TPS1/YBR126C S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YBR126C_S288C   1   MTTDNAKAQLTSSSGGNIIVVSNRLPVTITKNSSTGQYEYAMSSGGLVTA   50
YBR126C_AWRI1631   1   MTTDNAKAQLTSSSGGNIIVVSNRLPVTITKNSSTGQYEYAMSSGGLVTA   50
YBR126C_AWRI796   1   MTTDNAKAQLTSSSGGNIIVVSNRLPVTITKNSSTGQYEYAMSSGGLVTA   50
YBR126C_BC187   1   MTTDNAKAQLTSSSGGNIIVVSNRLPVTITKNSSTGQYEYAMSSGGLVTA   50
YBR126C_BY4741   1   MTTDNAKAQLTSSSGGNIIVVSNRLPVTITKNSSTGQYEYAMSSGGLVTA   50
YBR126C_BY4742   1   MTTDNAKAQLTSSSGGNIIVVSNRLPVTITKNSSTGQYEYAMSSGGLVTA   50
YBR126C_CBS7960   1   MTTDNAKAQLTSSSGGNIIVVSNRLPVTITKNSSTGQYEYAMSSGGLVTA   50
YBR126C_CEN.PK   1   MTTDNAKAQLTSSSGGNIIVVSNRLPVTITKNSSTGQYEYAMSSGGLVTA   50
YBR126C_D273-10B   1   MTTDNAKAQLTSSSGGNIIVVSNRLPVTITKNSSTGQYEYAMSSGGLVTA   50
YBR126C_DBVPG6044   1   MTTDNAKAQLTSSSGGNIIVVSNRLPVTITKNSSTGQYEYAMSSGGLVTA   50
YBR126C_EC1118   1   MTTDNAKAQLTSSSGGNIIVVSNRLPVTITKNSSTGQYEYAMSSGGLVTA   50
YBR126C_FL100   1   MTTDNAKAQLTSSSGGNIIVVSNRLPVTITKNSSTGQYEYAMSSGGLVTA   50
YBR126C_FY1679   1   MTTDNAKAQLTSSSGGNIIVVSNRLPVTITKNSSTGQYEYAMSSGGLVTA   50
YBR126C_FostersB   1   MTTDNAKAQLTSSSGGNIIVVSNRLPVTITKNSSTGQYEYAMSSGGLVTA   50
YBR126C_FostersO   1   MTTDNAKAQLTSSSGGNIIVVSNRLPVTITKNSSTGQYEYAMSSGGLVTA   50
YBR126C_JAY291   1   MTTDNAKAQLTSSSGGNIIVVSNRLPVTITKNSSTGQYEYAMSSGGLVTA   50
YBR126C_JK9-3d   1   MTTDNAKAQLTSSSGGNIIVVSNRLPVTITKNSSTGQYEYAMSSGGLVTA   50
YBR126C_K11   1   MTTDNAKAQLTSSSGGNIIVVSNRLPVTITKNSSTGQYEYAMSSGGLVTA   50
YBR126C_Kyokai7   1   MTTDNAKAQLTSSSGGNIIVVSNRLPVTITKNSSTGQYEYAMSSGGLVTA   50
YBR126C_L1528   1   MTTDNAKAQLTSSSGGNIIVVSNRLPVTITKNSSTGQYEYAMSSGGLVTA   50
YBR126C_LalvinQA23   1   MTTDNAKAQLTSSSGGNIIVVSNRLPVTITKNSSTGQYEYAMXSGGLVTA   50
YBR126C_PW5   1   MTTDNAKAQLTSSSGGNIIVVSNRLPVTITKNSSTGQYEYAMSSGGLVTA   50
YBR126C_RM11-1a   1   MTTDNAKAQLTSSSGGNIIVVSNRLPVTITKNSSTGQYEYAMSSGGLVTA   50
YBR126C_RedStar   1   MTTDNAKAQLTSSSGGNIIVVSNRLPVTITKNSSTGQYEYAMSSGGLVTA   50
YBR126C_SEY6210   1   MTTDNAKAQLTSSSGGNIIVVSNRLPVTITKNSSTGQYEYAMSSGGLVTA   50
YBR126C_SK1   1   MTTDNAKAQLTSSSGGNIIVVSNRLPVTITKNSSTGQYEYAMSSGGLVTA   50
YBR126C_T7   1   MTTDNAKAQLTSSSGGNIIVVSNRLPVTITKNSSTGQYEYAMSSGGLVTA   50
YBR126C_T73   
   --------------------------------------------------   
YBR126C_UC5   1   MTTDNAKAQLTSSSGGNIIVVSNRLPVTITKNSSTGQYEYAMSSGGLVTA   50
YBR126C_VL3   1   MTTDNAKAQLTSSSGGNIIVVSNRLPVXITKNSSTGQYEYAMSSGGLVTA   50
YBR126C_Vin13   1   MTTDNAKAQLTSSSGGNIIVVSNRLPVXITKNSSTGQYEYAMXSGGLVTA   50
YBR126C_X2180-1A   1   MTTDNAKAQLTSSSGGNIIVVSNRLPVTITKNSSTGQYEYAMSSGGLVTA   50
YBR126C_Y55   1   MTTDNAKAQLTSSSGGNIIVVSNRLPVTITKNSSTGQYEYAMSSGGLVTA   50
YBR126C_YJM339   1   MTTDNAKAQLTSSSGGNIIVVSNRLPVTITKNSSTGQYEYAMSSGGLVTA   50
YBR126C_YJM789   1   MTTDNAKAQLTSSSGGNIIVVSNRLPVTITKNSSTGQYEYAMSSGGLVTA   50
YBR126C_YPH499   1   MTTDNAKAQLTSSSGGNIIVVSNRLPVTITKNSSTGQYEYAMSSGGLVTA   50
YBR126C_YPS128   1   MTTDNAKAQLTSSSGGNIIVVSNRLPVTITKNSSTGQYEYAMSSGGLVTA   50
YBR126C_YPS163   1   MTTDNAKAQLTSSSGGNIIVVSNRLPVTITKNSSTGQYEYAMSSGGLVTA   50
YBR126C_YS9   1   MTTDNAKAQLTSSSGGNIIVVSNRLPVTITKNSSTGQYEYAMSSGGLVTA   50
YBR126C_ZTW1   1   MTTDNAKAQLTSSSGGNIIVVSNRLPVTITKNSSTGQYEYAMSSGGLVTA   50
         

YBR126C_S288C   51   LEGLKKTYTFKWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADL   100
YBR126C_AWRI1631   51   LEGLKKTYTFKWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADL   100
YBR126C_AWRI796   51   LEGLKKTYTFKWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADL   100
YBR126C_BC187   51   LEGLKKTYTFKWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADL   100
YBR126C_BY4741   51   LEGLKKTYTFKWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADL   100
YBR126C_BY4742   51   LEGLKKTYTFKWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADL   100
YBR126C_CBS7960   51   LEGLKKTYTFKWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADL   100
YBR126C_CEN.PK   51   LEGLKKTYTFKWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADL   100
YBR126C_D273-10B   51   LEGLKKTYTFKWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADL   100
YBR126C_DBVPG6044   51   LEGLKKTYTFKWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADL   100
YBR126C_EC1118   51   LEGLKKTYTFKWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADL   100
YBR126C_FL100   51   LEGLKKTYTFKWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADL   100
YBR126C_FY1679   51   LEGLKKTYTFKWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADL   100
YBR126C_FostersB   51   LEGLKKTYTFKWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADL   100
YBR126C_FostersO   51   LEGLKKTYTFKWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADL   100
YBR126C_JAY291   51   LEGLKKTYTFKWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADL   100
YBR126C_JK9-3d   51   LEGLKKTYTFKWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADL   100
YBR126C_K11   51   LEGLKKTYTFKWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADL   100
YBR126C_Kyokai7   51   LEGLKKTYTFKWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADL   100
YBR126C_L1528   51   LEGLKKTYTFKWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADL   100
YBR126C_LalvinQA23   51   LEGLKKTYTFKWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADL   100
YBR126C_PW5   51   LEGLKKTYTFKWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADL   100
YBR126C_RM11-1a   51   LEGLKKTYTFKWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADL   100
YBR126C_RedStar   51   LEGLKKTYTFKWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADL   100
YBR126C_SEY6210   51   LEGLKKTYTFKWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADL   100
YBR126C_SK1   51   LEGLKKTYTFKWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADL   100
YBR126C_T7   51   LEGLKKTYTFKWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADL   100
YBR126C_T73   
   --------------------------------------------------   
YBR126C_UC5   51   LEGLKKTYTFKWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADL   100
YBR126C_VL3   51   LEGLKKTYTFKWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADL   100
YBR126C_Vin13   51   LEGLKKTYTFKWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADL   100
YBR126C_X2180-1A   51   LEGLKKTYTFKWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADL   100
YBR126C_Y55   51   LEGLKKTYTFKWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADL   100
YBR126C_YJM339   51   LEGLKKTYTFKWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADL   100
YBR126C_YJM789   51   LEGLKKTYTFKWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADL   100
YBR126C_YPH499   51   LEGLKKTYTFKWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADL   100
YBR126C_YPS128   51   LEGLKKTYTFKWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADL   100
YBR126C_YPS163   51   LEGLKKTYTFKWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADL   100
YBR126C_YS9   51   LEGLKKTYTFKWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADL   100
YBR126C_ZTW1   51   LEGLKKTYTFKWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADL   100
         

YBR126C_S288C   101   HYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQTFTNEIAKTMNHND   150
YBR126C_AWRI1631   101   HYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQTFTNEIAKTMNHND   150
YBR126C_AWRI796   101   HYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQTFTNEIAKTMNHND   150
YBR126C_BC187   101   HYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQTFTNEIAKTMNHND   150
YBR126C_BY4741   101   HYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQTFTNEIAKTMNHND   150
YBR126C_BY4742   101   HYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQTFTNEIAKTMNHND   150
YBR126C_CBS7960   101   HYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQTFTNEIAKTMNHND   150
YBR126C_CEN.PK   101   HYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQTFTNEIAKTMNHND   150
YBR126C_D273-10B   101   HYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQTFTNEIAKTMNHND   150
YBR126C_DBVPG6044   101   HYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQTFTNEIAKTMNHND   150
YBR126C_EC1118   101   HYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQTFTNEIAKTMNHND   150
YBR126C_FL100   101   HYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQTFTNEIAKTMNHND   150
YBR126C_FY1679   101   HYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQTFTNEIAKTMNHND   150
YBR126C_FostersB   101   HYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQTFTNEIXKTMNHND   150
YBR126C_FostersO   101   HYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQTFTNEIXKTMNHND   150
YBR126C_JAY291   101   HYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQTFTNEIAKTMNHND   150
YBR126C_JK9-3d   101   HYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQTFTNEIAKTMNHND   150
YBR126C_K11   101   HYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQTFTNEIAKTMNHND   150
YBR126C_Kyokai7   101   HYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQTFTNEIAKTMNHND   150
YBR126C_L1528   101   HYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQTFTNEIAKTMNHND   150
YBR126C_LalvinQA23   101   HYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQTFTNEIAKTMNHND   150
YBR126C_PW5   101   HYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQTFTNEIAKTMNHND   150
YBR126C_RM11-1a   101   HYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQTFTNEIAKTMNHND   150
YBR126C_RedStar   101   HYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQTFTNEIAKTMNHND   150
YBR126C_SEY6210   101   HYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQTFTNEIAKTMNHND   150
YBR126C_SK1   101   HYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQTFTNEIAKTMNHND   150
YBR126C_T7   101   HYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQTFTNEIAKTMNHND   150
YBR126C_T73   1   ---------------------------------------------MNHND   5
YBR126C_UC5   101   HYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQTFTNEIAKTMNHND   150
YBR126C_VL3   101   HYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQTFTNEIAKTMNHND   150
YBR126C_Vin13   101   HYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQTFTNEIAKTMNHND   150
YBR126C_X2180-1A   101   HYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQTFTNEIAKTMNHND   150
YBR126C_Y55   101   HYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQTFTNEIAKTMNHND   150
YBR126C_YJM339   101   HYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQTFTNEIAKTMNHND   150
YBR126C_YJM789   101   HYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQTFTNEIAKTMNHND   150
YBR126C_YPH499   101   HYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQTFTNEIAKTMNHND   150
YBR126C_YPS128   101   HYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQTFTNEIAKTMNHND   150
YBR126C_YPS163   101   HYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQTFTNEIAKTMNHND   150
YBR126C_YS9   101   HYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQTFTNEIAKTMNHND   150
YBR126C_ZTW1   101   HYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANQTFTNEIAKTMNHND   150
         

