNISCVERIASRSCEKRTFKGSTNVGI   264
YBR295W_SEY6210   215   STLKKRSCKVSRQKIEVSSKPECCNISCVERIASRSCEKRTFKGSTNVGI   264
YBR295W_SK1   215   STLKKRRCKVSRQKIEVSSKPECCNISCVERIASRSCEKRTFKGTTNVGI   264
YBR295W_T7   215   STLKKRRCKVSRQKIEVSSKPECCNISCVERIASRSCEKRTFKGTTNVKI   264
YBR295W_UC5   215   STLKKRRCKVSRQKIEVSSKPECCNISCVERIASRSCEKRTFKGTTNVGI   264
YBR295W_UWOPS05_217_3   215   STLKKRRCKVSRQKIEVSSKPECCNISCVERIASRSCEKRTFKGTTNVGI   264
YBR295W_VL3   215   STLKKRSCKVSRQKIEVSSKPECCNISCVERIASRSCEKRTFKGSTNVGI   264
YBR295W_Vin13   124   STLKKRSCKVSRQKIEVSSKPECCNISCVERIASRSCEKRTFKGSTNVGI   173
YBR295W_W303   215   STLKKRSCKVSRQKIEVSSKPECCNISCVERIASRSCEKRTFKGSTNVGI   264
YBR295W_X2180-1A   215   STLKKRSCKVSRQKIEVSSKPECCNISCVERIASRSCEKRTFKGSTNVGI   264
YBR295W_Y55   215   STLKKRSCKVSRQKIEVSSKPECCNISCVERIASRSCEKRTFKGSTNVGI   264
YBR295W_YJM269   251   STLKKRRCKVSRQKIEVSNKPECCNISCVERIASRSCEKRTFKGTTNVGI   300
YBR295W_YJM789   215   STLKKRSCKVSRQKIEVSSKPECCNISCVERIASRSCEKRTFKGSTNVGI   264
YBR295W_YPH499   215   STLKKRSCKVSRQKIEVSSKPECCNISCVERIASRSCEKRTFKGSTNVGI   264
YBR295W_YPS128   215   STLKKRRCKVSRQKIEVSSKPECCNISCVERIASRSCEKRTFKGTTNVKI   264
YBR295W_YPS163   215   STLKKRRCKVSRQKIEVSSKPECCNISCVERIASRSCEKRTFKGTTNVKI   264
YBR295W_YS9   215   STLKKRSCKVSRQKIEVSSKPECCNISCVERIASRSCEKRTFKGSTNVGI   264
YBR295W_ZTW1   215   STLKKRRCKVSRQKIEVSSKPECCNISCVERIASRSCEKRTFKGTTNVGI   264
         

YBR295W_S288C   265   SGSSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESCCLP   314
YBR295W_AWRI1631   265   SGSSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESCCLP   314
YBR295W_AWRI796   265   SGSSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESCCLP   314
YBR295W_BC187   265   SGSSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESCCLP   314
YBR295W_BY4741   265   SGSSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESCCLP   314
YBR295W_BY4742   265   SGSSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESCCLP   314
YBR295W_CBS7960   265   SGSSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESCCLP   314
YBR295W_CEN.PK   265   SGSSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESCCLP   314
YBR295W_CLIB215   
   --------------------------------------------------   
YBR295W_CLIB324   221   SGSSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESCCLP   270
YBR295W_D273-10B   265   SGSSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESCCLP   314
YBR295W_DBVPG6044   265   SGSSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESCCLP   314
YBR295W_EC1118   265   SGSSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESCCLP   314
YBR295W_EC9-8   265   SGSSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESCCLP   314
YBR295W_FL100   265   SGSSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESYCLP   314
YBR295W_FY1679   265   SGSSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESCCLP   314
YBR295W_FostersB   
   --------------------------------------------------   
YBR295W_FostersO   265   SGSSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESCCLP   314
YBR295W_JAY291   265   SGSSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESCCLP   314
YBR295W_JK9-3d   258   SGSSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESCCLP   307
YBR295W_K11   265   SGSSSTDSLSENFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESYCLP   314
YBR295W_Kyokai7   265   SGSSSTDSLSENFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESYCLP   314
