ALG14/YBR070C S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YBR070C_S288C   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_AWRI1631   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_AWRI796   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_BC187   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_BY4741   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_BY4742   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_CEN.PK   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_CLIB215   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_CLIB324   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_D273-10B   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_DBVPG6044   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_EC1118   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_EC9-8   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_FL100   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_FY1679   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_FostersB   
   --------------------------------------------------   
YBR070C_FostersO   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKNGVNLLKIRKS   50
YBR070C_JAY291   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_JK9-3d   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_Kyokai7   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_L1528   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_LalvinQA23   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_M22   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_PW5   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_RM11-1a   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_RedStar   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_SEY6210   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_SK1   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_T7   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_T73   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_UC5   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_UWOPS05_217_3   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_VL3   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_Vin13   
   --------------------------------------------------   
YBR070C_W303   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_X2180-1A   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_Y55   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_YJM269   
   --------------------------------------------------   
YBR070C_YJM339   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_YJM789   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_YPH499   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_YPS128   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_YPS163   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_YS9   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
YBR070C_ZTW1   1   MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKS   50
         

YBR070C_S288C   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_AWRI1631   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_AWRI796   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_BC187   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_BY4741   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_BY4742   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_CEN.PK   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_CLIB215   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_CLIB324   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_D273-10B   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_DBVPG6044   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_EC1118   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_EC9-8   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_FL100   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_FY1679   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_FostersB   
   --------------------------------------------------   
YBR070C_FostersO   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_JAY291   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_JK9-3d   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_Kyokai7   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_L1528   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_LalvinQA23   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_M22   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_PW5   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_RM11-1a   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_RedStar   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_SEY6210   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_SK1   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_T7   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_T73   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_UC5   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_UWOPS05_217_3   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_VL3   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_Vin13   1   -------------------MIRLLENYQDLLLGKSIVYLGYSDEASRQRF   31
YBR070C_W303   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_X2180-1A   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_Y55   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_YJM269   1   -------------------MIRLLENYQDLLLGKSIVYLGYSDEASRQRF   31
YBR070C_YJM339   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_YJM789   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_YPH499   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_YPS128   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_YPS163   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_YS9   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
YBR070C_ZTW1   51   SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRF   100
         

YBR070C_S288C   101   AHFIKKFGHCKVKYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_AWRI1631   101   AHFIKKFGHCKVEYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_AWRI796   101   AHFIKKFGHCKVEYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_BC187   101   AHFIKKFGHCKVEYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_BY4741   101   AHFIKKFGHCKVKYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_BY4742   101   AHFIKKFGHCKVKYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_CEN.PK   101   AHFIKKFGHCKVKYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_CLIB215   101   AHFIKKFGHCKVEYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_CLIB324   101   AHFIKKFGHCKVEYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_D273-10B   101   AHFIKKFGHCKVKYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_DBVPG6044   101   AQFIKKFGHCKVEYYQFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_EC1118   101   AHFIKKFGHCKVEYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_EC9-8   101   AHFIKKFGHCKVKYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_FL100   101   AHFIKKFGHCKVEYYEFMKAREVKATLLQSVKTITGTLVQSFVHVVRIRF   150
YBR070C_FY1679   101   AHFIKKFGHCKVKYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_FostersB   
   --------------------------------------------------   
YBR070C_FostersO   101   AHFIKKFGHCKVEYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_JAY291   101   AHFIKKFGHCKVEYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_JK9-3d   101   AHFIKKFGHCKVKYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_Kyokai7   101   AHFIKKFGHCKVEYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_L1528   101   AHFIKKFGHCKVEYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_LalvinQA23   101   AHFIKKFGHCKVEYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_M22   101   AHFIKKFGHCKVEYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_PW5   101   AQFIKKFGHCKVEYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_RM11-1a   101   AHFIKKFGHCKVEYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_RedStar   101   AHFIKKFGHCKVKYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_SEY6210   101   AHFIKKFGHCKVKYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_SK1   101   AQFIKKFGHCKVEYYQFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_T7   101   AQFIKKFGHCKVEYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_T73   101   AHFIKKFGHCKVEYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_UC5   101   AHFIKKFGHCKVEYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_UWOPS05_217_3   101   AQFIKKFGHCKVEYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_VL3   101   AHFIKKFGHCKVEYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_Vin13   32   AHFIKKFGHCKVEYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   81
YBR070C_W303   101   AHFIKKFGHCKVKYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_X2180-1A   101   AHFIKKFGHCKVKYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_Y55   101   AQFIKKFGHCKVEYYQFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_YJM269   32   AHFIKKFGHCKVEYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   81
YBR070C_YJM339   101   AHFIKKFGHCKVEYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_YJM789   101   AHFIKKFGHCKVEYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_YPH499   101   AHFIKKFGHCKVKYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_YPS128   101   AHFIKKFGHCKVEYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_YPS163   101   AHFIKKFGHCKVEYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_YS9   101   AHFIKKFGHCKVEYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
YBR070C_ZTW1   101   AHFIKKFGHCKVEYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRF   150
         

