YBR201C-A S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YBR201C-A_S288C   1   MLAMKSFSQVSKSYKASAPSKKLTTLFYVAYITLGLTTPFLLPARMASKD   50
YBR201C-A_AWRI1631   1   MLAMKSFSQVSKSYKASAPSKKLTTLFYVAYITLGLTTPFLLPARMASKD   50
YBR201C-A_AWRI796   1   MLAMKSFSQVSKSYKASAPSKKLTTLFYVAYITLGLTTPFLLPARMASKD   50
YBR201C-A_CBS7960   1   MLAMKSFSQVSKSYKASAPSKKLTTLFYVAYITLGLTTPFLLPARMASKD   50
YBR201C-A_CLIB215   1   MLAMKSFSQVSKSYKASAPSKKLTTLFYVAYITLGLTTPFLLPARMASKD   50
YBR201C-A_CLIB324   1   MLAMKSFSQVSKSYKASAPSKKLTTLFYVAYITLGLTTPFLLPARMASKD   50
YBR201C-A_CLIB382   1   MLAMKSFSQVSKSYKASAPSKKLTTLFYVAYITLGLTTPFLLPARMASKD   50
YBR201C-A_EC1118   1   MLAMKSFSQVSKSYKASAPSKKLTTLFYVAYITLGLTTPFLLPARMASKD   50
YBR201C-A_EC9-8   1   MLAMKSFSQVSKSYKASAPSKKLTTLFYVAYITLGLTTPFLLPARMASKD   50
YBR201C-A_FostersB   1   MLAMKSFSQVSKSYKASAPSKKLTTLFYVAYITLGLTTPFLLPARMASKD   50
YBR201C-A_FostersO   1   MLAMKSFSQVSKSYKASAPSKKLTTLFYVAYITLGLTTPFLLPA------   44
YBR201C-A_JAY291   1   MLAIKSFSQVSKSYKASAPSKKLTTLFYVAYITLGLTTPFLLPARMASKD   50
YBR201C-A_Kyokai7   1   MLAMKSFSQVSKSYKASAPSKKLTTLFYVAYITLGLTTPFLLPARMASKD   50
YBR201C-A_LalvinQA23   1   MLAMKSFSQVSKSYKASAPSKKLTTLFYVAYITLGLTTPFLLPARMASKD   50
YBR201C-A_M22   1   MLAMKSFSQVSKSYKASAPSKKLTTLFYVAYITLGLTTPFLLPARMASKD   50
YBR201C-A_PW5   1   MLAMKSFSQVSKSYKASAPSKKLTTLFYVAYITLGLTTPFLLPARMASKD   50
YBR201C-A_T7   1   MLAMKSFSQVSKSYKASAPSKKLTTLFYVAYITLGLTTPFLLPARMASKD   50
YBR201C-A_T73   1   MLAMKSFSQVSKSYKASAPSKKLTTLFYVAYITLGLTTPFLLPARMASKD   50
YBR201C-A_UC5   1   MLAMKSFSQVSKSYKASAPSKKLTTLFYVAYITLGLTTPFLLPARMASKD   50
YBR201C-A_VL3   1   MLAMKSFSQVSKSYKASAPSKKLTTLFYVAYITLGLTTPFLLPARMASKD   50
YBR201C-A_Vin13   1   MLAMKSFSQVSKSYKASAPSKKLTTLFYVAYITLGLTTPFLLPARMASKD   50
YBR201C-A_Y10   1   MLAMKSFSQVSKSYKASAPSKKLTTLFYVAYITLGLTTPFLLPARMASKD   50
YBR201C-A_YJM269   1   MLAMKSFSQVSKSYKASAPSKKLTTLFYVAYITLGLTTPFLLPARMASKD   50
YBR201C-A_YJM789   1   MLAMKSFSQVSKSYKASAPSKKLTTLFYVAYITLGLTTPFLLPARMASKD   50
YBR201C-A_ZTW1   1   MLAMKSFSQVSKSYKASAPSKKLTTLFYVAYITLGLTTPFLLPARMASKD   50
         

