YBR141W-A S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YBR141W-A_S288C   1   MSPIEPRRFCNSVLSQYLECVTQACGRTIKM   31
YBR141W-A_AWRI1631   1   MSPIEPRRFCNSVLSQYLECVTQACGRTIKM   31
YBR141W-A_AWRI796   1   MSPIEPRRFCNSVLSQYLECVTQACGRTIKM   31
YBR141W-A_CBS7960   1   MSPIEPRRFCNSVLSQYLECVTQACGRTIKM   31
YBR141W-A_CLIB215   1   MSPIEPRRFCNSVLSQYLECVTQACGRTIKM   31
YBR141W-A_CLIB324   1   MSPIEPRRFCNSVLSQYLECVTQACGRTIKM   31
YBR141W-A_EC1118   1   MSPIEPRRFCNSVLSQYLECVTQACGRTIKM   31
YBR141W-A_EC9-8   1   MSPIEPRRFCNSVLSQYLECVTQACGRTIKM   31
YBR141W-A_FostersB   1   MSPIEXRRFCNSVLXQYLECVTQACGRTIKM   31
YBR141W-A_FostersO   1   MSPIEQRRFCNSVLSQYLECVTQACGRTIKM   31
YBR141W-A_JAY291   1   MSPIEPRRFCNSVLSQYLECVTQACGRTIKM   31
YBR141W-A_Kyokai7   1   MSPIEPRRFCNSVLSQYLECVTQACGRTIKM   31
YBR141W-A_LalvinQA23   1   MSPIEPRRFCNSVLSQYLECVTQACGRTIKM   31
YBR141W-A_M22   1   MSPIEPRRFCNSVLSQYLECVTQACGRTIKM   31
YBR141W-A_PW5   1   MSPIEPRRFCNSVLSQYLECVTQACGRTIKM   31
YBR141W-A_T7   1   MSPIEPRRFCNSVLSQYLECVTQACGRTIKM   31
YBR141W-A_T73   1   MSPIEPRRFCNSVLSQYLECVTQACGRTIKM   31
YBR141W-A_UC5   1   MSPIEPRRFCNSVLSQYLECVTQACGRTIKM   31
YBR141W-A_VL3   1   MSPIEQRRFCNSVLSQYLECVTQACGRTIKM   31
YBR141W-A_Y10   1   MSPIEPRRFCNSVLSQYLECVTQACGRTIKM   31
YBR141W-A_YJM269   1   MSPIEPRRFCNSVLSQYLECVTQACGRTIKM   31
YBR141W-A_YJM789   1   MSPIEPRRFCNSVLSQYLECVTQACGRTIKM   31
YBR141W-A_ZTW1   1   MSPIEPRRFCNSVLSQYLECVTQACGRTIKM   31
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YBR141W-A_S288C from SGD:

YBR141W-A_S288C [source=SGD]  Length: 32  Fri Sep 22 22:00:48 2017  Type: P  Check: 9501  ..

       1  MSPIEPRRFC NSVLSQYLEC VTQACGRTIK M*

Protein Sequence for YBR141W-A_AWRI1631 from AWRI:

YBR141W-A_AWRI1631 [source=AWRI]  Length: 32  Fri Sep 22 22:00:48 2017  Type: P  Check: 9501  ..

       1  MSPIEPRRFC NSVLSQYLEC VTQACGRTIK M*

Protein Sequence for YBR141W-A_AWRI796 from AWRI:

YBR141W-A_AWRI796 [source=AWRI]  Length: 32  Fri Sep 22 22:00:48 2017  Type: P  Check: 9501  ..

       1  MSPIEPRRFC NSVLSQYLEC VTQACGRTIK M*

Protein Sequence for YBR141W-A_CBS7960 from WashU:

YBR141W-A_CBS7960 [source=WashU]  Length: 32  Fri Sep 22 22:00:48 2017  Type: P  Check: 9501  ..

       1  MSPIEPRRFC NSVLSQYLEC VTQACGRTIK M*

Protein Sequence for YBR141W-A_CLIB215 from WashU:

YBR141W-A_CLIB215 [source=WashU]  Length: 32  Fri Sep 22 22:00:48 2017  Type: P  Check: 9501  ..

       1  MSPIEPRRFC NSVLSQYLEC VTQACGRTIK M*

Protein Sequence for YBR141W-A_CLIB324 from WashU:

YBR141W-A_CLIB324 [source=WashU]  Length: 32  Fri Sep 22 22:00:48 2017  Type: P  Check: 9501  ..

       1  MSPIEPRRFC NSVLSQYLEC VTQACGRTIK M*

Protein Sequence for YBR141W-A_EC1118 from Genoscope:

YBR141W-A_EC1118 [source=Genoscope]  Length: 32  Fri Sep 22 22:00:48 2017  Type: P  Check: 9501  ..