YBR070C_S288C   151   AMCGSPHLFLLNGPGTCCIISFWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_AWRI1631   151   AMCGSPHLFLLNGPGTCCIISLWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_AWRI796   151   AMCGSPHLFLLNGPGTCCIISLWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_BC187   151   AMCGSPHLFLLNGPGTCCIISLWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_BY4741   151   AMCGSPHLFLLNGPGTCCIISFWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_BY4742   151   AMCGSPHLFLLNGPGTCCIISFWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_CEN.PK   151   AMCGSPHLFLLNGPGTCCIISFWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_CLIB215   151   AMCGSPHLFLLNGPGTCCIISLWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_CLIB324   151   AMCGSPHLLLLNGPGTCCIISLWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_D273-10B   151   AMCGSPHLFLLNGPGTCCIISFWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_DBVPG6044   151   AMCGSPHLFLLNGPGTCCIISFWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_EC1118   151   AMCGSPHLFLLNGPGTCCIISLWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_EC9-8   151   AMCGSPHLFLLNGPGTCCIISFWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_FL100   151   AMCGSPHLFLLNGPGTCCIISFWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_FY1679   151   AMCGSPHLFLLNGPGTCCIISFWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_FostersB   1   -MCGSPHLFLLNGPGTCCIISLWLKIMELLLPLLGSSHIVYVESLARINT   49
YBR070C_FostersO   151   AMCGSPHLFLLNGPGTCCIISLWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_JAY291   151   AMCGSPHLLLLNGPGTCCIISLWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_JK9-3d   151   AMCGSPHLFLLNGPGTCCIISFWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_Kyokai7   151   AMCGSPHLFLLNGPGTCCIISFWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_L1528   151   AMCGSPHLFLLNGPGTCCIISLWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_LalvinQA23   151   AMCGSPHLFLLNGPGTCCIISLWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_M22   151   AMCGSPHLFLLNGPGTCCIISLWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_PW5   151   AMCGSPHLFLLNGPGTCCIISFWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_RM11-1a   151   AMCGSPHLFLLNGPGTCCIISLWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_RedStar   151   AMCGSPHLFLLNGPGTCCIISFWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_SEY6210   151   AMCGSPHLFLLNGPGTCCIISFWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_SK1   151   AMCGSPHLFLLNGPGTCCIISFWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_T7   151   AMCGSPHLFLLNGPGTCCIISLWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_T73   151   AMCGSPHLLLLNGPGTCCIISLWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_UC5   151   AMCGSPHLFLLNGPGTCCIISFWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_UWOPS05_217_3   151   AMCGSPHLFLLNGPGTCCIISFWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_VL3   151   AMCGSPHLFLLNGPGTCCIISLWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_Vin13   82   AMCGSPHLFLLNGPGTCCIISLWLKIMELLLPLLGSSHIVYVESLARINT   131
YBR070C_W303   151   AMCGSPHLFLLNGPGTCCIISFWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_X2180-1A   151   AMCGSPHLFLLNGPGTCCIISFWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_Y55   151   AMCGSPHLFLLNGPGTCCIISFWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_YJM269   82   AMCGSPHLFLLNGPGTCCIISLWLKIMELLLPLLGSSHIVYVESLARINT   131
YBR070C_YJM339   151   AMCGSPHLFLLNGPGTCCIISLWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_YJM789   151   AMCGSPHLFLLNGPGTCCIISLWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_YPH499   151   AMCGSPHLFLLNGPGTCCIISFWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_YPS128   151   AMCGSPHLFLLNGPGTCCIISLWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_YPS163   151   AMCGSPHLFLLNGPGTCCIISLWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_YS9   151   AMCGSPHLFLLNGPGTCCIISFWLKIMELLLPLLGSSHIVYVESLARINT   200
YBR070C_ZTW1   151   AMCGSPHLFLLNGPGTCCIISFWLKIMELLLPLLGSSHIVYVESLARINT   200
         