YBR295W_L1528   265   SGSSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESCCLP   314
YBR295W_LalvinQA23   
   --------------------------------------------------   
YBR295W_PW5   265   SGSSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESCCLP   314
YBR295W_RM11-1a   265   SGSSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESCCLP   314
YBR295W_RedStar   265   SGSSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESCCLP   314
YBR295W_SEY6210   265   SGSSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESCCLP   314
YBR295W_SK1   265   SGSSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESCCLP   314
YBR295W_T7   265   SGSSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESCCLP   314
YBR295W_UC5   265   SGSSSTDSLSENFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESYCLP   314
YBR295W_UWOPS05_217_3   265   SGSSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESCCLP   314
YBR295W_VL3   265   SGSSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESCCLP   314
YBR295W_Vin13   174   SGSSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESCCLP   223
YBR295W_W303   265   SGSSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESCCLP   314
YBR295W_X2180-1A   265   SGSSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESCCLP   314
YBR295W_Y55   265   SGSSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESCCLP   314
YBR295W_YJM269   301   SGCSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESCCLP   350
YBR295W_YJM789   265   SGSSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESCCLP   314
YBR295W_YPH499   265   SGSSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESCCLP   314
YBR295W_YPS128   265   SGSSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESCCLP   314
YBR295W_YPS163   265   SGSSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESCCLP   314
YBR295W_YS9   265   SGSSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESCCLP   314
YBR295W_ZTW1   265   SGSSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCICNYLRTLGKESYCLP   314
         

YBR295W_S288C   315   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTHGDKERLSNDNGHADFVCSK   364
YBR295W_AWRI1631   315   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTHGDKGRLSNDNGHADFVCSK   364
YBR295W_AWRI796   315   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTHGDKERLSNDNGHADFVCSK   364
YBR295W_BC187   315   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTHGDKERLSNDNGHADFVCSK   364
YBR295W_BY4741   315   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTHGDKERLSNDNGHADFVCSK   364
YBR295W_BY4742   315   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTHGDKERLSNDNGHADFVCSK   364
YBR295W_CBS7960   315   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTHGDKERLSNDNGHADFVCSK   364
YBR295W_CEN.PK   315   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTHGDKERLSNDNGHADFVCSK   364
YBR295W_CLIB215   
   --------------------------------------------------   
YBR295W_CLIB324   271   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTHGDKERLSNDNGHADFVCSK   320
YBR295W_D273-10B   315   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTHGDKERLSNDNGHADFVCSK   364
YBR295W_DBVPG6044   315   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTYGDKERLSNDNGHADFVCSK   364
YBR295W_EC1118   315   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTHGDKERLSNDNGHADFVCSK   364
YBR295W_EC9-8   315   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTYGDKERLSNDNGHTDFVCTK   364
