ALG7/YBR243C S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YBR243C_S288C   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_AWRI1631   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_AWRI796   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_BC187   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_BY4741   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_BY4742   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_CBS7960   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_CEN.PK   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_CLIB215   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_D273-10B   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_DBVPG6044   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_EC1118   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_EC9-8   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_FL100   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_FY1679   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_FostersB   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_FostersO   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_JAY291   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_JK9-3d   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_K11   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_Kyokai7   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_L1528   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_LalvinQA23   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_PW5   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_RM11-1a   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_RedStar   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_SEY6210   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_SK1   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_T7   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_UC5   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_UWOPS05_217_3   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_VL3   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_Vin13   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_W303   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_X2180-1A   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_Y55   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_YJM269   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_YJM339   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_YJM789   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_YPH499   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_YPS128   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_YPS163   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_YS9   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
YBR243C_ZTW1   1   MLRLFSLALITCLIYYSKNQGPSALVAAVGFGIAGYLATDMLIPRVGKSF   50
         

YBR243C_S288C   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_AWRI1631   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_AWRI796   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_BC187   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_BY4741   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_BY4742   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_CBS7960   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_CEN.PK   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_CLIB215   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_D273-10B   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_DBVPG6044   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_EC1118   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_EC9-8   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_FL100   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_FY1679   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_FostersB   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_FostersO   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_JAY291   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_JK9-3d   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_K11   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_Kyokai7   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_L1528   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_LalvinQA23   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_PW5   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_RM11-1a   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_RedStar   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_SEY6210   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_SK1   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_T7   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_UC5   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_UWOPS05_217_3   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_VL3   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_Vin13   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_W303   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_X2180-1A   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_Y55   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_YJM269   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_YJM339   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_YJM789   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_YPH499   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_YPS128   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_YPS163   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_YS9   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
YBR243C_ZTW1   51   IKIGLFGKDLSKPGRPVLPETIGAIPAAVYLFVMFIYIPFIFYKYMVITT   100
         

YBR243C_S288C   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_AWRI1631   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_AWRI796   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_BC187   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_BY4741   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_BY4742   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_CBS7960   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_CEN.PK   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_CLIB215   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_D273-10B   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_DBVPG6044   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_EC1118   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_EC9-8   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_FL100   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_FY1679   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_FostersB   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_FostersO   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_JAY291   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_JK9-3d   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_K11   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_Kyokai7   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_L1528   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_LalvinQA23   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_PW5   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_RM11-1a   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_RedStar   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_SEY6210   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_SK1   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_T7   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_UC5   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_UWOPS05_217_3   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_VL3   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_Vin13   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_W303   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_X2180-1A   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_Y55   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_YJM269   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_YJM339   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_YJM789   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_YPH499   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_YPS128   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_YPS163   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_YS9   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
YBR243C_ZTW1   101   SGGGHRDVSVVEDNGMNSNIFPHDKLSEYLSAILCLESTVLLGIADDLFD   150
         

YBR243C_S288C   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_AWRI1631   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_AWRI796   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_BC187   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_BY4741   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_BY4742   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_CBS7960   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_CEN.PK   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_CLIB215   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_D273-10B   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_DBVPG6044   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_EC1118   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_EC9-8   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_FL100   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_FY1679   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_FostersB   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_FostersO   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_JAY291   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_JK9-3d   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_K11   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_Kyokai7   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_L1528   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_LalvinQA23   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_PW5   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_RM11-1a   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_RedStar   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_SEY6210   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_SK1   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_T7   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_UC5   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_UWOPS05_217_3   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_VL3   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_Vin13   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_W303   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_X2180-1A   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_Y55   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_YJM269   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_YJM339   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERYLKKTSVDLGLW   200
YBR243C_YJM789   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_YPH499   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_YPS128   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_YPS163   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_YS9   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
YBR243C_ZTW1   151   LRWRHKFFLPAIAAIPLLMVYYVDFGVTHVLIPGFMERWLKKTSVDLGLW   200
         