YBR070C_S288C   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV------   237
YBR070C_AWRI1631   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV------   237
YBR070C_AWRI796   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV------   237
YBR070C_BC187   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV------   237
YBR070C_BY4741   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV------   237
YBR070C_BY4742   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV------   237
YBR070C_CEN.PK   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV------   237
YBR070C_CLIB215   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV------   237
YBR070C_CLIB324   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV------   237
YBR070C_D273-10B   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV------   237
YBR070C_DBVPG6044   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGVLV------   237
YBR070C_EC1118   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV------   237
YBR070C_EC9-8   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV------   237
YBR070C_FL100   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV------   237
YBR070C_FY1679   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV------   237
YBR070C_FostersB   50   PSLTGKILYWVVDEFIVQWARIEGQLFTKIQVVRHPCLSKPFM   92
YBR070C_FostersO   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV------   237
YBR070C_JAY291   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV------   237
YBR070C_JK9-3d   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV------   237
YBR070C_Kyokai7   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV------   237
YBR070C_L1528   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV------   237
YBR070C_LalvinQA23   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV------   237
YBR070C_M22   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGVVV------   237
YBR070C_PW5   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV------   237
YBR070C_RM11-1a   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV------   237
YBR070C_RedStar   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV------   237
YBR070C_SEY6210   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV------   237
YBR070C_SK1   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGVLV------   237
YBR070C_T7   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV------   237
YBR070C_T73   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV------   237
YBR070C_UC5   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV------   237
YBR070C_UWOPS05_217_3   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV------   237
YBR070C_VL3   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV------   237
YBR070C_Vin13   132   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV------   168
YBR070C_W303   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV------   237
YBR070C_X2180-1A   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV------   237
YBR070C_Y55   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGVLV------   237
YBR070C_YJM269   132   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV------   168
YBR070C_YJM339   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV------   237
YBR070C_YJM789   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV------   237
YBR070C_YPH499   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV------   237
YBR070C_YPS128   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV------   237
YBR070C_YPS163   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV------   237
YBR070C_YS9   201   PSLTGKILYWVVDEFIVQWQGLRDNYLPRSKWFGILV------   237
YBR070C_ZTW1   201   PSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV------   237
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YBR070C_S288C from SGD:

YBR070C_S288C [source=SGD]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 482  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AHFIKKFGHC KVKYYEFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLFL LNGPGTCCII SFWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGILV*

Protein Sequence for YBR070C_AWRI1631 from AWRI:

YBR070C_AWRI1631 [source=AWRI]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 152  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AHFIKKFGHC KVEYYEFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLFL LNGPGTCCII SLWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGILV*

Protein Sequence for YBR070C_AWRI796 from AWRI:

YBR070C_AWRI796 [source=AWRI]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 152  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AHFIKKFGHC KVEYYEFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLFL LNGPGTCCII SLWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGILV*

Protein Sequence for YBR070C_BC187 from Stanford:

YBR070C_BC187 [source=Stanford]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 152  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AHFIKKFGHC KVEYYEFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLFL LNGPGTCCII SLWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGILV*

Protein Sequence for YBR070C_BY4741 from Stanford:

YBR070C_BY4741 [source=Stanford]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 482  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AHFIKKFGHC KVKYYEFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLFL LNGPGTCCII SFWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGILV*

Protein Sequence for YBR070C_BY4742 from Stanford:

YBR070C_BY4742 [source=Stanford]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 482  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AHFIKKFGHC KVKYYEFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLFL LNGPGTCCII SFWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGILV*

Protein Sequence for YBR070C_CEN.PK from Stanford:

YBR070C_CEN.PK [source=Stanford]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 482  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AHFIKKFGHC KVKYYEFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLFL LNGPGTCCII SFWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGILV*

Protein Sequence for YBR070C_CLIB215 from WashU:

YBR070C_CLIB215 [source=WashU]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 152  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AHFIKKFGHC KVEYYEFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLFL LNGPGTCCII SLWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGILV*

Protein Sequence for YBR070C_CLIB324 from WashU:

YBR070C_CLIB324 [source=WashU]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 422  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AHFIKKFGHC KVEYYEFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLLL LNGPGTCCII SLWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGILV*

Protein Sequence for YBR070C_D273-10B from Stanford:

YBR070C_D273-10B [source=Stanford]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 482  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AHFIKKFGHC KVKYYEFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLFL LNGPGTCCII SFWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGILV*

Protein Sequence for YBR070C_DBVPG6044 from Stanford:

YBR070C_DBVPG6044 [source=Stanford]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 666  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AQFIKKFGHC KVEYYQFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLFL LNGPGTCCII SFWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGVLV*

Protein Sequence for YBR070C_EC1118 from Genoscope:

YBR070C_EC1118 [source=Genoscope]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 152  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AHFIKKFGHC KVEYYEFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLFL LNGPGTCCII SLWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGILV*