YBR126C_S288C   151   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   200
YBR126C_AWRI1631   151   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   200
YBR126C_AWRI796   151   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   200
YBR126C_BC187   151   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   200
YBR126C_BY4741   151   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   200
YBR126C_BY4742   151   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   200
YBR126C_CBS7960   151   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   200
YBR126C_CEN.PK   151   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   200
YBR126C_D273-10B   151   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   200
YBR126C_DBVPG6044   151   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   200
YBR126C_EC1118   151   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   200
YBR126C_FL100   151   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   200
YBR126C_FY1679   151   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   200
YBR126C_FostersB   151   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   200
YBR126C_FostersO   151   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   200
YBR126C_JAY291   151   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   200
YBR126C_JK9-3d   151   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   200
YBR126C_K11   151   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   200
YBR126C_Kyokai7   151   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   200
YBR126C_L1528   151   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   200
YBR126C_LalvinQA23   151   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   200
YBR126C_PW5   151   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   200
YBR126C_RM11-1a   151   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   200
YBR126C_RedStar   151   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   200
YBR126C_SEY6210   151   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   200
YBR126C_SK1   151   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   200
YBR126C_T7   151   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   200
YBR126C_T73   6   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   55
YBR126C_UC5   151   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   200
YBR126C_VL3   151   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   200
YBR126C_Vin13   151   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   200
YBR126C_X2180-1A   151   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   200
YBR126C_Y55   151   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   200
YBR126C_YJM339   151   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   200
YBR126C_YJM789   151   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   200
YBR126C_YPH499   151   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   200
YBR126C_YPS128   151   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   200
YBR126C_YPS163   151   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   200
YBR126C_YS9   151   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   200
YBR126C_ZTW1   151   LIWVHDYHLMLVPEMLRVKIHEKQLQNVKVGWFLHTPFPSSEIYRILPVR   200
         

YBR126C_S288C   201   QEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEYQGRFVNV   250
YBR126C_AWRI1631   201   QEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEYQGRFVNV   250
YBR126C_AWRI796   201   QEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEYQGRFVNV   250
YBR126C_BC187   201   QEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEYQGRFVNV   250
YBR126C_BY4741   201   QEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEYQGRFVNV   250
YBR126C_BY4742   201   QEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEYQGRFVNV   250
YBR126C_CBS7960   201   QEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEYQGRFVNV   250
YBR126C_CEN.PK   201   QEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEYQGRFVNV   250
YBR126C_D273-10B   201   QEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEYQGRFVNV   250
YBR126C_DBVPG6044   201   QEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEYQGRFVNV   250
YBR126C_EC1118   201   QEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEYQGRFVNV   250
YBR126C_FL100   201   QEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEYQGRFVNV   250
YBR126C_FY1679   201   QEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEYQGRFVNV   250
YBR126C_FostersB   201   QEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEYQGRFVNV   250
YBR126C_FostersO   201   QEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEYQGRFVNV   250
YBR126C_JAY291   201   QEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEYQGRFVNV   250
YBR126C_JK9-3d   201   QEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEYQGRFVNV   250
YBR126C_K11   201   QEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEYQGRFVNV   250
YBR126C_Kyokai7   201   QEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEYQGRFVNV   250
YBR126C_L1528   201   QEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEYQGRFVNV   250
YBR126C_LalvinQA23   201   QEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEYQGRFVNV   250
YBR126C_PW5   201   QEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEYQGRFVNV   250
YBR126C_RM11-1a   201   QEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEYQGRFVNV   250
YBR126C_RedStar   201   QEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEYQGRFVNV   250
YBR126C_SEY6210   201   QEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEYQGRFVNV   250
YBR126C_SK1   201   QEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEYQGRFVNV   250
YBR126C_T7   201   QEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEYQGRFVNV   250
YBR126C_T73   56   QEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEYQGRFVNV   105
YBR126C_UC5   201   QEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEYQGRFVNV   250
YBR126C_VL3   201   QEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEYQGRFVNV   250
YBR126C_Vin13   201   QEILKGVLSCDFSRVPHIRLCKTFLVFXAKGA------------------   232
YBR126C_X2180-1A   201   QEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEYQGRFVNV   250
YBR126C_Y55   201   QEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEYQGRFVNV   250
YBR126C_YJM339   201   QEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEYQGRFVNV   250
YBR126C_YJM789   201   QEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEYQGRFVNV   250
YBR126C_YPH499   201   QEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEYQGRFVNV   250
YBR126C_YPS128   201   QEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEYQGRFVNV   250
YBR126C_YPS163   201   QEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEYQGRFVNV   250
YBR126C_YS9   201   QEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEYQGRFVNV   250
YBR126C_ZTW1   201   QEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNGVEYQGRFVNV   250
         

YBR126C_S288C   251   GAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV   300
YBR126C_AWRI1631   251   GAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV   300
YBR126C_AWRI796   251   GAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV   300
YBR126C_BC187   251   GAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV   300
YBR126C_BY4741   251   GAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV   300
YBR126C_BY4742   251   GAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV   300
YBR126C_CBS7960   251   GAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV   300
YBR126C_CEN.PK   251   GAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV   300
YBR126C_D273-10B   251   GAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV   300
YBR126C_DBVPG6044   251   GAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV   300
YBR126C_EC1118   251   GAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV   300
YBR126C_FL100   251   GAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV   300
YBR126C_FY1679   251   GAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV   300
YBR126C_FostersB   251   GAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV   300
YBR126C_FostersO   251   GAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV   300
YBR126C_JAY291   251   GAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV   300
YBR126C_JK9-3d   251   GAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV   300
YBR126C_K11   251   GAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV   300
YBR126C_Kyokai7   251   GAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV   300
YBR126C_L1528   251   GAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV   300
YBR126C_LalvinQA23   251   GAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV   300
YBR126C_PW5   251   GAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV   300
YBR126C_RM11-1a   251   GAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV   300
YBR126C_RedStar   251   GAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV   300
YBR126C_SEY6210   251   GAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV   300
YBR126C_SK1   251   GAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV   300
YBR126C_T7   251   GAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV   300
YBR126C_T73   106   GAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV   155
YBR126C_UC5   251   GAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV   300
YBR126C_VL3   251   GAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV   300
YBR126C_Vin13   
   --------------------------------------------------   
YBR126C_X2180-1A   251   GAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV   300
YBR126C_Y55   251   GAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV   300
YBR126C_YJM339   251   GAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV   300
YBR126C_YJM789   251   GAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV   300
YBR126C_YPH499   251   GAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV   300
YBR126C_YPS128   251   GAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV   300
YBR126C_YPS163   251   GAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV   300
YBR126C_YS9   251   GAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV   300
YBR126C_ZTW1   251   GAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV   300
         

YBR126C_S288C   301   PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGR   350
YBR126C_AWRI1631   301   PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGR   350
YBR126C_AWRI796   301   PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGR   350
YBR126C_BC187   301   PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGR   350
YBR126C_BY4741   301   PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGR   350
YBR126C_BY4742   301   PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGR   350
YBR126C_CBS7960   301   PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGR   350
YBR126C_CEN.PK   301   PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGR   350
YBR126C_D273-10B   301   PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGR   350
YBR126C_DBVPG6044   301   PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGR   350
YBR126C_EC1118   301   PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGR   350
YBR126C_FL100   301   PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGR   350
YBR126C_FY1679   301   PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGR   350
YBR126C_FostersB   301   PQKLHAMEVFLNEHXEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGR   350
YBR126C_FostersO   301   PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGR   350
YBR126C_JAY291   301   PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGR   350
YBR126C_JK9-3d   301   PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGR   350
YBR126C_K11   301   PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGR   350
YBR126C_Kyokai7   301   PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGR   350
YBR126C_L1528   301   PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGR   350
YBR126C_LalvinQA23   301   PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGR   350
YBR126C_PW5   301   PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGR   350
YBR126C_RM11-1a   301   PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGR   350
YBR126C_RedStar   301   PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGR   350
YBR126C_SEY6210   301   PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGR   350
YBR126C_SK1   301   PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGR   350
YBR126C_T7   301   PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGR   350
YBR126C_T73   156   PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGR   205
YBR126C_UC5   301   PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGR   350
YBR126C_VL3   301   PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGR   350
YBR126C_Vin13   
   --------------------------------------------------   
YBR126C_X2180-1A   301   PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGR   350
YBR126C_Y55   301   PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGR   350
YBR126C_YJM339   301   PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGR   350
YBR126C_YJM789   301   PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGR   350
YBR126C_YPH499   301   PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGR   350
YBR126C_YPS128   301   PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGR   350
YBR126C_YPS163   301   PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGR   350
YBR126C_YS9   301   PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGR   350
YBR126C_ZTW1   301   PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGR   350
         

YBR126C_S288C   351   INGQFGTVEFVPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYE   400
YBR126C_AWRI1631   351   INGQFGTVEFVPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYE   400
YBR126C_AWRI796   351   INGQFGTVEFVPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYE   400
YBR126C_BC187   351   INGQFGTVEFVPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYE   400
YBR126C_BY4741   351   INGQFGTVEFVPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYE   400
YBR126C_BY4742   351   INGQFGTVEFVPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYE   400
YBR126C_CBS7960   351   INGQFGTVEFVPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYE   400
YBR126C_CEN.PK   351   INGQFGTVEFVPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYE   400
YBR126C_D273-10B   351   INGQFGTVEFVPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYE   400
YBR126C_DBVPG6044   351   INGQFGTVEFVPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYE   400
YBR126C_EC1118   351   INGQFGTVEFVPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYE   400
YBR126C_FL100   351   INGQFGTVEFVPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYE   400
YBR126C_FY1679   351   INGQFGTVEFVPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYE   400
YBR126C_FostersB   351   INGQFGTVEFVPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYE   400
YBR126C_FostersO   351   INGQFGTVEFVPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYE   400
YBR126C_JAY291   351   INGQFGTVEFVPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYE   400
YBR126C_JK9-3d   351   INGQFGTVEFVPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYE   400
YBR126C_K11   351   INGQFGTVEFVPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYE   400
YBR126C_Kyokai7   351   INGQFGTVEFVPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYE   400
YBR126C_L1528   351   INGQFGTVEFVPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYE   400
YBR126C_LalvinQA23   351   INGQFGTVEFVPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYE   400
YBR126C_PW5   351   INGQFGTVEFVPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYE   400
YBR126C_RM11-1a   351   INGQFGTVEFVPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYE   400
YBR126C_RedStar   351   INGQFGTVEFVPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYE   400
YBR126C_SEY6210   351   INGQFGTVEFVPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYE   400
YBR126C_SK1   351   INGQFGTVEFVPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYE   400
YBR126C_T7   351   INGQFGTVEFVPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYE   400
YBR126C_T73   206   INGQFGTVEFVPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYE   255
YBR126C_UC5   351   INGQFGTVEFVPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYE   400
YBR126C_VL3   351   INGQFGTVEFVPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYE   400
YBR126C_Vin13   
   --------------------------------------------------   
YBR126C_X2180-1A   351   INGQFGTVEFVPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYE   400
YBR126C_Y55   351   INGQFGTVEFVPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYE   400
YBR126C_YJM339   351   INGQFGTVEFVPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYE   400
YBR126C_YJM789   351   INGQFGTVEFVPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYE   400
YBR126C_YPH499   351   INGQFGTVEFVPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYE   400
YBR126C_YPS128   351   INGQFGTVEFVPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYE   400
YBR126C_YPS163   351   INGQFGTVEFVPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYE   400
YBR126C_YS9   351   INGQFGTVEFVPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYE   400
YBR126C_ZTW1   351   INGQFGTVEFVPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYE   400
         

