BDH1/YAL060W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YAL060W_S288C   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_AWRI1631   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_AWRI796   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_BC187   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_BY4741   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_BY4742   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_CEN.PK   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_D273-10B   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_DBVPG6044   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_EC1118   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_FL100   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_FY1679   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_FostersB   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_FostersO   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_JAY291   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_JK9-3d   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_K11   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_Kyokai7   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_L1528   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_LalvinQA23   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_M22   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_PW5   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_RM11-1a   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_RedStar   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_SEY6210   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_SK1   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_T7   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_T73   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_UC5   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_UWOPS05_217_3   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_VL3   1   ---------------MISXGQKSKPTMRLLSTSLGVGFVARIFTSTWMVQ   35
YAL060W_Vin13   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_W303   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_X2180-1A   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_Y55   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_YJM269   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_YJM339   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_YJM789   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_YPH499   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_YPS128   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_YPS163   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_YS9   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
YAL060W_ZTW1   1   MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGP   50
         

YAL060W_S288C   51   IFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_AWRI1631   51   IFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_AWRI796   51   IFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_BC187   51   IFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_BY4741   51   IFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_BY4742   51   IFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_CEN.PK   51   IFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_D273-10B   51   IFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_DBVPG6044   51   IFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_EC1118   51   IFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_FL100   51   IFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_FY1679   51   IFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_FostersB   51   IFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_FostersO   51   IFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_JAY291   51   IFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_JK9-3d   51   IFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_K11   51   IFMPKDGECHNLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_Kyokai7   51   IFMPKDGECHNLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_L1528   51   IFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_LalvinQA23   51   IFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_M22   51   IFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_PW5   51   IFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_RM11-1a   51   IFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_RedStar   51   IFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_SEY6210   51   IFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_SK1   51   IFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_T7   51   IFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_T73   51   IFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_UC5   51   IFMPKDGECHNLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_UWOPS05_217_3   51   IFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_VL3   36   SSCLKMESAINLSNAALPLAMGHEMSGIVSKVGPKVTKXKVGDHVVVDAA   85
YAL060W_Vin13   51   IFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_W303   51   IFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_X2180-1A   51   IFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_Y55   51   IFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_YJM269   51   IFMPKDGECHNLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_YJM339   51   IFMPKDGECHNLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_YJM789   51   IFMPKDGECHNLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_YPH499   51   IFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_YPS128   51   IFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_YPS163   51   IFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_YS9   51   IFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
YAL060W_ZTW1   51   IFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAA   100
         

YAL060W_S288C   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_AWRI1631   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_AWRI796   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_BC187   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_BY4741   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_BY4742   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_CEN.PK   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_D273-10B   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_DBVPG6044   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_EC1118   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_FL100   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_FY1679   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_FostersB   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_FostersO   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_JAY291   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_JK9-3d   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_K11   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_Kyokai7   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_L1528   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_LalvinQA23   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_M22   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_PW5   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_RM11-1a   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_RedStar   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_SEY6210   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_SK1   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_T7   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_T73   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_UC5   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_UWOPS05_217_3   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_VL3   86   SSCXDLHCWPHSKFYNSKPXDACQRGSENLCTHAGFVGLGVISGGFAEQV   135
YAL060W_Vin13   101   SSCADLHCWPHSKFYNSKPXDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_W303   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_X2180-1A   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_Y55   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_YJM269   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_YJM339   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_YJM789   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_YPH499   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_YPS128   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_YPS163   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_YS9   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
YAL060W_ZTW1   101   SSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQV   150
         

YAL060W_S288C   151   VVSQHHIIPVPKEIPLDVAALVEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_AWRI1631   151   VVSQHHIIPVPKEIPLDVAALIEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_AWRI796   151   VVSQHHIIPVPKEIPLDVAALIEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_BC187   151   VVSQHHIIPVPKEIPLDVAALIEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_BY4741   151   VVSQHHIIPVPKEIPLDVAALVEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_BY4742   151   VVSQHHIIPVPKEIPLDVAALVEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_CEN.PK   151   VVSQHHIIPVPKEIPLDVAALVEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_D273-10B   151   VVSQHHIIPVPKEIPLDVAALVEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_DBVPG6044   151   VVSQHHIIPVPKEIPLDVAALVEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_EC1118   151   VVSQHHIIPVPKEIPLDVAALVEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_FL100   151   VVSQHHIIPVPKEIPLDVAALVEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_FY1679   151   VVSQHHIIPVPKEIPLDVAALVEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_FostersB   151   VVSQHHIIPVPKEIPLDVAALIEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_FostersO   151   VVSQHHIIPVPKEIPLDVAALIEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_JAY291   151   VVSQHHIIPVPKEIPLDVAALIEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_JK9-3d   151   VVSQHHIIPVPKEIPLDVAALVEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_K11   151   VVSQHHIIPVPKEIPLDVAALVEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_Kyokai7   151   VVSQHHIIPVPKEIPLDVAALVEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_L1528   151   VVSQHHIIPVPKEIPLDVAALIEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_LalvinQA23   151   VVSQHHIIPVPKEIPLDVAALXEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_M22   151   VVSQHHIIPVPKEIPLDVAALIEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_PW5   151   VVSQHHIIPVPKEIPLDVAALVEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_RM11-1a   151   VVSQHHIIPVPKEIPLDVAALIEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_RedStar   151   VVSQHHIIPVPKQIPLDVAALVEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_SEY6210   151   VVSQHHIIPVPKEIPLDVAALVEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_SK1   151   VVSQHHIIPVPKEIPLDVAALIEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_T7   151   VVSQHHIIPVPKEIPLDVAALVEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_T73   151   VVSQHHIIPVPKEIPLDVAALVEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_UC5   151   VVSQHHIIPVPKEIPLDVAALVEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_UWOPS05_217_3   151   VVSQHHIIPVPKEIPLDVAALVEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_VL3   136   VVSQHHIIPVPKEIPLDVAALXEPLSVTWHAVKISGFKKGSSAXVLGAGP   185
YAL060W_Vin13   151   VVSQHHIIPVPKEIPLDVAALXEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_W303   151   VVSQHHIIPVPKEIPLDVAALVEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_X2180-1A   151   VVSQHHIIPVPKEIPLDVAALVEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_Y55   151   VVSQHHIIPVPKEIPLDVAALVEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_YJM269   151   VVSQHHIIPVPKEIPLDVAALVEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_YJM339   151   VVSQHHIIPVPKEIPLDVAALVEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_YJM789   151   VVSQHHIIPVPKEIPLDVAALVEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_YPH499   151   VVSQHHIIPVPKEIPLDVAALVEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_YPS128   151   VVSQHHIIPVPKEIPLDVAALVEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_YPS163   151   VVSQHHIIPVPKEIPLDVAALVEPLSVTWHAVKISGFKKGSSALVLGAGP   200
YAL060W_YS9   151   VVSQHHIIPVPKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLGAGP   200
YAL060W_ZTW1   151   VVSQHHIIPVPKEIPLDVAALVEPLSVTWHAVKISGFKKGSSALVLGAGP   200
         