Protein Sequence for YBR070C_EC9-8 from ASinica:

YBR070C_EC9-8 [source=ASinica]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 482  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AHFIKKFGHC KVKYYEFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLFL LNGPGTCCII SFWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGILV*

Protein Sequence for YBR070C_FL100 from Stanford:

YBR070C_FL100 [source=Stanford]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 377  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AHFIKKFGHC KVEYYEFMKA REVKATLLQS VKTITGTLVQ SFVHVVRIRF

     151  AMCGSPHLFL LNGPGTCCII SFWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGILV*

Protein Sequence for YBR070C_FY1679 from Stanford:

YBR070C_FY1679 [source=Stanford]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 482  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AHFIKKFGHC KVKYYEFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLFL LNGPGTCCII SFWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGILV*

Protein Sequence for YBR070C_FostersB from AWRI:

YBR070C_FostersB [source=AWRI]  Length: 93  Tue Sep 19 04:35:58 2017  Type: P  Check: 7505  ..

       1  MCGSPHLFLL NGPGTCCIIS LWLKIMELLL PLLGSSHIVY VESLARINTP

      51  SLTGKILYWV VDEFIVQWAR IEGQLFTKIQ VVRHPCLSKP FM*


Protein Sequence for YBR070C_FostersO from AWRI:

YBR070C_FostersO [source=AWRI]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 552  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKN GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AHFIKKFGHC KVEYYEFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLFL LNGPGTCCII SLWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGILV*

Protein Sequence for YBR070C_JAY291 from Duke:

YBR070C_JAY291 [source=Duke]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 422  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AHFIKKFGHC KVEYYEFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLLL LNGPGTCCII SLWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGILV*

Protein Sequence for YBR070C_JK9-3d from Stanford:

YBR070C_JK9-3d [source=Stanford]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 482  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AHFIKKFGHC KVKYYEFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLFL LNGPGTCCII SFWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGILV*

Protein Sequence for YBR070C_Kyokai7 from NRIB:

YBR070C_Kyokai7 [source=NRIB]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 146  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AHFIKKFGHC KVEYYEFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLFL LNGPGTCCII SFWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGILV*

Protein Sequence for YBR070C_L1528 from Stanford:

YBR070C_L1528 [source=Stanford]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 152  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AHFIKKFGHC KVEYYEFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLFL LNGPGTCCII SLWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGILV*

Protein Sequence for YBR070C_LalvinQA23 from AWRI:

YBR070C_LalvinQA23 [source=AWRI]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 152  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AHFIKKFGHC KVEYYEFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLFL LNGPGTCCII SLWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGILV*

Protein Sequence for YBR070C_M22 from WashU:

YBR070C_M22 [source=WashU]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 323  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AHFIKKFGHC KVEYYEFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLFL LNGPGTCCII SLWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGVVV*

Protein Sequence for YBR070C_PW5 from WashU:

YBR070C_PW5 [source=WashU]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 551  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AQFIKKFGHC KVEYYEFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLFL LNGPGTCCII SFWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGILV*

Protein Sequence for YBR070C_RM11-1a from Stanford:

YBR070C_RM11-1a [source=Stanford]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 152  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AHFIKKFGHC KVEYYEFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLFL LNGPGTCCII SLWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGILV*

Protein Sequence for YBR070C_RedStar from Stanford:

YBR070C_RedStar [source=Stanford]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 482  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AHFIKKFGHC KVKYYEFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLFL LNGPGTCCII SFWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGILV*

Protein Sequence for YBR070C_SEY6210 from Stanford:

YBR070C_SEY6210 [source=Stanford]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 482  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AHFIKKFGHC KVKYYEFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLFL LNGPGTCCII SFWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGILV*

Protein Sequence for YBR070C_SK1 from Stanford:

YBR070C_SK1 [source=Stanford]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 666  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AQFIKKFGHC KVEYYQFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLFL LNGPGTCCII SFWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGVLV*

Protein Sequence for YBR070C_T7 from WashU:

YBR070C_T7 [source=WashU]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 557  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AQFIKKFGHC KVEYYEFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLFL LNGPGTCCII SLWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGILV*

Protein Sequence for YBR070C_T73 from WashU:

YBR070C_T73 [source=WashU]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 422  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AHFIKKFGHC KVEYYEFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLLL LNGPGTCCII SLWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGILV*

Protein Sequence for YBR070C_UC5 from WashU:

YBR070C_UC5 [source=WashU]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 146  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AHFIKKFGHC KVEYYEFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLFL LNGPGTCCII SFWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGILV*

Protein Sequence for YBR070C_UWOPS05_217_3 from Stanford:

YBR070C_UWOPS05_217_3 [source=Stanford]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 551  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AQFIKKFGHC KVEYYEFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLFL LNGPGTCCII SFWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGILV*

Protein Sequence for YBR070C_VL3 from AWRI:

YBR070C_VL3 [source=AWRI]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 152  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AHFIKKFGHC KVEYYEFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLFL LNGPGTCCII SLWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGILV*

Protein Sequence for YBR070C_Vin13 from AWRI:

YBR070C_Vin13 [source=AWRI]  Length: 169  Tue Sep 19 04:35:58 2017  Type: P  Check: 9001  ..