YBR295W_FL100   315   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTYGDKERLSNDNGHADFVCSK   364
YBR295W_FY1679   315   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTHGDKERLSNDNGHADFVCSK   364
YBR295W_FostersB   
   --------------------------------------------------   
YBR295W_FostersO   315   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTHGDKERLSNDNGHADFVCSK   364
YBR295W_JAY291   315   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTHGDKERLSNDNGHADFVCSK   364
YBR295W_JK9-3d   308   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTYGDKERLSNDNGHADFVCSK   357
YBR295W_K11   315   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTYGDKERLSNDNGHADFVCSK   364
YBR295W_Kyokai7   315   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTYGDKERLSNDNGHADFVCSK   364
YBR295W_L1528   315   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTHGDKERLSNDNGHADFVCSK   364
YBR295W_LalvinQA23   
   --------------------------------------------------   
YBR295W_PW5   315   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTYGDKERLSNDNGHVDFVCSK   364
YBR295W_RM11-1a   315   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTHGDKERLSNDNGHADFVCSK   364
YBR295W_RedStar   315   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTHGDKERLSNDNGHADFVCSK   364
YBR295W_SEY6210   315   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTHGDKERLSNDNGHADFVCSK   364
YBR295W_SK1   315   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTYGDKERLSNDNGHADFVCSK   364
YBR295W_T7   315   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTYGDKERLSNDNGHADFVCSK   364
YBR295W_UC5   315   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTYGDKERLSNDNGHADFVCSK   364
YBR295W_UWOPS05_217_3   315   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTYGDKERLSNDNGHADFVCSK   364
YBR295W_VL3   315   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTHGDKERLSNDNGHADFVCSK   364
YBR295W_Vin13   224   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTHGDKERLSNDNGHADFVCSK   273
YBR295W_W303   315   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTHGDKERLSNDNGHADFVCSK   364
YBR295W_X2180-1A   315   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTHGDKERLSNDNGHADFVCSK   364
YBR295W_Y55   315   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTHGDKERLSNDNGHADFVCSK   364
YBR295W_YJM269   351   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTYGDKERLSNDNGHTDFVCTK   400
YBR295W_YJM789   315   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTHGDKERLSNDNGHADFVCSK   364
YBR295W_YPH499   315   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTHGDKERLSNDNGHADFVCSK   364
YBR295W_YPS128   315   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTYGDKERLSNDNGHADFVCSK   364
YBR295W_YPS163   315   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTYGDKERLSNDNGHADFVCSK   364
YBR295W_YS9   315   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTHGDKERLSNDNGHADFVCSK   364
YBR295W_ZTW1   315   KVRFCSGEGASKKTKYSYRNSSGCLTKKKTHGDKERLSNDNGHADFVCSK   364
         

YBR295W_S288C   365   SCCTKMKDCAVTSTISGHSSSEISRIVSMEPIENHLNLEAGSTGTEHIVL   414
YBR295W_AWRI1631   365   SCCTKMKDCAVTSTISGHSSSEISRIVSMEPIENHLNLEAGSTGTEHIVL   414
YBR295W_AWRI796   365   SCCTKMKDCAVTSTISGHSSSEISRIVSMEPIENHLNLEAGSTGTEHIVL   414
YBR295W_BC187   365   SCCTKMKDCAVTSTISGHSSSEISRIVSMEPIENHLNLEAGSTGTEHIVL   414
YBR295W_BY4741   365   SCCTKMKDCAVTSTISGHSSSEISRIVSMEPIENHLNLEAGSTGTEHIVL   414
YBR295W_BY4742   365   SCCTKMKDCAVTSTISGHSSSEISRIVSMEPIENHLNLEAGSTGTEHIVL   414