YBR243C_S288C   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_AWRI1631   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_AWRI796   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_BC187   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_BY4741   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_BY4742   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_CBS7960   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_CEN.PK   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_CLIB215   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_D273-10B   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_DBVPG6044   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_EC1118   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_EC9-8   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_FL100   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_FY1679   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_FostersB   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_FostersO   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_JAY291   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_JK9-3d   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_K11   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_Kyokai7   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_L1528   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_LalvinQA23   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_PW5   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_RM11-1a   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_RedStar   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_SEY6210   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_SK1   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_T7   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_UC5   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_UWOPS05_217_3   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_VL3   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_Vin13   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_W303   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_X2180-1A   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_Y55   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_YJM269   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_YJM339   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_YJM789   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_YPH499   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_YPS128   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_YPS163   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_YS9   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
YBR243C_ZTW1   201   YYVYMASMAIFCPNSINILAGVNGLEVGQCIVLAILALLNDLLYFSMGPL   250
         

YBR243C_S288C   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_AWRI1631   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_AWRI796   251   ATRDSHRFSAVLIIPFFGCILGAMEMESLARHSVCGRYILLFRWNGIRSR   300
YBR243C_BC187   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_BY4741   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_BY4742   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_CBS7960   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_CEN.PK   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_CLIB215   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_D273-10B   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_DBVPG6044   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_EC1118   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_EC9-8   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_FL100   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_FY1679   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_FostersB   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_FostersO   251   ATRDSHRFSAVLIIPFFGCILGAMEMESLARHSVCGRYILLFRWNGIRSR   300
YBR243C_JAY291   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_JK9-3d   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_K11   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_Kyokai7   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_L1528   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_LalvinQA23   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_PW5   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_RM11-1a   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_RedStar   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_SEY6210   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_SK1   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_T7   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_UC5   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_UWOPS05_217_3   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_VL3   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_Vin13   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_W303   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_X2180-1A   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_Y55   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_YJM269   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_YJM339   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_YJM789   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_YPH499   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_YPS128   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_YPS163   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_YS9   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
YBR243C_ZTW1   251   ATRDSHRFSAVLIIPFLGVSLALWKWNRWPATVFVGDTYCYFAGMVFAVV   300
         

YBR243C_S288C   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_AWRI1631   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_AWRI796   301   WYTGSFFKDDAFAIHSSNR-------------------------------   319
YBR243C_BC187   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_BY4741   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_BY4742   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_CBS7960   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_CEN.PK   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_CLIB215   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_D273-10B   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_DBVPG6044   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_EC1118   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_EC9-8   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_FL100   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_FY1679   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_FostersB   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_FostersO   301   WYTGSFFKDDAFAIHSSNR-------------------------------   319
YBR243C_JAY291   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_JK9-3d   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_K11   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_Kyokai7   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_L1528   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_LalvinQA23   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKRRFNV   350
YBR243C_PW5   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_RM11-1a   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_RedStar   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_SEY6210   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_SK1   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_T7   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_UC5   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_UWOPS05_217_3   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_VL3   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_Vin13   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_W303   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_X2180-1A   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_Y55   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_YJM269   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_YJM339   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_YJM789   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_YPH499   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_YPS128   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_YPS163   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_YS9   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
YBR243C_ZTW1   301   GILGHFSKTMLLLFIPQIVNFIYSCPQLFKLVPCPRHRLPKFNEKDGLMY   350
         

YBR243C_S288C   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT   400
YBR243C_AWRI1631   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT   400
YBR243C_AWRI796   
   --------------------------------------------------   
YBR243C_BC187   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT   400
YBR243C_BY4741   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT   400
YBR243C_BY4742   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT   400
YBR243C_CBS7960   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT   400
YBR243C_CEN.PK   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT   400
YBR243C_CLIB215   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT   400
YBR243C_D273-10B   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT   400
YBR243C_DBVPG6044   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT   400
YBR243C_EC1118   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT   400
YBR243C_EC9-8   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT   400
YBR243C_FL100   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT   400
YBR243C_FY1679   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT   400
YBR243C_FostersB   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT   400
YBR243C_FostersO   
   --------------------------------------------------   
YBR243C_JAY291   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT   400
YBR243C_JK9-3d   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT   400
YBR243C_K11   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT   400
YBR243C_Kyokai7   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT   400
YBR243C_L1528   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT   400
YBR243C_LalvinQA23   351   SIKSKLKRRTAKEHF-----------------------------------   365
YBR243C_PW5   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT   400
YBR243C_RM11-1a   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT   400
YBR243C_RedStar   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT   400
YBR243C_SEY6210   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT   400
YBR243C_SK1   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT   400
YBR243C_T7   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT   400
YBR243C_UC5   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT   400
YBR243C_UWOPS05_217_3   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFGENNEIISTSNMTLINLT   400
YBR243C_VL3   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT   400
YBR243C_Vin13   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT   400
YBR243C_W303   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT   400
YBR243C_X2180-1A   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT   400
YBR243C_Y55   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT   400
YBR243C_YJM269   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT   400
YBR243C_YJM339   351   PSRANLKEEPPKSIFKPILKLLYSLHLIDLEFDENNEIISTSNMTLINLT   400
YBR243C_YJM789   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT   400
YBR243C_YPH499   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT   400
YBR243C_YPS128   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT   400
YBR243C_YPS163   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT   400
YBR243C_YS9   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT   400
YBR243C_ZTW1   351   PSRANLKEEPPKSIFKPILKLLYCLHLIDLEFDENNEIISTSNMTLINLT   400
         