       1  MIRLLENYQD LLLGKSIVYL GYSDEASRQR FAHFIKKFGH CKVEYYEFMK

      51  AREVKATLLQ SVKTIIGTLV QSFVHVVRIR FAMCGSPHLF LLNGPGTCCI

     101  ISLWLKIMEL LLPLLGSSHI VYVESLARIN TPSLTGKILY WVVDEFIVQW

     151  QELRDNYLPR SKWFGILV*

Protein Sequence for YBR070C_W303 from Stanford:

YBR070C_W303 [source=Stanford]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 482  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AHFIKKFGHC KVKYYEFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLFL LNGPGTCCII SFWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGILV*

Protein Sequence for YBR070C_X2180-1A from Stanford:

YBR070C_X2180-1A [source=Stanford]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 482  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AHFIKKFGHC KVKYYEFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLFL LNGPGTCCII SFWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGILV*

Protein Sequence for YBR070C_Y55 from Stanford:

YBR070C_Y55 [source=Stanford]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 666  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AQFIKKFGHC KVEYYQFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLFL LNGPGTCCII SFWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGVLV*

Protein Sequence for YBR070C_YJM269 from WashU:

YBR070C_YJM269 [source=WashU]  Length: 169  Tue Sep 19 04:35:58 2017  Type: P  Check: 9001  ..

       1  MIRLLENYQD LLLGKSIVYL GYSDEASRQR FAHFIKKFGH CKVEYYEFMK

      51  AREVKATLLQ SVKTIIGTLV QSFVHVVRIR FAMCGSPHLF LLNGPGTCCI

     101  ISLWLKIMEL LLPLLGSSHI VYVESLARIN TPSLTGKILY WVVDEFIVQW

     151  QELRDNYLPR SKWFGILV*

Protein Sequence for YBR070C_YJM339 from Stanford:

YBR070C_YJM339 [source=Stanford]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 152  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AHFIKKFGHC KVEYYEFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLFL LNGPGTCCII SLWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGILV*

Protein Sequence for YBR070C_YJM789 from Stanford:

YBR070C_YJM789 [source=Stanford]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 152  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AHFIKKFGHC KVEYYEFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLFL LNGPGTCCII SLWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGILV*

Protein Sequence for YBR070C_YPH499 from Stanford:

YBR070C_YPH499 [source=Stanford]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 482  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AHFIKKFGHC KVKYYEFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLFL LNGPGTCCII SFWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGILV*

Protein Sequence for YBR070C_YPS128 from Stanford:

YBR070C_YPS128 [source=Stanford]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 152  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AHFIKKFGHC KVEYYEFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLFL LNGPGTCCII SLWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGILV*

Protein Sequence for YBR070C_YPS163 from Stanford:

YBR070C_YPS163 [source=Stanford]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 152  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AHFIKKFGHC KVEYYEFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLFL LNGPGTCCII SLWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGILV*

Protein Sequence for YBR070C_YS9 from Stanford:

YBR070C_YS9 [source=Stanford]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 246  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AHFIKKFGHC KVEYYEFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLFL LNGPGTCCII SFWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ GLRDNYLPRS KWFGILV*

Protein Sequence for YBR070C_ZTW1 from Zhejiang:

YBR070C_ZTW1 [source=Zhejiang]  Length: 238  Tue Sep 19 04:35:58 2017  Type: P  Check: 146  ..

       1  MKTAYLASLV LIVSTAYVIR LIAILPFFHT QAGTEKDTKD GVNLLKIRKS

      51  SKKPLKIFVF LGSGGHTGEM IRLLENYQDL LLGKSIVYLG YSDEASRQRF

     101  AHFIKKFGHC KVEYYEFMKA REVKATLLQS VKTIIGTLVQ SFVHVVRIRF

     151  AMCGSPHLFL LNGPGTCCII SFWLKIMELL LPLLGSSHIV YVESLARINT

     201  PSLTGKILYW VVDEFIVQWQ ELRDNYLPRS KWFGILV*