       1  MSPIEPRRFC NSVLSQYLEC VTQACGRTIK M*

Protein Sequence for YBR141W-A_EC9-8 from ASinica:

YBR141W-A_EC9-8 [source=ASinica]  Length: 32  Fri Sep 22 22:00:48 2017  Type: P  Check: 9501  ..

       1  MSPIEPRRFC NSVLSQYLEC VTQACGRTIK M*

Protein Sequence for YBR141W-A_FostersB from AWRI:

YBR141W-A_FostersB [source=AWRI]  Length: 32  Fri Sep 22 22:00:48 2017  Type: P  Check: 9624  ..

       1  MSPIEXRRFC NSVLXQYLEC VTQACGRTIK M*

Protein Sequence for YBR141W-A_FostersO from AWRI:

YBR141W-A_FostersO [source=AWRI]  Length: 32  Fri Sep 22 22:00:48 2017  Type: P  Check: 9507  ..

       1  MSPIEQRRFC NSVLSQYLEC VTQACGRTIK M*

Protein Sequence for YBR141W-A_JAY291 from Duke:

YBR141W-A_JAY291 [source=Duke]  Length: 32  Fri Sep 22 22:00:48 2017  Type: P  Check: 9501  ..

       1  MSPIEPRRFC NSVLSQYLEC VTQACGRTIK M*

Protein Sequence for YBR141W-A_Kyokai7 from NRIB:

YBR141W-A_Kyokai7 [source=NRIB]  Length: 32  Fri Sep 22 22:00:48 2017  Type: P  Check: 9501  ..

       1  MSPIEPRRFC NSVLSQYLEC VTQACGRTIK M*

Protein Sequence for YBR141W-A_LalvinQA23 from AWRI:

YBR141W-A_LalvinQA23 [source=AWRI]  Length: 32  Fri Sep 22 22:00:48 2017  Type: P  Check: 9501  ..

       1  MSPIEPRRFC NSVLSQYLEC VTQACGRTIK M*

Protein Sequence for YBR141W-A_M22 from WashU:

YBR141W-A_M22 [source=WashU]  Length: 32  Fri Sep 22 22:00:48 2017  Type: P  Check: 9501  ..

       1  MSPIEPRRFC NSVLSQYLEC VTQACGRTIK M*

Protein Sequence for YBR141W-A_PW5 from WashU:

YBR141W-A_PW5 [source=WashU]  Length: 32  Fri Sep 22 22:00:48 2017  Type: P  Check: 9501  ..

       1  MSPIEPRRFC NSVLSQYLEC VTQACGRTIK M*

Protein Sequence for YBR141W-A_T7 from WashU:

YBR141W-A_T7 [source=WashU]  Length: 32  Fri Sep 22 22:00:48 2017  Type: P  Check: 9501  ..

       1  MSPIEPRRFC NSVLSQYLEC VTQACGRTIK M*

Protein Sequence for YBR141W-A_T73 from WashU:

YBR141W-A_T73 [source=WashU]  Length: 32  Fri Sep 22 22:00:48 2017  Type: P  Check: 9501  ..

       1  MSPIEPRRFC NSVLSQYLEC VTQACGRTIK M*

Protein Sequence for YBR141W-A_UC5 from WashU:

YBR141W-A_UC5 [source=WashU]  Length: 32  Fri Sep 22 22:00:48 2017  Type: P  Check: 9501  ..

       1  MSPIEPRRFC NSVLSQYLEC VTQACGRTIK M*

Protein Sequence for YBR141W-A_VL3 from AWRI:

YBR141W-A_VL3 [source=AWRI]  Length: 32  Fri Sep 22 22:00:48 2017  Type: P  Check: 9507  ..

       1  MSPIEQRRFC NSVLSQYLEC VTQACGRTIK M*

Protein Sequence for YBR141W-A_Y10 from WashU:

YBR141W-A_Y10 [source=WashU]  Length: 32  Fri Sep 22 22:00:48 2017  Type: P  Check: 9501  ..

       1  MSPIEPRRFC NSVLSQYLEC VTQACGRTIK M*

Protein Sequence for YBR141W-A_YJM269 from WashU:

YBR141W-A_YJM269 [source=WashU]  Length: 32  Fri Sep 22 22:00:48 2017  Type: P  Check: 9501  ..

       1  MSPIEPRRFC NSVLSQYLEC VTQACGRTIK M*

Protein Sequence for YBR141W-A_YJM789 from Stanford:

YBR141W-A_YJM789 [source=Stanford]  Length: 32  Fri Sep 22 22:00:48 2017  Type: P  Check: 9501  ..

       1  MSPIEPRRFC NSVLSQYLEC VTQACGRTIK M*

Protein Sequence for YBR141W-A_ZTW1 from Zhejiang:

YBR141W-A_ZTW1 [source=Zhejiang]  Length: 32  Fri Sep 22 22:00:48 2017  Type: P  Check: 9501  ..

       1  MSPIEPRRFC NSVLSQYLEC VTQACGRTIK M*