YBR126C_S288C   401   YIACQEEKKGSLILSEFTGAAQSLNGAIIVNPWNTDDLSDAINEALTLPD   450
YBR126C_AWRI1631   401   YIACQEEKKGSLILSEFTGAAQSLNGAIIVNPWNTDDLSDAINEALTLPD   450
YBR126C_AWRI796   401   YIACQEEKKGSLILSEFTGAAQSLNGAIIVNPWNTDDLSDAINEALTLPD   450
YBR126C_BC187   401   YIACQEEKKGSLILSEFTGAAQSLNGAIIVNPWNTDDLSDAINEALTLPD   450
YBR126C_BY4741   401   YIACQEEKKGSLILSEFTGAAQSLNGAIIVNPWNTDDLSDAINEALTLPD   450
YBR126C_BY4742   401   YIACQEEKKGSLILSEFTGAAQSLNGAIIVNPWNTDDLSDAINEALTLPD   450
YBR126C_CBS7960   401   YIACQEEKKGSLILSEFTGAAQSLNGAIIVNPWNTDDLSDAINEALTLPD   450
YBR126C_CEN.PK   401   YIACQEEKKGSLILSEFTGAAQSLNGAIIVNPWNTDDLSDAINEALTLPD   450
YBR126C_D273-10B   401   YIACQEEKKGSLILSEFTGAAQSLNGAIIVNPWNTDDLSDAINEALTLPD   450
YBR126C_DBVPG6044   401   YIACQEEKKGSLILSEFTGAAQSLNGAIIVNPWNTDDLSDAINEALTLPD   450
YBR126C_EC1118   401   YIACQEEKKGSLILSEFTGAAQSLNGAIIVNPWNTDDLSDAINEALTLPD   450
YBR126C_FL100   401   YIACQEEKKGSLILSEFTGAAQSLNGAIIVNPWNTDDLSDAINEALTLPD   450
YBR126C_FY1679   401   YIACQEEKKGSLILSEFTGAAQSLNGAIIVNPWNTDDLSDAINEALTLPD   450
YBR126C_FostersB   401   YIACQEEKKGSLILSEFTGXAQSLNGAIIVNPWNTDDLSDAINEALTLPD   450
YBR126C_FostersO   401   YIACQEEKKGSLILSEFTGXAQSLNGAIIVNPWNTDDLSDAINEALTLPD   450
YBR126C_JAY291   401   YIACQEEKKGSLILSEFTGAAQSLNGAIIVNPWNTDDLSDAINEALTLPD   450
YBR126C_JK9-3d   401   YIACQEEKKGSLILSEFTGAAQSLNGAIIVNPWNTDDLSDAINEALTLPD   450
YBR126C_K11   401   YIACQEEKKGSLILSEFTGAAQSLNGAIIVNPWNTDDLSDAINEALTLPD   450
YBR126C_Kyokai7   401   YIACQEEKKGSLILSEFTGAAQSLNGAIIVNPWNTDDLSDAINEALTLPD   450
YBR126C_L1528   401   YIACQEEKKGSLILSEFTGAAQSLNGAIIVNPWNTDDLSDAINEALTLPD   450
YBR126C_LalvinQA23   401   YIACQEEKKGSLILSEFTGAAQSLNGAIIVNPWNTDDLSDAINEALTLPD   450
YBR126C_PW5   401   YIACQEEKKGSLILSEFTGAAQSLNGAIIVNPWNTDDLSDAINEALTLPD   450
YBR126C_RM11-1a   401   YIACQEEKKGSLILSEFTGAAQSLNGAIIVNPWNTDDLSDAINEALTLPD   450
YBR126C_RedStar   401   YIACQEEKKGSLILSEFTGAAQSLNGAIIVNPWNTDDLSDAINEALTLPD   450
YBR126C_SEY6210   401   YIACQEEKKGSLILSEFTGAAQSLNGAIIVNPWNTDDLSDAINEALTLPD   450
YBR126C_SK1   401   YIACQEEKKGSLILSEFTGAAQSLNGAIIVNPWNTDDLSDAINEALTLPD   450
YBR126C_T7   401   YIACQEEKKGSLILSEFTGAAQSLNGAIIVNPWNTDDLSDAINEALTLPD   450
YBR126C_T73   256   YIACQEEKKGSLILSEFTGAAQSLNGAIIVNPWNTDDLSDAINEALTLPD   305
YBR126C_UC5   401   YIACQEEKKGSLILSEFTGAAQSLNGAIIVNPWNTDDLSDAINEALTLPD   450
YBR126C_VL3   401   YIACQEEKKGSLILSEFTGAAQSLNGAIIVNPWNTDDLSDAINEALTLPD   450
YBR126C_Vin13   
   --------------------------------------------------   
YBR126C_X2180-1A   401   YIACQEEKKGSLILSEFTGAAQSLNGAIIVNPWNTDDLSDAINEALTLPD   450
YBR126C_Y55   401   YIACQEEKKGSLILSEFTGAAQSLNGAIIVNPWNTDDLSDAINEALTLPD   450
YBR126C_YJM339   401   YIACQEEKKGSLILSEFTGAAQSLNGAIIVNPWNTDDLSDAINEALTLPD   450
YBR126C_YJM789   401   YIACQEEKKGSLILSEFTGAAQSLNGAIIVNPWNTDDLSDAINEALTLPD   450
YBR126C_YPH499   401   YIACQEEKKGSLILSEFTGAAQSLNGAIIVNPWNTDDLSDAINEALTLPD   450
YBR126C_YPS128   401   YIACQEEKKGSLILSEFTGAAQSLNGAIIVNPWNTDDLSDAINEALTLPD   450
YBR126C_YPS163   401   YIACQEEKKGSLILSEFTGAAQSLNGAIIVNPWNTDDLSDAINEALTLPD   450
YBR126C_YS9   401   YIACQEEKKGSLILSEFTGAAQSLNGAIIVNPWNTDDLSDAINEALTLPD   450
YBR126C_ZTW1   401   YIACQEEKKGSLILSEFTGAAQSLNGAIIVNPWNTDDLSDAINEALTLPD   450
         

YBR126C_S288C   451   VKKEVNWEKLYKYISKYTSAFWGENFVHELYSTSSSSTSSSATKN   495
YBR126C_AWRI1631   451   VKKEVNWEKLYKYISKYTSAFWGENFVHELYSTSSSSTSSSATKN   495
YBR126C_AWRI796   451   VKKEVNWEKLYKYISKYTSAFWGENFVHELYSTSSSSTSSSATKN   495
YBR126C_BC187   451   VKKEVNWEKLYKYISKYTSAFWGENFVHELYSTSSSSTSSSATKN   495
YBR126C_BY4741   451   VKKEVNWEKLYKYISKYTSAFWGENFVHELYSTSSSSTSSSATKN   495
YBR126C_BY4742   451   VKKEVNWEKLYKYISKYTSAFWGENFVHELYSTSSSSTSSSATKN   495
YBR126C_CBS7960   451   VKKEVNWEKLYKYISKYTSAFWGENFVHELYSTSSSSTSSSATKN   495
YBR126C_CEN.PK   451   VKKEVNWEKLYKYISKYTSAFWGENFVHELYSTSSSSTSSSATKN   495
YBR126C_D273-10B   451   VKKEVNWEKLYKYISKYTSAFWGENFVHELYSTSSSSTSSSATKN   495
YBR126C_DBVPG6044   451   VKKEVNWEKLYKYISKYTSAFWGENFVHELYSTSSSSTSSSATKN   495
YBR126C_EC1118   451   VKKEVNWEKLYKYISKYTSAFWGENFVHELYSTSSSSTSSSATKN   495
YBR126C_FL100   451   VKKEVNWEKLYKYISKYTSAFWGENFVHELYSTSSSSTSSSATKN   495
YBR126C_FY1679   451   VKKEVNWEKLYKYISKYTSAFWGENFVHELYSTSSSSTSSSATKN   495
YBR126C_FostersB   451   VKKEVNWEKLYKYISKYTSAFWGENFVHELYSTSSSSTSSSATKN   495
YBR126C_FostersO   451   VKKEVNWEKLYKYISKYTSAFWGENFVHELYSTSSSSTSSSATKN   495
YBR126C_JAY291   451   VKKEVNWEKLYKYISKYTSAFWGENFVHELYSTSSSSTSSSATKN   495
YBR126C_JK9-3d   451   VKKEVNWEKLYKYISKYTSAFWGENFVHELYSTSSSSTSSSATKN   495
YBR126C_K11   451   VKKEVNWEKLYKYISKYTSAFWGENFVHELYSTSSSSTSSSATKN   495
YBR126C_Kyokai7   451   VKKEVNWEKLYKYISKYTSAFWGENFVHELYSTSSSSTSSSATKN   495
YBR126C_L1528   451   VKKEVNWEKLYKYISKYTSAFWGENFVHELYSTSSSSTSSSATKN   495
YBR126C_LalvinQA23   451   VKKEVNWEKLYKYISKYTSAFWGENFVHELYSTSSSSTSSSATKN   495
YBR126C_PW5   451   VKKEVNWEKLYKYISKYTSAFWGENFVHELYSTSSSSTSSSATKN   495
YBR126C_RM11-1a   451   VKKEVNWEKLYKYISKYTSAFWGENFVHELYSTSSSSTSSSATKN   495
YBR126C_RedStar   451   VKKEVNWEKLYKYISKYTSAFWGENFVHELYSTSSSSTSSSATKN   495
YBR126C_SEY6210   451   VKKEVNWEKLYKYISKYTSAFWGENFVHELYSTSSSSTSSSATKN   495
YBR126C_SK1   451   VKKEVNWEKLYKYISKYTSAFWGENFVHELYSTSSSSTSSSATKN   495
YBR126C_T7   451   VKKEVNWEKLYKYISKYTSAFWGENFVHELYSTSSSSTSSSATKN   495
YBR126C_T73   306   VKKEVNWEKLYKYISKYTSAFWGENFVHELYSTSSSSTSSSATKN   350
YBR126C_UC5   451   VKKEVNWEKLYKYISKYTSAFWGENFVHELYSTSSSSTSSSATKN   495
YBR126C_VL3   451   VKKEVNWEKLYKYISKYTSAFWGENFVHELYSTSSSSTSSSATKN   495
YBR126C_Vin13   
   ---------------------------------------------   
YBR126C_X2180-1A   451   VKKEVNWEKLYKYISKYTSAFWGENFVHELYSTSSSSTSSSATKN   495
YBR126C_Y55   451   VKKEVNWEKLYKYISKYTSAFWGENFVHELYSTSSSSTSSSATKN   495
YBR126C_YJM339   451   VKKEVNWEKLYKYISKYTSAFWGENFVHELYSTSSSSTSSSATKN   495
YBR126C_YJM789   451   VKKEVNWEKLYKYISKYTSAFWGENFVHELYSTSSSSTSSSATKN   495
YBR126C_YPH499   451   VKKEVNWEKLYKYISKYTSAFWGENFVHELYSTSSSSTSSSATKN   495
YBR126C_YPS128   451   VKKEVNWEKLYKYISKYTSAFWGENFVHELYSTSSSSTSSSATKN   495
YBR126C_YPS163   451   VKKEVNWEKLYKYISKYTSAFWGENFVHELYSTSSSSTSSSATKN   495
YBR126C_YS9   451   VKKEVNWEKLYKYISKYTSAFWGENFVHELYSTSSSSTSSSATKN   495
YBR126C_ZTW1   451   VKKEVNWEKLYKYISKYTSAFWGENFVHELYSTSSSSTSSSATKN   495
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YBR126C_S288C from SGD:

YBR126C_S288C [source=SGD]  Length: 496  Sun Feb 18 22:00:04 2018  Type: P  Check: 9177  ..