YBR295W_CBS7960   365   SCCTKMKDCAVTSTISGHSSSEISRIVSMEPIENHLNLEAGSTGTEHIVL   414
YBR295W_CEN.PK   365   SCCTKMKDCAVTSTISGHSSSEISRIVSMEPIENHLNLEAGSTGTEHIVL   414
YBR295W_CLIB215   1   -----MKDCAVTSTISGHSSSEISRIVSMEPIENHLNLEAGSTGTEHIVL   45
YBR295W_CLIB324   321   SCCTKMKDCAVTSTISGHSSSEISRIVSMEPIENHLNLEAGSTGTEHIVL   370
YBR295W_D273-10B   365   SCCTKMKDCAVTSTISGHSSSEISRIVSMEPIENHLNLEAGSTGTEHIVL   414
YBR295W_DBVPG6044   365   SCCTKMKDCAVTSTISGHSSSEISRIVSMEPIGNHLNLEAGSTGTEHIVL   414
YBR295W_EC1118   365   SCCTKMKDCAVTSTISGHSSSEISRIVSMEPIENHLNLEAGSTGTEHIVL   414
YBR295W_EC9-8   365   GCCTKMKDCAVTSTISGHSSSEISRIVSMEPIGNHLNLEAGSTGTEHIVL   414
YBR295W_FL100   365   SCCTKMKDCAVTSTISGHSSSEISRIVSMEPIGNHLNLEAGSTGTEHIVL   414
YBR295W_FY1679   365   SCCTKMKDCAVTSTISGHSSSEISRIVSMEPIENHLNLEAGSTGTEHIVL   414
YBR295W_FostersB   
   --------------------------------------------------   
YBR295W_FostersO   365   SCCTKMKDCAVTSTISGHSSSEISRIVSMEPIENHLNLEAGSTGTEHIVL   414
YBR295W_JAY291   365   SCCTKMKDCAVTSTISGHSSSEISRIVSMEPIENHLNLEAGSTGTEHIVL   414
YBR295W_JK9-3d   358   SCCTKMKDCAVTSTISGHSSSEISRIVSMEPIGNHLNLEAGSTGTEHIVL   407
YBR295W_K11   365   SCCTKMKDCAVTSTISGHSSSEISRIVSMEPIGNHLNLEAGSTGTEHIVL   414
YBR295W_Kyokai7   365   SCCTKMKDCAVTSTISGHSSSEISRIVSMEPIGNHLNLEAGSTGTEHIVL   414
YBR295W_L1528   365   SCCTKMKDCAVTSTISGHSSSEISRIVSMEPIENHLNLEAGSTGTEHIVL   414
YBR295W_LalvinQA23   
   --------------------------------------------------   
YBR295W_PW5   365   SCCTKMKDCAVTSTISGHSSSEISRIVSMEPIGNHLNLEAGSTGTEHIVL   414
YBR295W_RM11-1a   365   SCCTKMKDCAVTSTISGHSSSEISRIVSMEPIENHLNLEAGSTGTEHIVL   414
YBR295W_RedStar   365   SCCTKMKDCAVTSTISGHSSSEISRIVSMEPIENHLNLEAGSTGTEHIVL   414
YBR295W_SEY6210   365   SCCTKMKDCAVTSTISGHSSSEISRIVSMEPIENHLNLEAGSTGTEHIVL   414
YBR295W_SK1   365   SCCTKMKDCAVTSTISGHSSSEISRIVSMEPIGNHLNLEAGSTGTEHIVL   414
YBR295W_T7   365   SCCTKMKDCAVTSTISGHSSSEISRIVSMEPIGNHLNLEAGSTGTEHIVL   414
YBR295W_UC5   365   SCCTKMKDCAVTSTISGHSSSEISRIVSMEPIGNHLNLEAGSTGTEHIVL   414
YBR295W_UWOPS05_217_3   365   SCCTKMKDCAVTSTISGHSSSEISRIVSMEPIGNHLNLEAGSTGTEHIVL   414
YBR295W_VL3   365   SCCTKMKDCAVTSTISGHSSSEISRIVSMEPIENHLNLEAGSTGTEHIVL   414
YBR295W_Vin13   274   SCCTKMKDCAVTSTISGHSSSEISRIVSMEPIENHLNLEAGSTGTEHIVL   323
YBR295W_W303   365   SCCTKMKDCAVTSTISGHSSSEISRIVSMEPIENHLNLEAGSTGTEHIVL   414
YBR295W_X2180-1A   365   SCCTKMKDCAVTSTISGHSSSEISRIVSMEPIENHLNLEAGSTGTEHIVL   414
YBR295W_Y55   365   SCCTKMKDCAVTSTISGHSSSEISRIVSMEPIENHLNLEAGSTGTEHIVL   414
YBR295W_YJM269   401   GCCTKMKDCAVTSTISGHSSSEISRIVSMEPIGNHLNLEAGSTGTEHIVL   450
YBR295W_YJM789   365   SCCTKMKDCAVTSTISGHSSSEISRIVSMEPIENHLNLEAGSTGTEHIVL   414
YBR295W_YPH499   365   SCCTKMKDCAVTSTISGHSSSEISRIVSMEPIENHLNLEAGSTGTEHIVL   414
YBR295W_YPS128   365   SCCTKMKDCAVTSTISGHSSSEISRIVSMEPIGNHLNLEAGSTGTEHIVL   414
YBR295W_YPS163   365   SCCTKMKDCAVTSTISGHSSSEISRIVSMEPIGNHLNLEAGSTGTEHIVL   414
YBR295W_YS9   365   SCCTKMKDCAVTSTISGHSSSEISRIVSMEPIENHLNLEAGSTGTEHIVL   414
YBR295W_ZTW1   365   SCCTKMKDCAVTSTISGHSSSEISRIVSMEPIGNHLNLEAGSTGTEHIVL   414
         

YBR295W_S288C   415   SVSGMSCTGCESKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   464
YBR295W_AWRI1631   415   SVSGMSCTGCESKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   464
YBR295W_AWRI796   415   SVSGMSCTGCESKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   464
YBR295W_BC187   415   SVSGMSCTGCESKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   464