YBR201C-A_S288C   51   THYYKDEFCSQRSYTRF   67
YBR201C-A_AWRI1631   51   THNYKDEFCSQRSYTRF   67
YBR201C-A_AWRI796   51   THNYKDEFCSQRSYTRF   67
YBR201C-A_CBS7960   51   THNYKDEFCSQRSYTRF   67
YBR201C-A_CLIB215   51   THNYKDEFCSQRSYTRF   67
YBR201C-A_CLIB324   51   THNYKDEFCSQRSYTRF   67
YBR201C-A_CLIB382   51   THNYKDEFCSQRSYIRF   67
YBR201C-A_EC1118   51   THNYKDEFCSQRSYTRF   67
YBR201C-A_EC9-8   51   THNYKDEFCSQRSYTRF   67
YBR201C-A_FostersB   51   THYYKDEFCSQRSYTRF   67
YBR201C-A_FostersO   
   -----------------   
YBR201C-A_JAY291   51   THNYKDEFCSQRSYTRF   67
YBR201C-A_Kyokai7   51   THYYKDEFCSQRSYTRF   67
YBR201C-A_LalvinQA23   51   THNYKDEFCSQRSYTRF   67
YBR201C-A_M22   51   THNYKDEFCSQRSYTRF   67
YBR201C-A_PW5   51   THYYKDEFCSQRSYTRF   67
YBR201C-A_T7   51   THYYKDEFCSQRSYTRF   67
YBR201C-A_T73   51   THNYKDEFCSQRSYTRF   67
YBR201C-A_UC5   51   THYYKDEFCSQRSYTRF   67
YBR201C-A_VL3   51   THNYKDEFCSQRSYTRF   67
YBR201C-A_Vin13   51   THNYKDEFCSQRSYTRF   67
YBR201C-A_Y10   51   THYYKDEFCSQRSYTRF   67
YBR201C-A_YJM269   51   THYYKDEFCSQRSYTRF   67
YBR201C-A_YJM789   51   THYYKDEFCSQRSYTRF   67
YBR201C-A_ZTW1   51   THYYKDEFCSQRSYTRF   67
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YBR201C-A_S288C from SGD:

YBR201C-A_S288C [source=SGD]  Length: 68  Mon Oct 23 04:59:15 2017  Type: P  Check: 2446  ..

       1  MLAMKSFSQV SKSYKASAPS KKLTTLFYVA YITLGLTTPF LLPARMASKD

      51  THYYKDEFCS QRSYTRF*

Protein Sequence for YBR201C-A_AWRI1631 from AWRI:

YBR201C-A_AWRI1631 [source=AWRI]  Length: 68  Mon Oct 23 04:59:15 2017  Type: P  Check: 1863  ..

       1  MLAMKSFSQV SKSYKASAPS KKLTTLFYVA YITLGLTTPF LLPARMASKD

      51  THNYKDEFCS QRSYTRF*

Protein Sequence for YBR201C-A_AWRI796 from AWRI:

YBR201C-A_AWRI796 [source=AWRI]  Length: 68  Mon Oct 23 04:59:15 2017  Type: P  Check: 1863  ..

       1  MLAMKSFSQV SKSYKASAPS KKLTTLFYVA YITLGLTTPF LLPARMASKD

      51  THNYKDEFCS QRSYTRF*

Protein Sequence for YBR201C-A_CBS7960 from WashU:

YBR201C-A_CBS7960 [source=WashU]  Length: 68  Mon Oct 23 04:59:15 2017  Type: P  Check: 1863  ..

       1  MLAMKSFSQV SKSYKASAPS KKLTTLFYVA YITLGLTTPF LLPARMASKD

      51  THNYKDEFCS QRSYTRF*

Protein Sequence for YBR201C-A_CLIB215 from WashU:

YBR201C-A_CLIB215 [source=WashU]  Length: 68  Mon Oct 23 04:59:15 2017  Type: P  Check: 1863  ..