       1  MTTDNAKAQL TSSSGGNIIV VSNRLPVTIT KNSSTGQYEY AMSSGGLVTA

      51  LEGLKKTYTF KWFGWPGLEI PDDEKDQVRK DLLEKFNAVP IFLSDEIADL

     101  HYNGFSNSIL WPLFHYHPGE INFDENAWLA YNEANQTFTN EIAKTMNHND

     151  LIWVHDYHLM LVPEMLRVKI HEKQLQNVKV GWFLHTPFPS SEIYRILPVR

     201  QEILKGVLSC DLVGFHTYDY ARHFLSSVQR VLNVNTLPNG VEYQGRFVNV

     251  GAFPIGIDVD KFTDGLKKES VQKRIQQLKE TFKGCKIIVG VDRLDYIKGV

     301  PQKLHAMEVF LNEHPEWRGK VVLVQVAVPS RGDVEEYQYL RSVVNELVGR

     351  INGQFGTVEF VPIHFMHKSI PFEELISLYA VSDVCLVSST RDGMNLVSYE

     401  YIACQEEKKG SLILSEFTGA AQSLNGAIIV NPWNTDDLSD AINEALTLPD

     451  VKKEVNWEKL YKYISKYTSA FWGENFVHEL YSTSSSSTSS SATKN*


Protein Sequence for YBR126C_AWRI1631 from AWRI:

YBR126C_AWRI1631 [source=AWRI]  Length: 496  Sun Feb 18 22:00:04 2018  Type: P  Check: 9177  ..

       1  MTTDNAKAQL TSSSGGNIIV VSNRLPVTIT KNSSTGQYEY AMSSGGLVTA

      51  LEGLKKTYTF KWFGWPGLEI PDDEKDQVRK DLLEKFNAVP IFLSDEIADL

     101  HYNGFSNSIL WPLFHYHPGE INFDENAWLA YNEANQTFTN EIAKTMNHND

     151  LIWVHDYHLM LVPEMLRVKI HEKQLQNVKV GWFLHTPFPS SEIYRILPVR

     201  QEILKGVLSC DLVGFHTYDY ARHFLSSVQR VLNVNTLPNG VEYQGRFVNV

     251  GAFPIGIDVD KFTDGLKKES VQKRIQQLKE TFKGCKIIVG VDRLDYIKGV

     301  PQKLHAMEVF LNEHPEWRGK VVLVQVAVPS RGDVEEYQYL RSVVNELVGR

     351  INGQFGTVEF VPIHFMHKSI PFEELISLYA VSDVCLVSST RDGMNLVSYE

     401  YIACQEEKKG SLILSEFTGA AQSLNGAIIV NPWNTDDLSD AINEALTLPD

     451  VKKEVNWEKL YKYISKYTSA FWGENFVHEL YSTSSSSTSS SATKN*


Protein Sequence for YBR126C_AWRI796 from AWRI:

YBR126C_AWRI796 [source=AWRI]  Length: 496  Sun Feb 18 22:00:04 2018  Type: P  Check: 9177  ..

       1  MTTDNAKAQL TSSSGGNIIV VSNRLPVTIT KNSSTGQYEY AMSSGGLVTA

      51  LEGLKKTYTF KWFGWPGLEI PDDEKDQVRK DLLEKFNAVP IFLSDEIADL

     101  HYNGFSNSIL WPLFHYHPGE INFDENAWLA YNEANQTFTN EIAKTMNHND

     151  LIWVHDYHLM LVPEMLRVKI HEKQLQNVKV GWFLHTPFPS SEIYRILPVR

     201  QEILKGVLSC DLVGFHTYDY ARHFLSSVQR VLNVNTLPNG VEYQGRFVNV

     251  GAFPIGIDVD KFTDGLKKES VQKRIQQLKE TFKGCKIIVG VDRLDYIKGV

     301  PQKLHAMEVF LNEHPEWRGK VVLVQVAVPS RGDVEEYQYL RSVVNELVGR

     351  INGQFGTVEF VPIHFMHKSI PFEELISLYA VSDVCLVSST RDGMNLVSYE

     401  YIACQEEKKG SLILSEFTGA AQSLNGAIIV NPWNTDDLSD AINEALTLPD

     451  VKKEVNWEKL YKYISKYTSA FWGENFVHEL YSTSSSSTSS SATKN*


Protein Sequence for YBR126C_BC187 from Stanford:

YBR126C_BC187 [source=Stanford]  Length: 496  Sun Feb 18 22:00:04 2018  Type: P  Check: 9177  ..

       1  MTTDNAKAQL TSSSGGNIIV VSNRLPVTIT KNSSTGQYEY AMSSGGLVTA

      51  LEGLKKTYTF KWFGWPGLEI PDDEKDQVRK DLLEKFNAVP IFLSDEIADL

     101  HYNGFSNSIL WPLFHYHPGE INFDENAWLA YNEANQTFTN EIAKTMNHND

     151  LIWVHDYHLM LVPEMLRVKI HEKQLQNVKV GWFLHTPFPS SEIYRILPVR

     201  QEILKGVLSC DLVGFHTYDY ARHFLSSVQR VLNVNTLPNG VEYQGRFVNV

     251  GAFPIGIDVD KFTDGLKKES VQKRIQQLKE TFKGCKIIVG VDRLDYIKGV

     301  PQKLHAMEVF LNEHPEWRGK VVLVQVAVPS RGDVEEYQYL RSVVNELVGR

     351  INGQFGTVEF VPIHFMHKSI PFEELISLYA VSDVCLVSST RDGMNLVSYE

     401  YIACQEEKKG SLILSEFTGA AQSLNGAIIV NPWNTDDLSD AINEALTLPD

     451  VKKEVNWEKL YKYISKYTSA FWGENFVHEL YSTSSSSTSS SATKN*


Protein Sequence for YBR126C_BY4741 from Stanford:

YBR126C_BY4741 [source=Stanford]  Length: 496  Sun Feb 18 22:00:04 2018  Type: P  Check: 9177  ..

       1  MTTDNAKAQL TSSSGGNIIV VSNRLPVTIT KNSSTGQYEY AMSSGGLVTA

      51  LEGLKKTYTF KWFGWPGLEI PDDEKDQVRK DLLEKFNAVP IFLSDEIADL

     101  HYNGFSNSIL WPLFHYHPGE INFDENAWLA YNEANQTFTN EIAKTMNHND

     151  LIWVHDYHLM LVPEMLRVKI HEKQLQNVKV GWFLHTPFPS SEIYRILPVR

     201  QEILKGVLSC DLVGFHTYDY ARHFLSSVQR VLNVNTLPNG VEYQGRFVNV

     251  GAFPIGIDVD KFTDGLKKES VQKRIQQLKE TFKGCKIIVG VDRLDYIKGV

     301  PQKLHAMEVF LNEHPEWRGK VVLVQVAVPS RGDVEEYQYL RSVVNELVGR

     351  INGQFGTVEF VPIHFMHKSI PFEELISLYA VSDVCLVSST RDGMNLVSYE

     401  YIACQEEKKG SLILSEFTGA AQSLNGAIIV NPWNTDDLSD AINEALTLPD

     451  VKKEVNWEKL YKYISKYTSA FWGENFVHEL YSTSSSSTSS SATKN*


Protein Sequence for YBR126C_BY4742 from Stanford:

YBR126C_BY4742 [source=Stanford]  Length: 496  Sun Feb 18 22:00:04 2018  Type: P  Check: 9177  ..

       1  MTTDNAKAQL TSSSGGNIIV VSNRLPVTIT KNSSTGQYEY AMSSGGLVTA

      51  LEGLKKTYTF KWFGWPGLEI PDDEKDQVRK DLLEKFNAVP IFLSDEIADL

     101  HYNGFSNSIL WPLFHYHPGE INFDENAWLA YNEANQTFTN EIAKTMNHND

     151  LIWVHDYHLM LVPEMLRVKI HEKQLQNVKV GWFLHTPFPS SEIYRILPVR

     201  QEILKGVLSC DLVGFHTYDY ARHFLSSVQR VLNVNTLPNG VEYQGRFVNV

     251  GAFPIGIDVD KFTDGLKKES VQKRIQQLKE TFKGCKIIVG VDRLDYIKGV

     301  PQKLHAMEVF LNEHPEWRGK VVLVQVAVPS RGDVEEYQYL RSVVNELVGR

     351  INGQFGTVEF VPIHFMHKSI PFEELISLYA VSDVCLVSST RDGMNLVSYE

     401  YIACQEEKKG SLILSEFTGA AQSLNGAIIV NPWNTDDLSD AINEALTLPD

     451  VKKEVNWEKL YKYISKYTSA FWGENFVHEL YSTSSSSTSS SATKN*


Protein Sequence for YBR126C_CBS7960 from WashU:

YBR126C_CBS7960 [source=WashU]  Length: 496  Sun Feb 18 22:00:04 2018  Type: P  Check: 9177  ..

       1  MTTDNAKAQL TSSSGGNIIV VSNRLPVTIT KNSSTGQYEY AMSSGGLVTA

      51  LEGLKKTYTF KWFGWPGLEI PDDEKDQVRK DLLEKFNAVP IFLSDEIADL

     101  HYNGFSNSIL WPLFHYHPGE INFDENAWLA YNEANQTFTN EIAKTMNHND

     151  LIWVHDYHLM LVPEMLRVKI HEKQLQNVKV GWFLHTPFPS SEIYRILPVR

     201  QEILKGVLSC DLVGFHTYDY ARHFLSSVQR VLNVNTLPNG VEYQGRFVNV

     251  GAFPIGIDVD KFTDGLKKES VQKRIQQLKE TFKGCKIIVG VDRLDYIKGV

     301  PQKLHAMEVF LNEHPEWRGK VVLVQVAVPS RGDVEEYQYL RSVVNELVGR

     351  INGQFGTVEF VPIHFMHKSI PFEELISLYA VSDVCLVSST RDGMNLVSYE

     401  YIACQEEKKG SLILSEFTGA AQSLNGAIIV NPWNTDDLSD AINEALTLPD

     451  VKKEVNWEKL YKYISKYTSA FWGENFVHEL YSTSSSSTSS SATKN*


Protein Sequence for YBR126C_CEN.PK from Stanford:

YBR126C_CEN.PK [source=Stanford]  Length: 496  Sun Feb 18 22:00:04 2018  Type: P  Check: 9177  ..