YBR295W_BY4741   415   SVSGMSCTGCESKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   464
YBR295W_BY4742   415   SVSGMSCTGCESKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   464
YBR295W_CBS7960   415   SVSGMSCTGCESKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   464
YBR295W_CEN.PK   415   SVSGMSCTGCESKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   464
YBR295W_CLIB215   46   SVSGMSCTGCESKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   95
YBR295W_CLIB324   371   SVSGMSCTGCESKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   420
YBR295W_D273-10B   415   SVSGMSCTGCESKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   464
YBR295W_DBVPG6044   415   SVSGMTCTGCETKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   464
YBR295W_EC1118   415   SVSGMTCTGCESKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   464
YBR295W_EC9-8   415   SVSGMTCTGCETKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   464
YBR295W_FL100   415   SVSGMTCTGCETKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   464
YBR295W_FY1679   415   SVSGMSCTGCESKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   464
YBR295W_FostersB   
   --------------------------------------------------   
YBR295W_FostersO   415   SVSGMTCTGCESKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   464
YBR295W_JAY291   415   SVSGMSCTGCESKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   464
YBR295W_JK9-3d   408   SVSGMTCTGCETKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   457
YBR295W_K11   415   SVSGMTCTGCETKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   464
YBR295W_Kyokai7   415   SVSGMTCTGCETKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   464
YBR295W_L1528   415   SVSGMSCTGCESKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   464
YBR295W_LalvinQA23   
   --------------------------------------------------   
YBR295W_PW5   415   SVSGMTCTGCETKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   464
YBR295W_RM11-1a   415   SVSGMSCTGCESKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   464
YBR295W_RedStar   415   SVSGMSCTGCESKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   464
YBR295W_SEY6210   415   SVSGMSCTGCESKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   464
YBR295W_SK1   415   SVSGMTCTGCETKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   464
YBR295W_T7   415   SVSGMTCTGCETKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   464
YBR295W_UC5   415   SVSGMTCTGCETKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   464
YBR295W_UWOPS05_217_3   415   SVSGMTCTGCETKLKKSFGALKCVHGLKTSLILSQAEFNLDLSQGSVKDV   464
YBR295W_VL3   415   SVSGMSCTGCESKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   464
YBR295W_Vin13   324   SVSGMSCTGCESKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   373
YBR295W_W303   415   SVSGMSCTGCESKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   464
YBR295W_X2180-1A   415   SVSGMSCTGCESKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   464
YBR295W_Y55   415   SVSGMSCTGCESKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   464
YBR295W_YJM269   451   SVSGMTCTGCETKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   500
YBR295W_YJM789   415   SVSGMSCTGCESKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   464
YBR295W_YPH499   415   SVSGMSCTGCESKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   464
YBR295W_YPS128   415   SVSGMTCTGCETKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   464