       1  MLAMKSFSQV SKSYKASAPS KKLTTLFYVA YITLGLTTPF LLPARMASKD

      51  THNYKDEFCS QRSYTRF*

Protein Sequence for YBR201C-A_CLIB324 from WashU:

YBR201C-A_CLIB324 [source=WashU]  Length: 68  Mon Oct 23 04:59:15 2017  Type: P  Check: 1863  ..

       1  MLAMKSFSQV SKSYKASAPS KKLTTLFYVA YITLGLTTPF LLPARMASKD

      51  THNYKDEFCS QRSYTRF*

Protein Sequence for YBR201C-A_CLIB382 from WashU:

YBR201C-A_CLIB382 [source=WashU]  Length: 68  Mon Oct 23 04:59:15 2017  Type: P  Check: 1775  ..

       1  MLAMKSFSQV SKSYKASAPS KKLTTLFYVA YITLGLTTPF LLPARMASKD

      51  THNYKDEFCS QRSYIRF*

Protein Sequence for YBR201C-A_EC1118 from Genoscope:

YBR201C-A_EC1118 [source=Genoscope]  Length: 68  Mon Oct 23 04:59:15 2017  Type: P  Check: 1863  ..

       1  MLAMKSFSQV SKSYKASAPS KKLTTLFYVA YITLGLTTPF LLPARMASKD

      51  THNYKDEFCS QRSYTRF*

Protein Sequence for YBR201C-A_EC9-8 from ASinica:

YBR201C-A_EC9-8 [source=ASinica]  Length: 68  Mon Oct 23 04:59:15 2017  Type: P  Check: 1863  ..

       1  MLAMKSFSQV SKSYKASAPS KKLTTLFYVA YITLGLTTPF LLPARMASKD

      51  THNYKDEFCS QRSYTRF*

Protein Sequence for YBR201C-A_FostersB from AWRI:

YBR201C-A_FostersB [source=AWRI]  Length: 68  Mon Oct 23 04:59:15 2017  Type: P  Check: 2446  ..

       1  MLAMKSFSQV SKSYKASAPS KKLTTLFYVA YITLGLTTPF LLPARMASKD

      51  THYYKDEFCS QRSYTRF*

Protein Sequence for YBR201C-A_FostersO from AWRI:

YBR201C-A_FostersO [source=AWRI]  Length: 45  Mon Oct 23 04:59:15 2017  Type: P  Check: 8693  ..

       1  MLAMKSFSQV SKSYKASAPS KKLTTLFYVA YITLGLTTPF LLPA*


Protein Sequence for YBR201C-A_JAY291 from Duke:

YBR201C-A_JAY291 [source=Duke]  Length: 68  Mon Oct 23 04:59:15 2017  Type: P  Check: 1847  ..

       1  MLAIKSFSQV SKSYKASAPS KKLTTLFYVA YITLGLTTPF LLPARMASKD

      51  THNYKDEFCS QRSYTRF*

Protein Sequence for YBR201C-A_Kyokai7 from NRIB:

YBR201C-A_Kyokai7 [source=NRIB]  Length: 68  Mon Oct 23 04:59:15 2017  Type: P  Check: 2446  ..

       1  MLAMKSFSQV SKSYKASAPS KKLTTLFYVA YITLGLTTPF LLPARMASKD

      51  THYYKDEFCS QRSYTRF*

Protein Sequence for YBR201C-A_LalvinQA23 from AWRI:

YBR201C-A_LalvinQA23 [source=AWRI]  Length: 68  Mon Oct 23 04:59:15 2017  Type: P  Check: 1863  ..

       1  MLAMKSFSQV SKSYKASAPS KKLTTLFYVA YITLGLTTPF LLPARMASKD

      51  THNYKDEFCS QRSYTRF*

Protein Sequence for YBR201C-A_M22 from WashU:

YBR201C-A_M22 [source=WashU]  Length: 68  Mon Oct 23 04:59:15 2017  Type: P  Check: 1863  ..