       1  MTTDNAKAQL TSSSGGNIIV VSNRLPVTIT KNSSTGQYEY AMSSGGLVTA

      51  LEGLKKTYTF KWFGWPGLEI PDDEKDQVRK DLLEKFNAVP IFLSDEIADL

     101  HYNGFSNSIL WPLFHYHPGE INFDENAWLA YNEANQTFTN EIAKTMNHND

     151  LIWVHDYHLM LVPEMLRVKI HEKQLQNVKV GWFLHTPFPS SEIYRILPVR

     201  QEILKGVLSC DLVGFHTYDY ARHFLSSVQR VLNVNTLPNG VEYQGRFVNV

     251  GAFPIGIDVD KFTDGLKKES VQKRIQQLKE TFKGCKIIVG VDRLDYIKGV

     301  PQKLHAMEVF LNEHPEWRGK VVLVQVAVPS RGDVEEYQYL RSVVNELVGR

     351  INGQFGTVEF VPIHFMHKSI PFEELISLYA VSDVCLVSST RDGMNLVSYE

     401  YIACQEEKKG SLILSEFTGA AQSLNGAIIV NPWNTDDLSD AINEALTLPD

     451  VKKEVNWEKL YKYISKYTSA FWGENFVHEL YSTSSSSTSS SATKN*


Protein Sequence for YBR126C_D273-10B from Stanford:

YBR126C_D273-10B [source=Stanford]  Length: 496  Sun Feb 18 22:00:04 2018  Type: P  Check: 9177  ..

       1  MTTDNAKAQL TSSSGGNIIV VSNRLPVTIT KNSSTGQYEY AMSSGGLVTA

      51  LEGLKKTYTF KWFGWPGLEI PDDEKDQVRK DLLEKFNAVP IFLSDEIADL

     101  HYNGFSNSIL WPLFHYHPGE INFDENAWLA YNEANQTFTN EIAKTMNHND

     151  LIWVHDYHLM LVPEMLRVKI HEKQLQNVKV GWFLHTPFPS SEIYRILPVR

     201  QEILKGVLSC DLVGFHTYDY ARHFLSSVQR VLNVNTLPNG VEYQGRFVNV

     251  GAFPIGIDVD KFTDGLKKES VQKRIQQLKE TFKGCKIIVG VDRLDYIKGV

     301  PQKLHAMEVF LNEHPEWRGK VVLVQVAVPS RGDVEEYQYL RSVVNELVGR

     351  INGQFGTVEF VPIHFMHKSI PFEELISLYA VSDVCLVSST RDGMNLVSYE

     401  YIACQEEKKG SLILSEFTGA AQSLNGAIIV NPWNTDDLSD AINEALTLPD

     451  VKKEVNWEKL YKYISKYTSA FWGENFVHEL YSTSSSSTSS SATKN*


Protein Sequence for YBR126C_DBVPG6044 from Stanford:

YBR126C_DBVPG6044 [source=Stanford]  Length: 496  Sun Feb 18 22:00:04 2018  Type: P  Check: 9177  ..

       1  MTTDNAKAQL TSSSGGNIIV VSNRLPVTIT KNSSTGQYEY AMSSGGLVTA

      51  LEGLKKTYTF KWFGWPGLEI PDDEKDQVRK DLLEKFNAVP IFLSDEIADL

     101  HYNGFSNSIL WPLFHYHPGE INFDENAWLA YNEANQTFTN EIAKTMNHND

     151  LIWVHDYHLM LVPEMLRVKI HEKQLQNVKV GWFLHTPFPS SEIYRILPVR

     201  QEILKGVLSC DLVGFHTYDY ARHFLSSVQR VLNVNTLPNG VEYQGRFVNV

     251  GAFPIGIDVD KFTDGLKKES VQKRIQQLKE TFKGCKIIVG VDRLDYIKGV

     301  PQKLHAMEVF LNEHPEWRGK VVLVQVAVPS RGDVEEYQYL RSVVNELVGR

     351  INGQFGTVEF VPIHFMHKSI PFEELISLYA VSDVCLVSST RDGMNLVSYE

     401  YIACQEEKKG SLILSEFTGA AQSLNGAIIV NPWNTDDLSD AINEALTLPD

     451  VKKEVNWEKL YKYISKYTSA FWGENFVHEL YSTSSSSTSS SATKN*


Protein Sequence for YBR126C_EC1118 from Genoscope:

YBR126C_EC1118 [source=Genoscope]  Length: 496  Sun Feb 18 22:00:04 2018  Type: P  Check: 9177  ..

       1  MTTDNAKAQL TSSSGGNIIV VSNRLPVTIT KNSSTGQYEY AMSSGGLVTA

      51  LEGLKKTYTF KWFGWPGLEI PDDEKDQVRK DLLEKFNAVP IFLSDEIADL

     101  HYNGFSNSIL WPLFHYHPGE INFDENAWLA YNEANQTFTN EIAKTMNHND

     151  LIWVHDYHLM LVPEMLRVKI HEKQLQNVKV GWFLHTPFPS SEIYRILPVR

     201  QEILKGVLSC DLVGFHTYDY ARHFLSSVQR VLNVNTLPNG VEYQGRFVNV

     251  GAFPIGIDVD KFTDGLKKES VQKRIQQLKE TFKGCKIIVG VDRLDYIKGV

     301  PQKLHAMEVF LNEHPEWRGK VVLVQVAVPS RGDVEEYQYL RSVVNELVGR

     351  INGQFGTVEF VPIHFMHKSI PFEELISLYA VSDVCLVSST RDGMNLVSYE

     401  YIACQEEKKG SLILSEFTGA AQSLNGAIIV NPWNTDDLSD AINEALTLPD

     451  VKKEVNWEKL YKYISKYTSA FWGENFVHEL YSTSSSSTSS SATKN*


Protein Sequence for YBR126C_FL100 from Stanford:

YBR126C_FL100 [source=Stanford]  Length: 496  Sun Feb 18 22:00:04 2018  Type: P  Check: 9177  ..

       1  MTTDNAKAQL TSSSGGNIIV VSNRLPVTIT KNSSTGQYEY AMSSGGLVTA

      51  LEGLKKTYTF KWFGWPGLEI PDDEKDQVRK DLLEKFNAVP IFLSDEIADL

     101  HYNGFSNSIL WPLFHYHPGE INFDENAWLA YNEANQTFTN EIAKTMNHND

     151  LIWVHDYHLM LVPEMLRVKI HEKQLQNVKV GWFLHTPFPS SEIYRILPVR

     201  QEILKGVLSC DLVGFHTYDY ARHFLSSVQR VLNVNTLPNG VEYQGRFVNV

     251  GAFPIGIDVD KFTDGLKKES VQKRIQQLKE TFKGCKIIVG VDRLDYIKGV

     301  PQKLHAMEVF LNEHPEWRGK VVLVQVAVPS RGDVEEYQYL RSVVNELVGR

     351  INGQFGTVEF VPIHFMHKSI PFEELISLYA VSDVCLVSST RDGMNLVSYE

     401  YIACQEEKKG SLILSEFTGA AQSLNGAIIV NPWNTDDLSD AINEALTLPD

     451  VKKEVNWEKL YKYISKYTSA FWGENFVHEL YSTSSSSTSS SATKN*


Protein Sequence for YBR126C_FY1679 from Stanford:

YBR126C_FY1679 [source=Stanford]  Length: 496  Sun Feb 18 22:00:04 2018  Type: P  Check: 9177  ..

       1  MTTDNAKAQL TSSSGGNIIV VSNRLPVTIT KNSSTGQYEY AMSSGGLVTA

      51  LEGLKKTYTF KWFGWPGLEI PDDEKDQVRK DLLEKFNAVP IFLSDEIADL

     101  HYNGFSNSIL WPLFHYHPGE INFDENAWLA YNEANQTFTN EIAKTMNHND

     151  LIWVHDYHLM LVPEMLRVKI HEKQLQNVKV GWFLHTPFPS SEIYRILPVR

     201  QEILKGVLSC DLVGFHTYDY ARHFLSSVQR VLNVNTLPNG VEYQGRFVNV

     251  GAFPIGIDVD KFTDGLKKES VQKRIQQLKE TFKGCKIIVG VDRLDYIKGV

     301  PQKLHAMEVF LNEHPEWRGK VVLVQVAVPS RGDVEEYQYL RSVVNELVGR

     351  INGQFGTVEF VPIHFMHKSI PFEELISLYA VSDVCLVSST RDGMNLVSYE

     401  YIACQEEKKG SLILSEFTGA AQSLNGAIIV NPWNTDDLSD AINEALTLPD

     451  VKKEVNWEKL YKYISKYTSA FWGENFVHEL YSTSSSSTSS SATKN*


Protein Sequence for YBR126C_FostersB from AWRI:

YBR126C_FostersB [source=AWRI]  Length: 496  Sun Feb 18 22:00:04 2018  Type: P  Check: 567  ..

       1  MTTDNAKAQL TSSSGGNIIV VSNRLPVTIT KNSSTGQYEY AMSSGGLVTA

      51  LEGLKKTYTF KWFGWPGLEI PDDEKDQVRK DLLEKFNAVP IFLSDEIADL

     101  HYNGFSNSIL WPLFHYHPGE INFDENAWLA YNEANQTFTN EIXKTMNHND

     151  LIWVHDYHLM LVPEMLRVKI HEKQLQNVKV GWFLHTPFPS SEIYRILPVR

     201  QEILKGVLSC DLVGFHTYDY ARHFLSSVQR VLNVNTLPNG VEYQGRFVNV

     251  GAFPIGIDVD KFTDGLKKES VQKRIQQLKE TFKGCKIIVG VDRLDYIKGV

     301  PQKLHAMEVF LNEHXEWRGK VVLVQVAVPS RGDVEEYQYL RSVVNELVGR

     351  INGQFGTVEF VPIHFMHKSI PFEELISLYA VSDVCLVSST RDGMNLVSYE

     401  YIACQEEKKG SLILSEFTGX AQSLNGAIIV NPWNTDDLSD AINEALTLPD

     451  VKKEVNWEKL YKYISKYTSA FWGENFVHEL YSTSSSSTSS SATKN*


Protein Sequence for YBR126C_FostersO from AWRI:

YBR126C_FostersO [source=AWRI]  Length: 496  Sun Feb 18 22:00:04 2018  Type: P  Check: 327  ..

       1  MTTDNAKAQL TSSSGGNIIV VSNRLPVTIT KNSSTGQYEY AMSSGGLVTA

      51  LEGLKKTYTF KWFGWPGLEI PDDEKDQVRK DLLEKFNAVP IFLSDEIADL

     101  HYNGFSNSIL WPLFHYHPGE INFDENAWLA YNEANQTFTN EIXKTMNHND

     151  LIWVHDYHLM LVPEMLRVKI HEKQLQNVKV GWFLHTPFPS SEIYRILPVR

     201  QEILKGVLSC DLVGFHTYDY ARHFLSSVQR VLNVNTLPNG VEYQGRFVNV

     251  GAFPIGIDVD KFTDGLKKES VQKRIQQLKE TFKGCKIIVG VDRLDYIKGV

     301  PQKLHAMEVF LNEHPEWRGK VVLVQVAVPS RGDVEEYQYL RSVVNELVGR

     351  INGQFGTVEF VPIHFMHKSI PFEELISLYA VSDVCLVSST RDGMNLVSYE

     401  YIACQEEKKG SLILSEFTGX AQSLNGAIIV NPWNTDDLSD AINEALTLPD

     451  VKKEVNWEKL YKYISKYTSA FWGENFVHEL YSTSSSSTSS SATKN*


Protein Sequence for YBR126C_JAY291 from Duke:

YBR126C_JAY291 [source=Duke]  Length: 496  Sun Feb 18 22:00:04 2018  Type: P  Check: 9177  ..