YBR295W_YPS163   415   SVSGMTCTGCETKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   464
YBR295W_YS9   415   SVSGMSCTGCESKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   464
YBR295W_ZTW1   415   SVSGMTCTGCETKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDV   464
         

YBR295W_S288C   465   IKHLSKTTEFKYEQISNHGSTIDVVVPYAAKDFINEEWPQGVTELKIVER   514
YBR295W_AWRI1631   465   IKHLSKTTEFKYEQISNHGSTIDVVVPYAAKDFINEEWPQGVTELKIVER   514
YBR295W_AWRI796   465   IKHLSKTTEFKYEQISNHGSTIDVVVPYAAKDFINEEWPQGVTELKIVER   514
YBR295W_BC187   465   IKHLSKTTEFKYEQISNHGSTIDVVVPYAAKDFINEEWPQGVTELKIVER   514
YBR295W_BY4741   465   IKHLSKTTEFKYEQISNHGSTIDVVVPYAAKDFINEEWPQGVTELKIVER   514
YBR295W_BY4742   465   IKHLSKTTEFKYEQISNHGSTIDVVVPYAAKDFINEEWPQGVTELKIVER   514
YBR295W_CBS7960   465   IKHLSKTTEFKYEQISNHGSTIDVVVPYAAKDFINEEWPQGVTELKIVER   514
YBR295W_CEN.PK   465   IKHLSKTTEFKYEQISNHGSTIDVVVPYAAKDFINEEWPQGVTELKIVER   514
YBR295W_CLIB215   96   IKHLSKTTEFKYEQISNHGSTIDVVVPYAAKDFINEEWPQGVTELKIVER   145
YBR295W_CLIB324   421   IKHLSKTTEFKYEQISNHGSTIDVVVPYAAKDFINEEWPQGVTELKIVER   470
YBR295W_D273-10B   465   IKHLSKTTEFKYEQISNHGSTIDVVVPYAAKDFINEEWPQGVTELKIVER   514
YBR295W_DBVPG6044   465   IKHLSKTTEFKYEQISNHASTIDVVAPYAAKDFINEEWPQGVTELKIVER   514
YBR295W_EC1118   465   IKHLSKTTEFKYEQISNHGSTIDVVVPYAAKDFINEEWPQGVTELKIVER   514
YBR295W_EC9-8   465   IKHLSKTTEFKYEQISNHGSTIDVVAPYAAKDFINEEWPQGVTELKIVER   514
YBR295W_FL100   465   IKHLSKNTEFKYEQISNHASTIDVVAPYAAKDFINEEWPQGVTELKIVER   514
YBR295W_FY1679   465   IKHLSKTTEFKYEQISNHGSTIDVVVPYAAKDFINEEWPQGVTELKIVER   514
YBR295W_FostersB   
   --------------------------------------------------   
YBR295W_FostersO   465   IKHLSKTTEFKYEQISNHGSTIDVVVPYAAKDFINEEWPQGVTELKIVER   514
YBR295W_JAY291   465   IKHLSKTTEFKYEQISNHGSTIDVVVPYAAKDFINEEWPQGVTELKIVER   514
YBR295W_JK9-3d   458   IKHLSKTTEFKYEQISNHASTIDVVAPYAAKDFINEEWPQGVTELKIVER   507
YBR295W_K11   465   IKHLSKTTEFKYEQISNHASTIDVVAPYAAKDFINEEWPQGVTELKIVER   514
YBR295W_Kyokai7   465   IKHLSKTTEFKYEQISNHASTIDVVAPYAAKDFINEEWPQGVTELKIVER   514
YBR295W_L1528   465   IKHLSKTTEFKYEQISNHGSTIDVVVPYAAKDFINEEWPQGVTELKIVER   514
YBR295W_LalvinQA23   
   --------------------------------------------------   
YBR295W_PW5   465   IKHLSKTTEFKYEQISNHASTIDVVAPYAAKDFINEEWPQGVTELKIVER   514
YBR295W_RM11-1a   465   IKHLSKTTEFKYEQISNHGSTIDVVVPYAAKDFINEEWPQGVTELKIVER   514
YBR295W_RedStar   465   IKHLSKTTEFKYEQISNHGSTIDVVVPYAAKDFINEEWPQGVTELKIVER   514
YBR295W_SEY6210   465   IKHLSKTTEFKYEQISNHGSTIDVVVPYAAKDFINEEWPQGVTELKIVER   514
YBR295W_SK1   465   IKHLSKTTEFKYEQISNHASTIDVVAPYAAKDFINEEWPQGVTELKIVER   514
YBR295W_T7   465   IKHLSKTTEFKYEQISNHASTIDVVAPYAAKDFINEEWPQGVTELKIVER   514
YBR295W_UC5   465   IKHLSKTTEFKYEQISNHASTIDVVAPYAAKDFINEEWPQGVTELKIVER   514
YBR295W_UWOPS05_217_3   465   IKHLSKTTEFKYEQISNHASTIDVVAPYAAKDFINEEWPQGVTELKIVER   514
YBR295W_VL3   465   IKHLSKTTEFKYEQISNHGSTIDVVVPYAAKDFINEEWPQGVTELKIVER   514
YBR295W_Vin13   374   IKHLSKTTEFKYEQISNHGSTIDVVVPYAAKDFINEEWPQGVTELKIVER   423
YBR295W_W303   465   IKHLSKTTEFKYEQISNHGSTIDVVVPYAAKDFINEEWPQGVTELKIVER   514
YBR295W_X2180-1A   465   IKHLSKTTEFKYEQISNHGSTIDVVVPYAAKDFINEEWPQGVTELKIVER   514
YBR295W_Y55   465   IKHLSKTTEFKYEQISNHGSTIDVVVPYAAKDFINEEWPQGVTELKIVER   514
YBR295W_YJM269   501   IKHLSKTTEFKYEQISNHGSTIDVVAPYAAKDFINEEWPQGVTELKIVER   550
YBR295W_YJM789   465   IKHLSKTTEFKYEQISNHGSTIDVVVPYAAKDFINEEWPQGVTELKIVER   514
YBR295W_YPH499   465   IKHLSKTTEFKYEQI