       1  MLAMKSFSQV SKSYKASAPS KKLTTLFYVA YITLGLTTPF LLPARMASKD

      51  THNYKDEFCS QRSYTRF*

Protein Sequence for YBR201C-A_PW5 from WashU:

YBR201C-A_PW5 [source=WashU]  Length: 68  Mon Oct 23 04:59:15 2017  Type: P  Check: 2446  ..

       1  MLAMKSFSQV SKSYKASAPS KKLTTLFYVA YITLGLTTPF LLPARMASKD

      51  THYYKDEFCS QRSYTRF*

Protein Sequence for YBR201C-A_T7 from WashU:

YBR201C-A_T7 [source=WashU]  Length: 68  Mon Oct 23 04:59:15 2017  Type: P  Check: 2446  ..

       1  MLAMKSFSQV SKSYKASAPS KKLTTLFYVA YITLGLTTPF LLPARMASKD

      51  THYYKDEFCS QRSYTRF*

Protein Sequence for YBR201C-A_T73 from WashU:

YBR201C-A_T73 [source=WashU]  Length: 68  Mon Oct 23 04:59:15 2017  Type: P  Check: 1863  ..

       1  MLAMKSFSQV SKSYKASAPS KKLTTLFYVA YITLGLTTPF LLPARMASKD

      51  THNYKDEFCS QRSYTRF*

Protein Sequence for YBR201C-A_UC5 from WashU:

YBR201C-A_UC5 [source=WashU]  Length: 68  Mon Oct 23 04:59:15 2017  Type: P  Check: 2446  ..

       1  MLAMKSFSQV SKSYKASAPS KKLTTLFYVA YITLGLTTPF LLPARMASKD

      51  THYYKDEFCS QRSYTRF*

Protein Sequence for YBR201C-A_VL3 from AWRI:

YBR201C-A_VL3 [source=AWRI]  Length: 68  Mon Oct 23 04:59:15 2017  Type: P  Check: 1863  ..

       1  MLAMKSFSQV SKSYKASAPS KKLTTLFYVA YITLGLTTPF LLPARMASKD

      51  THNYKDEFCS QRSYTRF*

Protein Sequence for YBR201C-A_Vin13 from AWRI:

YBR201C-A_Vin13 [source=AWRI]  Length: 68  Mon Oct 23 04:59:15 2017  Type: P  Check: 1863  ..

       1  MLAMKSFSQV SKSYKASAPS KKLTTLFYVA YITLGLTTPF LLPARMASKD

      51  THNYKDEFCS QRSYTRF*

Protein Sequence for YBR201C-A_Y10 from WashU:

YBR201C-A_Y10 [source=WashU]  Length: 68  Mon Oct 23 04:59:15 2017  Type: P  Check: 2446  ..

       1  MLAMKSFSQV SKSYKASAPS KKLTTLFYVA YITLGLTTPF LLPARMASKD

      51  THYYKDEFCS QRSYTRF*

Protein Sequence for YBR201C-A_YJM269 from WashU:

YBR201C-A_YJM269 [source=WashU]  Length: 68  Mon Oct 23 04:59:15 2017  Type: P  Check: 2446  ..

       1  MLAMKSFSQV SKSYKASAPS KKLTTLFYVA YITLGLTTPF LLPARMASKD

      51  THYYKDEFCS QRSYTRF*

Protein Sequence for YBR201C-A_YJM789 from Stanford:

YBR201C-A_YJM789 [source=Stanford]  Length: 68  Mon Oct 23 04:59:15 2017  Type: P  Check: 2446  ..

       1  MLAMKSFSQV SKSYKASAPS KKLTTLFYVA YITLGLTTPF LLPARMASKD

      51  THYYKDEFCS QRSYTRF*

Protein Sequence for YBR201C-A_ZTW1 from Zhejiang:

YBR201C-A_ZTW1 [source=Zhejiang]  Length: 68  Mon Oct 23 04:59:15 2017  Type: P  Check: 2446  ..

       1  MLAMKSFSQV SKSYKASAPS KKLTTLFYVA YITLGLTTPF LLPARMASKD

      51  THYYKDEFCS QRSYTRF*