       1  MTTDNAKAQL TSSSGGNIIV VSNRLPVTIT KNSSTGQYEY AMSSGGLVTA

      51  LEGLKKTYTF KWFGWPGLEI PDDEKDQVRK DLLEKFNAVP IFLSDEIADL

     101  HYNGFSNSIL WPLFHYHPGE INFDENAWLA YNEANQTFTN EIAKTMNHND

     151  LIWVHDYHLM LVPEMLRVKI HEKQLQNVKV GWFLHTPFPS SEIYRILPVR

     201  QEILKGVLSC DLVGFHTYDY ARHFLSSVQR VLNVNTLPNG VEYQGRFVNV

     251  GAFPIGIDVD KFTDGLKKES VQKRIQQLKE TFKGCKIIVG VDRLDYIKGV

     301  PQKLHAMEVF LNEHPEWRGK VVLVQVAVPS RGDVEEYQYL RSVVNELVGR

     351  INGQFGTVEF VPIHFMHKSI PFEELISLYA VSDVCLVSST RDGMNLVSYE

     401  YIACQEEKKG SLILSEFTGA AQSLNGAIIV NPWNTDDLSD AINEALTLPD

     451  VKKEVNWEKL YKYISKYTSA FWGENFVHEL YSTSSSSTSS SATKN*


Protein Sequence for YBR126C_JK9-3d from Stanford:

YBR126C_JK9-3d [source=Stanford]  Length: 496  Sun Feb 18 22:00:04 2018  Type: P  Check: 9177  ..

       1  MTTDNAKAQL TSSSGGNIIV VSNRLPVTIT KNSSTGQYEY AMSSGGLVTA

      51  LEGLKKTYTF KWFGWPGLEI PDDEKDQVRK DLLEKFNAVP IFLSDEIADL

     101  HYNGFSNSIL WPLFHYHPGE INFDENAWLA YNEANQTFTN EIAKTMNHND

     151  LIWVHDYHLM LVPEMLRVKI HEKQLQNVKV GWFLHTPFPS SEIYRILPVR

     201  QEILKGVLSC DLVGFHTYDY ARHFLSSVQR VLNVNTLPNG VEYQGRFVNV

     251  GAFPIGIDVD KFTDGLKKES VQKRIQQLKE TFKGCKIIVG VDRLDYIKGV

     301  PQKLHAMEVF LNEHPEWRGK VVLVQVAVPS RGDVEEYQYL RSVVNELVGR

     351  INGQFGTVEF VPIHFMHKSI PFEELISLYA VSDVCLVSST RDGMNLVSYE

     401  YIACQEEKKG SLILSEFTGA AQSLNGAIIV NPWNTDDLSD AINEALTLPD

     451  VKKEVNWEKL YKYISKYTSA FWGENFVHEL YSTSSSSTSS SATKN*


Protein Sequence for YBR126C_K11 from Stanford:

YBR126C_K11 [source=Stanford]  Length: 496  Sun Feb 18 22:00:04 2018  Type: P  Check: 9177  ..

       1  MTTDNAKAQL TSSSGGNIIV VSNRLPVTIT KNSSTGQYEY AMSSGGLVTA

      51  LEGLKKTYTF KWFGWPGLEI PDDEKDQVRK DLLEKFNAVP IFLSDEIADL

     101  HYNGFSNSIL WPLFHYHPGE INFDENAWLA YNEANQTFTN EIAKTMNHND

     151  LIWVHDYHLM LVPEMLRVKI HEKQLQNVKV GWFLHTPFPS SEIYRILPVR

     201  QEILKGVLSC DLVGFHTYDY ARHFLSSVQR VLNVNTLPNG VEYQGRFVNV

     251  GAFPIGIDVD KFTDGLKKES VQKRIQQLKE TFKGCKIIVG VDRLDYIKGV

     301  PQKLHAMEVF LNEHPEWRGK VVLVQVAVPS RGDVEEYQYL RSVVNELVGR

     351  INGQFGTVEF VPIHFMHKSI PFEELISLYA VSDVCLVSST RDGMNLVSYE

     401  YIACQEEKKG SLILSEFTGA AQSLNGAIIV NPWNTDDLSD AINEALTLPD

     451  VKKEVNWEKL YKYISKYTSA FWGENFVHEL YSTSSSSTSS SATKN*


Protein Sequence for YBR126C_Kyokai7 from NRIB:

YBR126C_Kyokai7 [source=NRIB]  Length: 496  Sun Feb 18 22:00:04 2018  Type: P  Check: 9177  ..

       1  MTTDNAKAQL TSSSGGNIIV VSNRLPVTIT KNSSTGQYEY AMSSGGLVTA

      51  LEGLKKTYTF KWFGWPGLEI PDDEKDQVRK DLLEKFNAVP IFLSDEIADL

     101  HYNGFSNSIL WPLFHYHPGE INFDENAWLA YNEANQTFTN EIAKTMNHND

     151  LIWVHDYHLM LVPEMLRVKI HEKQLQNVKV GWFLHTPFPS SEIYRILPVR

     201  QEILKGVLSC DLVGFHTYDY ARHFLSSVQR VLNVNTLPNG VEYQGRFVNV

     251  GAFPIGIDVD KFTDGLKKES VQKRIQQLKE TFKGCKIIVG VDRLDYIKGV

     301  PQKLHAMEVF LNEHPEWRGK VVLVQVAVPS RGDVEEYQYL RSVVNELVGR

     351  INGQFGTVEF VPIHFMHKSI PFEELISLYA VSDVCLVSST RDGMNLVSYE

     401  YIACQEEKKG SLILSEFTGA AQSLNGAIIV NPWNTDDLSD AINEALTLPD

     451  VKKEVNWEKL YKYISKYTSA FWGENFVHEL YSTSSSSTSS SATKN*


Protein Sequence for YBR126C_L1528 from Stanford:

YBR126C_L1528 [source=Stanford]  Length: 496  Sun Feb 18 22:00:04 2018  Type: P  Check: 9177  ..

       1  MTTDNAKAQL TSSSGGNIIV VSNRLPVTIT KNSSTGQYEY AMSSGGLVTA

      51  LEGLKKTYTF KWFGWPGLEI PDDEKDQVRK DLLEKFNAVP IFLSDEIADL

     101  HYNGFSNSIL WPLFHYHPGE INFDENAWLA YNEANQTFTN EIAKTMNHND

     151  LIWVHDYHLM LVPEMLRVKI HEKQLQNVKV GWFLHTPFPS SEIYRILPVR

     201  QEILKGVLSC DLVGFHTYDY ARHFLSSVQR VLNVNTLPNG VEYQGRFVNV

     251  GAFPIGIDVD KFTDGLKKES VQKRIQQLKE TFKGCKIIVG VDRLDYIKGV

     301  PQKLHAMEVF LNEHPEWRGK VVLVQVAVPS RGDVEEYQYL RSVVNELVGR

     351  INGQFGTVEF VPIHFMHKSI PFEELISLYA VSDVCLVSST RDGMNLVSYE

     401  YIACQEEKKG SLILSEFTGA AQSLNGAIIV NPWNTDDLSD AINEALTLPD

     451  VKKEVNWEKL YKYISKYTSA FWGENFVHEL YSTSSSSTSS SATKN*


Protein Sequence for YBR126C_LalvinQA23 from AWRI:

YBR126C_LalvinQA23 [source=AWRI]  Length: 496  Sun Feb 18 22:00:04 2018  Type: P  Check: 9392  ..

       1  MTTDNAKAQL TSSSGGNIIV VSNRLPVTIT KNSSTGQYEY AMXSGGLVTA

      51  LEGLKKTYTF KWFGWPGLEI PDDEKDQVRK DLLEKFNAVP IFLSDEIADL

     101  HYNGFSNSIL WPLFHYHPGE INFDENAWLA YNEANQTFTN EIAKTMNHND

     151  LIWVHDYHLM LVPEMLRVKI HEKQLQNVKV GWFLHTPFPS SEIYRILPVR

     201  QEILKGVLSC DLVGFHTYDY ARHFLSSVQR VLNVNTLPNG VEYQGRFVNV

     251  GAFPIGIDVD KFTDGLKKES VQKRIQQLKE TFKGCKIIVG VDRLDYIKGV

     301  PQKLHAMEVF LNEHPEWRGK VVLVQVAVPS RGDVEEYQYL RSVVNELVGR

     351  INGQFGTVEF VPIHFMHKSI PFEELISLYA VSDVCLVSST RDGMNLVSYE

     401  YIACQEEKKG SLILSEFTGA AQSLNGAIIV NPWNTDDLSD AINEALTLPD

     451  VKKEVNWEKL YKYISKYTSA FWGENFVHEL YSTSSSSTSS SATKN*


Protein Sequence for YBR126C_PW5 from WashU:

YBR126C_PW5 [source=WashU]  Length: 496  Sun Feb 18 22:00:04 2018  Type: P  Check: 9177  ..

       1  MTTDNAKAQL TSSSGGNIIV VSNRLPVTIT KNSSTGQYEY AMSSGGLVTA

      51  LEGLKKTYTF KWFGWPGLEI PDDEKDQVRK DLLEKFNAVP IFLSDEIADL

     101  HYNGFSNSIL WPLFHYHPGE INFDENAWLA YNEANQTFTN EIAKTMNHND

     151  LIWVHDYHLM LVPEMLRVKI HEKQLQNVKV GWFLHTPFPS SEIYRILPVR

     201  QEILKGVLSC DLVGFHTYDY ARHFLSSVQR VLNVNTLPNG VEYQGRFVNV

     251  GAFPIGIDVD KFTDGLKKES VQKRIQQLKE TFKGCKIIVG VDRLDYIKGV

     301  PQKLHAMEVF LNEHPEWRGK VVLVQVAVPS RGDVEEYQYL RSVVNELVGR

     351  INGQFGTVEF VPIHFMHKSI PFEELISLYA VSDVCLVSST RDGMNLVSYE

     401  YIACQEEKKG SLILSEFTGA AQSLNGAIIV NPWNTDDLSD AINEALTLPD

     451  VKKEVNWEKL YKYISKYTSA FWGENFVHEL YSTSSSSTSS SATKN*


Protein Sequence for YBR126C_RM11-1a from Stanford:

YBR126C_RM11-1a [source=Stanford]  Length: 496  Sun Feb 18 22:00:04 2018  Type: P  Check: 9177  ..

       1  MTTDNAKAQL TSSSGGNIIV VSNRLPVTIT KNSSTGQYEY AMSSGGLVTA

      51  LEGLKKTYTF KWFGWPGLEI PDDEKDQVRK DLLEKFNAVP IFLSDEIADL

     101  HYNGFSNSIL WPLFHYHPGE INFDENAWLA YNEANQTFTN EIAKTMNHND

     151  LIWVHDYHLM LVPEMLRVKI HEKQLQNVKV GWFLHTPFPS SEIYRILPVR

     201  QEILKGVLSC DLVGFHTYDY ARHFLSSVQR VLNVNTLPNG VEYQGRFVNV

     251  GAFPIGIDVD KFTDGLKKES VQKRIQQLKE TFKGCKIIVG VDRLDYIKGV

     301  PQKLHAMEVF LNEHPEWRGK VVLVQVAVPS RGDVEEYQYL RSVVNELVGR

     351  INGQFGTVEF VPIHFMHKSI PFEELISLYA VSDVCLVSST RDGMNLVSYE

     401  YIACQEEKKG SLILSEFTGA AQSLNGAIIV NPWNTDDLSD AINEALTLPD

     451  VKKEVNWEKL YKYISKYTSA FWGENFVHEL YSTSSSSTSS SATKN*


Protein Sequence for YBR126C_RedStar from Stanford:

YBR126C_RedStar [source=Stanford]  Length: 496  Sun Feb 18 22:00:04 2018  Type: P  Check: 9177  ..