YBR243C_S288C   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
YBR243C_AWRI1631   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
YBR243C_AWRI796   
   ------------------------------------------------   
YBR243C_BC187   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
YBR243C_BY4741   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
YBR243C_BY4742   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
YBR243C_CBS7960   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
YBR243C_CEN.PK   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
YBR243C_CLIB215   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
YBR243C_D273-10B   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
YBR243C_DBVPG6044   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
YBR243C_EC1118   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
YBR243C_EC9-8   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
YBR243C_FL100   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
YBR243C_FY1679   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
YBR243C_FostersB   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
YBR243C_FostersO   
   ------------------------------------------------   
YBR243C_JAY291   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
YBR243C_JK9-3d   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
YBR243C_K11   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
YBR243C_Kyokai7   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
YBR243C_L1528   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
YBR243C_LalvinQA23   
   ------------------------------------------------   
YBR243C_PW5   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
YBR243C_RM11-1a   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
YBR243C_RedStar   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
YBR243C_SEY6210   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
YBR243C_SK1   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
YBR243C_T7   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
YBR243C_UC5   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
YBR243C_UWOPS05_217_3   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
YBR243C_VL3   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
YBR243C_Vin13   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
YBR243C_W303   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
YBR243C_X2180-1A   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
YBR243C_Y55   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
YBR243C_YJM269   401   LVWFGPMREDKLCNTILKLQFCIGILVLLGRHAIGAIIFGHDNLWTVR   448
YBR243C_YJM339   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
YBR243C_YJM789   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
YBR243C_YPH499   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
YBR243C_YPS128   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
YBR243C_YPS163   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
YBR243C_YS9   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
YBR243C_ZTW1   401   LVWFGPMREDKLCNTILKLQFCIGILALLGRHAIGAIIFGHDNLWTVR   448
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YBR243C_S288C from SGD:

YBR243C_S288C [source=SGD]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 6759  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_AWRI1631 from AWRI:

YBR243C_AWRI1631 [source=AWRI]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 6759  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_AWRI796 from AWRI:

YBR243C_AWRI796 [source=AWRI]  Length: 320  Fri Sep 22 12:55:09 2017  Type: P  Check: 3107  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFFGCI LGAMEMESLA RHSVCGRYIL LFRWNGIRSR

     301  WYTGSFFKDD AFAIHSSNR*

Protein Sequence for YBR243C_BC187 from Stanford:

YBR243C_BC187 [source=Stanford]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 6759  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_BY4741 from Stanford:

YBR243C_BY4741 [source=Stanford]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 6759  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_BY4742 from Stanford:

YBR243C_BY4742 [source=Stanford]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 6759  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_CBS7960 from WashU:

YBR243C_CBS7960 [source=WashU]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 6759  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_CEN.PK from Stanford:

YBR243C_CEN.PK [source=Stanford]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 6759  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_CLIB215 from WashU:

YBR243C_CLIB215 [source=WashU]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 6759  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_D273-10B from Stanford:

YBR243C_D273-10B [source=Stanford]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 6759  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_DBVPG6044 from Stanford:

YBR243C_DBVPG6044 [source=Stanford]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 6759  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_EC1118 from Genoscope:

YBR243C_EC1118 [source=Genoscope]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 6759  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_EC9-8 from ASinica:

YBR243C_EC9-8 [source=ASinica]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 6759  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_FL100 from Stanford:

YBR243C_FL100 [source=Stanford]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 6759  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_FY1679 from Stanford:

YBR243C_FY1679 [source=Stanford]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 6759  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_FostersB from AWRI:

YBR243C_FostersB [source=AWRI]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 6759  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_FostersO from AWRI:

YBR243C_FostersO [source=AWRI]  Length: 320  Fri Sep 22 12:55:09 2017  Type: P  Check: 3107  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFFGCI LGAMEMESLA RHSVCGRYIL LFRWNGIRSR

     301  WYTGSFFKDD AFAIHSSNR*

Protein Sequence for YBR243C_JAY291 from Duke:

YBR243C_JAY291 [source=Duke]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 6759  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_JK9-3d from Stanford:

YBR243C_JK9-3d [source=Stanford]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 6759  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_K11 from Stanford:

YBR243C_K11 [source=Stanford]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 6759  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_Kyokai7 from NRIB:

YBR243C_Kyokai7 [source=NRIB]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 6759  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_L1528 from Stanford:

YBR243C_L1528 [source=Stanford]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 6759  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_LalvinQA23 from AWRI:

YBR243C_LalvinQA23 [source=AWRI]  Length: 366  Fri Sep 22 12:55:09 2017  Type: P  Check: 9825  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKRRFNV

     351  SIKSKLKRRT AKEHF*

Protein Sequence for YBR243C_PW5 from WashU:

YBR243C_PW5 [source=WashU]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 6759  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_RM11-1a from Stanford:

YBR243C_RM11-1a [source=Stanford]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 6759  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_RedStar from Stanford:

YBR243C_RedStar [source=Stanford]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 6759  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_SEY6210 from Stanford:

YBR243C_SEY6210 [source=Stanford]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 6759  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_SK1 from Stanford:

YBR243C_SK1 [source=Stanford]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 6759  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_T7 from WashU:

YBR243C_T7 [source=WashU]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 6759  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_UC5 from WashU:

YBR243C_UC5 [source=WashU]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 6759  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_UWOPS05_217_3 from Stanford:

YBR243C_UWOPS05_217_3 [source=Stanford]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 6882  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFGENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_VL3 from AWRI:

YBR243C_VL3 [source=AWRI]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 6759  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_Vin13 from AWRI:

YBR243C_Vin13 [source=AWRI]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 6759  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_W303 from Stanford:

YBR243C_W303 [source=Stanford]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 6759  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_X2180-1A from Stanford:

YBR243C_X2180-1A [source=Stanford]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 6759  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_Y55 from Stanford:

YBR243C_Y55 [source=Stanford]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 6759  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_YJM269 from WashU:

YBR243C_YJM269 [source=WashU]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 7347  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILVLLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_YJM339 from Stanford:

YBR243C_YJM339 [source=Stanford]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 7307  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERYL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYSLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_YJM789 from Stanford:

YBR243C_YJM789 [source=Stanford]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 6759  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_YPH499 from Stanford:

YBR243C_YPH499 [source=Stanford]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 6759  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_YPS128 from Stanford:

YBR243C_YPS128 [source=Stanford]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 6759  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_YPS163 from Stanford:

YBR243C_YPS163 [source=Stanford]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 6759  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_YS9 from Stanford:

YBR243C_YS9 [source=Stanford]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 6759  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*


Protein Sequence for YBR243C_ZTW1 from Zhejiang:

YBR243C_ZTW1 [source=Zhejiang]  Length: 449  Fri Sep 22 12:55:09 2017  Type: P  Check: 6759  ..

       1  MLRLFSLALI TCLIYYSKNQ GPSALVAAVG FGIAGYLATD MLIPRVGKSF

      51  IKIGLFGKDL SKPGRPVLPE TIGAIPAAVY LFVMFIYIPF IFYKYMVITT

     101  SGGGHRDVSV VEDNGMNSNI FPHDKLSEYL SAILCLESTV LLGIADDLFD

     151  LRWRHKFFLP AIAAIPLLMV YYVDFGVTHV LIPGFMERWL KKTSVDLGLW

     201  YYVYMASMAI FCPNSINILA GVNGLEVGQC IVLAILALLN DLLYFSMGPL

     251  ATRDSHRFSA VLIIPFLGVS LALWKWNRWP ATVFVGDTYC YFAGMVFAVV

     301  GILGHFSKTM LLLFIPQIVN FIYSCPQLFK LVPCPRHRLP KFNEKDGLMY

     351  PSRANLKEEP PKSIFKPILK LLYCLHLIDL EFDENNEIIS TSNMTLINLT

     401  LVWFGPMRED KLCNTILKLQ FCIGILALLG RHAIGAIIFG HDNLWTVR*