       1  MTTDNAKAQL TSSSGGNIIV VSNRLPVTIT KNSSTGQYEY AMSSGGLVTA

      51  LEGLKKTYTF KWFGWPGLEI PDDEKDQVRK DLLEKFNAVP IFLSDEIADL

     101  HYNGFSNSIL WPLFHYHPGE INFDENAWLA YNEANQTFTN EIAKTMNHND

     151  LIWVHDYHLM LVPEMLRVKI HEKQLQNVKV GWFLHTPFPS SEIYRILPVR

     201  QEILKGVLSC DLVGFHTYDY ARHFLSSVQR VLNVNTLPNG VEYQGRFVNV

     251  GAFPIGIDVD KFTDGLKKES VQKRIQQLKE TFKGCKIIVG VDRLDYIKGV

     301  PQKLHAMEVF LNEHPEWRGK VVLVQVAVPS RGDVEEYQYL RSVVNELVGR

     351  INGQFGTVEF VPIHFMHKSI PFEELISLYA VSDVCLVSST RDGMNLVSYE

     401  YIACQEEKKG SLILSEFTGA AQSLNGAIIV NPWNTDDLSD AINEALTLPD

     451  VKKEVNWEKL YKYISKYTSA FWGENFVHEL YSTSSSSTSS SATKN*


Protein Sequence for YBR126C_SEY6210 from Stanford:

YBR126C_SEY6210 [source=Stanford]  Length: 496  Sun Feb 18 22:00:04 2018  Type: P  Check: 9177  ..

       1  MTTDNAKAQL TSSSGGNIIV VSNRLPVTIT KNSSTGQYEY AMSSGGLVTA

      51  LEGLKKTYTF KWFGWPGLEI PDDEKDQVRK DLLEKFNAVP IFLSDEIADL

     101  HYNGFSNSIL WPLFHYHPGE INFDENAWLA YNEANQTFTN EIAKTMNHND

     151  LIWVHDYHLM LVPEMLRVKI HEKQLQNVKV GWFLHTPFPS SEIYRILPVR

     201  QEILKGVLSC DLVGFHTYDY ARHFLSSVQR VLNVNTLPNG VEYQGRFVNV

     251  GAFPIGIDVD KFTDGLKKES VQKRIQQLKE TFKGCKIIVG VDRLDYIKGV

     301  PQKLHAMEVF LNEHPEWRGK VVLVQVAVPS RGDVEEYQYL RSVVNELVGR

     351  INGQFGTVEF VPIHFMHKSI PFEELISLYA VSDVCLVSST RDGMNLVSYE

     401  YIACQEEKKG SLILSEFTGA AQSLNGAIIV NPWNTDDLSD AINEALTLPD

     451  VKKEVNWEKL YKYISKYTSA FWGENFVHEL YSTSSSSTSS SATKN*


Protein Sequence for YBR126C_SK1 from Stanford:

YBR126C_SK1 [source=Stanford]  Length: 496  Sun Feb 18 22:00:04 2018  Type: P  Check: 9177  ..

       1  MTTDNAKAQL TSSSGGNIIV VSNRLPVTIT KNSSTGQYEY AMSSGGLVTA

      51  LEGLKKTYTF KWFGWPGLEI PDDEKDQVRK DLLEKFNAVP IFLSDEIADL

     101  HYNGFSNSIL WPLFHYHPGE INFDENAWLA YNEANQTFTN EIAKTMNHND

     151  LIWVHDYHLM LVPEMLRVKI HEKQLQNVKV GWFLHTPFPS SEIYRILPVR

     201  QEILKGVLSC DLVGFHTYDY ARHFLSSVQR VLNVNTLPNG VEYQGRFVNV

     251  GAFPIGIDVD KFTDGLKKES VQKRIQQLKE TFKGCKIIVG VDRLDYIKGV

     301  PQKLHAMEVF LNEHPEWRGK VVLVQVAVPS RGDVEEYQYL RSVVNELVGR

     351  INGQFGTVEF VPIHFMHKSI PFEELISLYA VSDVCLVSST RDGMNLVSYE

     401  YIACQEEKKG SLILSEFTGA AQSLNGAIIV NPWNTDDLSD AINEALTLPD

     451  VKKEVNWEKL YKYISKYTSA FWGENFVHEL YSTSSSSTSS SATKN*


Protein Sequence for YBR126C_T7 from WashU:

YBR126C_T7 [source=WashU]  Length: 496  Sun Feb 18 22:00:04 2018  Type: P  Check: 9177  ..

       1  MTTDNAKAQL TSSSGGNIIV VSNRLPVTIT KNSSTGQYEY AMSSGGLVTA

      51  LEGLKKTYTF KWFGWPGLEI PDDEKDQVRK DLLEKFNAVP IFLSDEIADL

     101  HYNGFSNSIL WPLFHYHPGE INFDENAWLA YNEANQTFTN EIAKTMNHND

     151  LIWVHDYHLM LVPEMLRVKI HEKQLQNVKV GWFLHTPFPS SEIYRILPVR

     201  QEILKGVLSC DLVGFHTYDY ARHFLSSVQR VLNVNTLPNG VEYQGRFVNV

     251  GAFPIGIDVD KFTDGLKKES VQKRIQQLKE TFKGCKIIVG VDRLDYIKGV

     301  PQKLHAMEVF LNEHPEWRGK VVLVQVAVPS RGDVEEYQYL RSVVNELVGR

     351  INGQFGTVEF VPIHFMHKSI PFEELISLYA VSDVCLVSST RDGMNLVSYE

     401  YIACQEEKKG SLILSEFTGA AQSLNGAIIV NPWNTDDLSD AINEALTLPD

     451  VKKEVNWEKL YKYISKYTSA FWGENFVHEL YSTSSSSTSS SATKN*


Protein Sequence for YBR126C_T73 from WashU:

YBR126C_T73 [source=WashU]  Length: 351  Sun Feb 18 22:00:04 2018  Type: P  Check: 6070  ..

       1  MNHNDLIWVH DYHLMLVPEM LRVKIHEKQL QNVKVGWFLH TPFPSSEIYR

      51  ILPVRQEILK GVLSCDLVGF HTYDYARHFL SSVQRVLNVN TLPNGVEYQG

     101  RFVNVGAFPI GIDVDKFTDG LKKESVQKRI QQLKETFKGC KIIVGVDRLD

     151  YIKGVPQKLH AMEVFLNEHP EWRGKVVLVQ VAVPSRGDVE EYQYLRSVVN

     201  ELVGRINGQF GTVEFVPIHF MHKSIPFEEL ISLYAVSDVC LVSSTRDGMN

     251  LVSYEYIACQ EEKKGSLILS EFTGAAQSLN GAIIVNPWNT DDLSDAINEA

     301  LTLPDVKKEV NWEKLYKYIS KYTSAFWGEN FVHELYSTSS SSTSSSATKN

     351  *

Protein Sequence for YBR126C_UC5 from WashU:

YBR126C_UC5 [source=WashU]  Length: 496  Sun Feb 18 22:00:04 2018  Type: P  Check: 9177  ..

       1  MTTDNAKAQL TSSSGGNIIV VSNRLPVTIT KNSSTGQYEY AMSSGGLVTA

      51  LEGLKKTYTF KWFGWPGLEI PDDEKDQVRK DLLEKFNAVP IFLSDEIADL

     101  HYNGFSNSIL WPLFHYHPGE INFDENAWLA YNEANQTFTN EIAKTMNHND

     151  LIWVHDYHLM LVPEMLRVKI HEKQLQNVKV GWFLHTPFPS SEIYRILPVR

     201  QEILKGVLSC DLVGFHTYDY ARHFLSSVQR VLNVNTLPNG VEYQGRFVNV

     251  GAFPIGIDVD KFTDGLKKES VQKRIQQLKE TFKGCKIIVG VDRLDYIKGV

     301  PQKLHAMEVF LNEHPEWRGK VVLVQVAVPS RGDVEEYQYL RSVVNELVGR

     351  INGQFGTVEF VPIHFMHKSI PFEELISLYA VSDVCLVSST RDGMNLVSYE

     401  YIACQEEKKG SLILSEFTGA AQSLNGAIIV NPWNTDDLSD AINEALTLPD

     451  VKKEVNWEKL YKYISKYTSA FWGENFVHEL YSTSSSSTSS SATKN*


Protein Sequence for YBR126C_VL3 from AWRI:

YBR126C_VL3 [source=AWRI]  Length: 496  Sun Feb 18 22:00:04 2018  Type: P  Check: 9289  ..

       1  MTTDNAKAQL TSSSGGNIIV VSNRLPVXIT KNSSTGQYEY AMSSGGLVTA

      51  LEGLKKTYTF KWFGWPGLEI PDDEKDQVRK DLLEKFNAVP IFLSDEIADL

     101  HYNGFSNSIL WPLFHYHPGE INFDENAWLA YNEANQTFTN EIAKTMNHND

     151  LIWVHDYHLM LVPEMLRVKI HEKQLQNVKV GWFLHTPFPS SEIYRILPVR

     201  QEILKGVLSC DLVGFHTYDY ARHFLSSVQR VLNVNTLPNG VEYQGRFVNV

     251  GAFPIGIDVD KFTDGLKKES VQKRIQQLKE TFKGCKIIVG VDRLDYIKGV

     301  PQKLHAMEVF LNEHPEWRGK VVLVQVAVPS RGDVEEYQYL RSVVNELVGR

     351  INGQFGTVEF VPIHFMHKSI PFEELISLYA VSDVCLVSST RDGMNLVSYE

     401  YIACQEEKKG SLILSEFTGA AQSLNGAIIV NPWNTDDLSD AINEALTLPD

     451  VKKEVNWEKL YKYISKYTSA FWGENFVHEL YSTSSSSTSS SATKN*


Protein Sequence for YBR126C_Vin13 from AWRI:

YBR126C_Vin13 [source=AWRI]  Length: 233  Sun Feb 18 22:00:04 2018  Type: P  Check: 8607  ..

       1  MTTDNAKAQL TSSSGGNIIV VSNRLPVXIT KNSSTGQYEY AMXSGGLVTA

      51  LEGLKKTYTF KWFGWPGLEI PDDEKDQVRK DLLEKFNAVP IFLSDEIADL

     101  HYNGFSNSIL WPLFHYHPGE INFDENAWLA YNEANQTFTN EIAKTMNHND

     151  LIWVHDYHLM LVPEMLRVKI HEKQLQNVKV GWFLHTPFPS SEIYRILPVR

     201  QEILKGVLSC DFSRVPHIRL CKTFLVFXAK GA*

Protein Sequence for YBR126C_X2180-1A from Stanford:

YBR126C_X2180-1A [source=Stanford]  Length: 496  Sun Feb 18 22:00:04 2018  Type: P  Check: 9177  ..

       1  MTTDNAKAQL TSSSGGNIIV VSNRLPVTIT KNSSTGQYEY AMSSGGLVTA

      51  LEGLKKTYTF KWFGWPGLEI PDDEKDQVRK DLLEKFNAVP IFLSDEIADL

     101  HYNGFSNSIL WPLFHYHPGE INFDENAWLA YNEANQTFTN EIAKTMNHND

     151  LIWVHDYHLM LVPEMLRVKI HEKQLQNVKV GWFLHTPFPS SEIYRILPVR

     201  QEILKGVLSC DLVGFHTYDY ARHFLSSVQR VLNVNTLPNG VEYQGRFVNV

     251  GAFPIGIDVD KFTDGLKKES VQKRIQQLKE TFKGCKIIVG VDRLDYIKGV

     301  PQKLHAMEVF LNEHPEWRGK VVLVQVAVPS RGDVEEYQYL RSVVNELVGR

     351  INGQFGTVEF VPIHFMHKSI PFEELISLYA VSDVCLVSST RDGMNLVSYE

     401  YIACQEEKKG SLILSEFTGA AQSLNGAIIV NPWNTDDLSD AINEALTLPD

     451  VKKEVNWEKL YKYISKYTSA FWGENFVHEL YSTSSSSTSS SATKN*


Protein Sequence for YBR126C_Y55 from Stanford:

YBR126C_Y55 [source=Stanford]  Length: 496  Sun Feb 18 22:00:04 2018  Type: P  Check: 9177  ..

       1  MTTDNAKAQL TSSSGGNIIV VSNRLPVTIT KNSSTGQYEY AMSSGGLVTA

      51  LEGLKKTYTF KWFGWPGLEI PDDEKDQVRK DLLEKFNAVP IFLSDEIADL

     101  HYNGFSNSIL WPLFHYHPGE INFDENAWLA YNEANQTFTN EIAKTMNHND

     151  LIWVHDYHLM LVPEMLRVKI HEKQLQNVKV GWFLHTPFPS SEIYRILPVR

     201  QEILKGVLSC DLVGFHTYDY ARHFLSSVQR VLNVNTLPNG VEYQGRFVNV

     251  GAFPIGIDVD KFTDGLKKES VQKRIQQLKE TFKGCKIIVG VDRLDYIKGV

     301  PQKLHAMEVF LNEHPEWRGK VVLVQVAVPS RGDVEEYQYL RSVVNELVGR

     351  INGQFGTVEF VPIHFMHKSI PFEELISLYA VSDVCLVSST RDGMNLVSYE

     401  YIACQEEKKG SLILSEFTGA AQSLNGAIIV NPWNTDDLSD AINEALTLPD

     451  VKKEVNWEKL YKYISKYTSA FWGENFVHEL YSTSSSSTSS SATKN*


Protein Sequence for YBR126C_YJM339 from Stanford:

YBR126C_YJM339 [source=Stanford]  Length: 496  Sun Feb 18 22:00:04 2018  Type: P  Check: 9177  ..

       1  MTTDNAKAQL TSSSGGNIIV VSNRLPVTIT KNSSTGQYEY AMSSGGLVTA

      51  LEGLKKTYTF KWFGWPGLEI PDDEKDQVRK DLLEKFNAVP IFLSDEIADL

     101  HYNGFSNSIL WPLFHYHPGE INFDENAWLA YNEANQTFTN EIAKTMNHND

     151  LIWVHDYHLM LVPEMLRVKI HEKQLQNVKV GWFLHTPFPS SEIYRILPVR

     201  QEILKGVLSC DLVGFHTYDY ARHFLSSVQR VLNVNTLPNG VEYQGRFVNV

     251  GAFPIGIDVD KFTDGLKKES VQKRIQQLKE TFKGCKIIVG VDRLDYIKGV

     301  PQKLHAMEVF LNEHPEWRGK VVLVQVAVPS RGDVEEYQYL RSVVNELVGR

     351  INGQFGTVEF VPIHFMHKSI PFEELISLYA VSDVCLVSST RDGMNLVSYE

     401  YIACQEEKKG SLILSEFTGA AQSLNGAIIV NPWNTDDLSD AINEALTLPD

     451  VKKEVNWEKL YKYISKYTSA FWGENFVHEL YSTSSSSTSS SATKN*


Protein Sequence for YBR126C_YJM789 from Stanford:

YBR126C_YJM789 [source=Stanford]  Length: 496  Sun Feb 18 22:00:04 2018  Type: P  Check: 9177  ..

       1  MTTDNAKAQL TSSSGGNIIV VSNRLPVTIT KNSSTGQYEY AMSSGGLVTA

      51  LEGLKKTYTF KWFGWPGLEI PDDEKDQVRK DLLEKFNAVP IFLSDEIADL

     101  HYNGFSNSIL WPLFHYHPGE INFDENAWLA YNEANQTFTN EIAKTMNHND

     151  LIWVHDYHLM LVPEMLRVKI HEKQLQNVKV GWFLHTPFPS SEIYRILPVR

     201  QEILKGVLSC DLVGFHTYDY ARHFLSSVQR VLNVNTLPNG VEYQGRFVNV

     251  GAFPIGIDVD KFTDGLKKES VQKRIQQLKE TFKGCKIIVG VDRLDYIKGV

     301  PQKLHAMEVF LNEHPEWRGK VVLVQVAVPS RGDVEEYQYL RSVVNELVGR

     351  INGQFGTVEF VPIHFMHKSI PFEELISLYA VSDVCLVSST RDGMNLVSYE

     401  YIACQEEKKG SLILSEFTGA AQSLNGAIIV NPWNTDDLSD AINEALTLPD

     451  VKKEVNWEKL YKYISKYTSA FWGENFVHEL YSTSSSSTSS SATKN*


Protein Sequence for YBR126C_YPH499 from Stanford:

YBR126C_YPH499 [source=Stanford]  Length: 496  Sun Feb 18 22:00:04 2018  Type: P  Check: 9177  ..

       1  MTTDNAKAQL TSSSGGNIIV VSNRLPVTIT KNSSTGQYEY AMSSGGLVTA

      51  LEGLKKTYTF KWFGWPGLEI PDDEKDQVRK DLLEKFNAVP IFLSDEIADL

     101  HYNGFSNSIL WPLFHYHPGE INFDENAWLA YNEANQTFTN EIAKTMNHND

     151  LIWVHDYHLM LVPEMLRVKI HEKQLQNVKV GWFLHTPFPS SEIYRILPVR

     201  QEILKGVLSC DLVGFHTYDY ARHFLSSVQR VLNVNTLPNG VEYQGRFVNV

     251  GAFPIGIDVD KFTDGLKKES VQKRIQQLKE TFKGCKIIVG VDRLDYIKGV

     301  PQKLHAMEVF LNEHPEWRGK VVLVQVAVPS RGDVEEYQYL RSVVNELVGR

     351  INGQFGTVEF VPIHFMHKSI PFEELISLYA VSDVCLVSST RDGMNLVSYE

     401  YIACQEEKKG SLILSEFTGA AQSLNGAIIV NPWNTDDLSD AINEALTLPD

     451  VKKEVNWEKL YKYISKYTSA FWGENFVHEL YSTSSSSTSS SATKN*


Protein Sequence for YBR126C_YPS128 from Stanford:

YBR126C_YPS128 [source=Stanford]  Length: 496  Sun Feb 18 22:00:04 2018  Type: P  Check: 9177  ..

       1  MTTDNAKAQL TSSSGGNIIV VSNRLPVTIT KNSSTGQYEY AMSSGGLVTA

      51  LEGLKKTYTF KWFGWPGLEI PDDEKDQVRK DLLEKFNAVP IFLSDEIADL

     101  HYNGFSNSIL WPLFHYHPGE INFDENAWLA YNEANQTFTN EIAKTMNHND

     151  LIWVHDYHLM LVPEMLRVKI HEKQLQNVKV GWFLHTPFPS SEIYRILPVR

     201  QEILKGVLSC DLVGFHTYDY ARHFLSSVQR VLNVNTLPNG VEYQGRFVNV

     251  GAFPIGIDVD KFTDGLKKES VQKRIQQLKE TFKGCKIIVG VDRLDYIKGV

     301  PQKLHAMEVF LNEHPEWRGK VVLVQVAVPS RGDVEEYQYL RSVVNELVGR

     351  INGQFGTVEF VPIHFMHKSI PFEELISLYA VSDVCLVSST RDGMNLVSYE

     401  YIACQEEKKG SLILSEFTGA AQSLNGAIIV NPWNTDDLSD AINEALTLPD

     451  VKKEVNWEKL YKYISKYTSA FWGENFVHEL YSTSSSSTSS SATKN*


Protein Sequence for YBR126C_YPS163 from Stanford:

YBR126C_YPS163 [source=Stanford]  Length: 496  Sun Feb 18 22:00:04 2018  Type: P  Check: 9177  ..

       1  MTTDNAKAQL TSSSGGNIIV VSNRLPVTIT KNSSTGQYEY AMSSGGLVTA

      51  LEGLKKTYTF KWFGWPGLEI PDDEKDQVRK DLLEKFNAVP IFLSDEIADL

     101  HYNGFSNSIL WPLFHYHPGE INFDENAWLA YNEANQTFTN EIAKTMNHND

     151  LIWVHDYHLM LVPEMLRVKI HEKQLQNVKV GWFLHTPFPS SEIYRILPVR

     201  QEILKGVLSC DLVGFHTYDY ARHFLSSVQR VLNVNTLPNG VEYQGRFVNV

     251  GAFPIGIDVD KFTDGLKKES VQKRIQQLKE TFKGCKIIVG VDRLDYIKGV

     301  PQKLHAMEVF LNEHPEWRGK VVLVQVAVPS RGDVEEYQYL RSVVNELVGR

     351  INGQFGTVEF VPIHFMHKSI PFEELISLYA VSDVCLVSST RDGMNLVSYE

     401  YIACQEEKKG SLILSEFTGA AQSLNGAIIV NPWNTDDLSD AINEALTLPD

     451  VKKEVNWEKL YKYISKYTSA FWGENFVHEL YSTSSSSTSS SATKN*


Protein Sequence for YBR126C_YS9 from Stanford:

YBR126C_YS9 [source=Stanford]  Length: 496  Sun Feb 18 22:00:04 2018  Type: P  Check: 9177  ..

       1  MTTDNAKAQL TSSSGGNIIV VSNRLPVTIT KNSSTGQYEY AMSSGGLVTA

      51  LEGLKKTYTF KWFGWPGLEI PDDEKDQVRK DLLEKFNAVP IFLSDEIADL

     101  HYNGFSNSIL WPLFHYHPGE INFDENAWLA YNEANQTFTN EIAKTMNHND

     151  LIWVHDYHLM LVPEMLRVKI HEKQLQNVKV GWFLHTPFPS SEIYRILPVR

     201  QEILKGVLSC DLVGFHTYDY ARHFLSSVQR VLNVNTLPNG VEYQGRFVNV

     251  GAFPIGIDVD KFTDGLKKES VQKRIQQLKE TFKGCKIIVG VDRLDYIKGV

     301  PQKLHAMEVF LNEHPEWRGK VVLVQVAVPS RGDVEEYQYL RSVVNELVGR

     351  INGQFGTVEF VPIHFMHKSI PFEELISLYA VSDVCLVSST RDGMNLVSYE

     401  YIACQEEKKG SLILSEFTGA AQSLNGAIIV NPWNTDDLSD AINEALTLPD

     451  VKKEVNWEKL YKYISKYTSA FWGENFVHEL YSTSSSSTSS SATKN*


Protein Sequence for YBR126C_ZTW1 from Zhejiang:

YBR126C_ZTW1 [source=Zhejiang]  Length: 496  Sun Feb 18 22:00:04 2018  Type: P  Check: 9177  ..

       1  MTTDNAKAQL TSSSGGNIIV VSNRLPVTIT KNSSTGQYEY AMSSGGLVTA

      51  LEGLKKTYTF KWFGWPGLEI PDDEKDQVRK DLLEKFNAVP IFLSDEIADL

     101  HYNGFSNSIL WPLFHYHPGE INFDENAWLA YNEANQTFTN EIAKTMNHND

     151  LIWVHDYHLM LVPEMLRVKI HEKQLQNVKV GWFLHTPFPS SEIYRILPVR

     201  QEILKGVLSC DLVGFHTYDY ARHFLSSVQR VLNVNTLPNG VEYQGRFVNV

     251  GAFPIGIDVD KFTDGLKKES VQKRIQQLKE TFKGCKIIVG VDRLDYIKGV

     301  PQKLHAMEVF LNEHPEWRGK VVLVQVAVPS RGDVEEYQYL RSVVNELVGR

     351  INGQFGTVEF VPIHFMHKSI PFEELISLYA VSDVCLVSST RDGMNLVSYE

     401  YIACQEEKKG SLILSEFTGA AQSLNGAIIV NPWNTDDLSD AINEALTLPD

     451  VKKEVNWEKL YKYISKYTSA FWGENFVHEL YSTSSSSTSS SATKN*