YAL060W_S288C   201   IGLCTILVLKGMGASKIVVSEIAERRIEMAKKLGVEVFNPSKHGHKSIEI   250
YAL060W_AWRI1631   201   IGLCTILVLKGMGASKIVVSEVAERRIEMAKKLGVEVFNPSKHGHKSIEI   250
YAL060W_AWRI796   201   IGLCTILVLKGMGASKIVVSEVAERRIEMAKKLGVEVFNPSKHGHKSIEI   250
YAL060W_BC187   201   IGLCTILVLKGMGASKIVVSEVAERRIEMAKKLGVEVFNPSKHGHKSIEI   250
YAL060W_BY4741   201   IGLCTILVLKGMGASKIVVSEIAERRIEMAKKLGVEVFNPSKHGHKSIEI   250
YAL060W_BY4742   201   IGLCTILVLKGMGASKIVVSEIAERRIEMAKKLGVEVFNPSKHGHKSIEI   250
YAL060W_CEN.PK   201   IGLCTILVLKGMGASKIVVSEIAERRIEMAKKLGVEVFNPSKHGHKSIEI   250
YAL060W_D273-10B   201   IGLCTILVLKGMGASKIVVSEIAERRIEMAKKLGVEVFNPSKHGHKSIEI   250
YAL060W_DBVPG6044   201   IGLCTILVLKGMGASKIVVSEIAERRIEMAKKLGVEVFNPSKHGHKSIEI   250
YAL060W_EC1118   201   IGLCTILVLKGMGASKIVVSEVAERRIEMAKKLGVEVFNPSKHGHKSIEI   250
YAL060W_FL100   201   IGLCTILVLKGMGASKIVVSEIAERRIEMAKKLGVEVFNPSKHGHKSIEI   250
YAL060W_FY1679   201   IGLCTILVLKGMGASKIVVSEIAERRIEMAKKLGVEVFNPSKHGHKSIEI   250
YAL060W_FostersB   201   IGLCTILVLKGMGASKIVVSEVAERRIEMAKKLGVEVFNPSKHXHKSIEI   250
YAL060W_FostersO   201   IGLCTILVLKGMGASKIVVSEVAERRIEMAKKLGVEVFNPSKHVHKSIEI   250
YAL060W_JAY291   201   IGLCTILVLKGMGASKIVVSEVAERRIEMAKKLGVEVFNPSKHGHKSIEI   250
YAL060W_JK9-3d   201   IGLCTILVLKGMGASKIVVSEIAERRIEMAKKLGVEVFNPFKHGHKSIEI   250
YAL060W_K11   201   IGLCTILVLKGMGASKIVVSEVAERRIEMAKKLGVEVFNPSKHGHKSIEI   250
YAL060W_Kyokai7   201   IGLCTILVLKGMGASKIVVSEVAERRIEMAKKLGVEVFNPSKHGHKSIEI   250
YAL060W_L1528   201   IGLCTILVLKGMGASKIVVSEVAERRIEMAKKLGVEVFNPSKHGHKSIEI   250
YAL060W_LalvinQA23   201   IGLCTILVLKGMGASKIVVSEVAERRIEMAKKLGVEVFNPSKHGHKSIEI   250
YAL060W_M22   201   IGLCTILVLKGMGASKIVVSEVAERRIEMAKKLGVEVFNPSKHGHKSIEI   250
YAL060W_PW5   201   IGLCTILVLKGMGASKIVVSEIAERRIEMAKKLGVEVFNPSKHGHKSIEI   250
YAL060W_RM11-1a   201   IGLCTILVLKGMGASKIVVSEVAERRIEMAKKLGVEVFNPSKHGHKSIEI   250
YAL060W_RedStar   201   IGLCTILVLKGMGASKIVVSEVAERRIEMAKKLGVEVFNPSKHGHKSIEI   250
YAL060W_SEY6210   201   IGLCTILVLKGMGASKIVVSEIAERRIEMAKKLGVEVFNPSKHGHKSIEI   250
YAL060W_SK1   201   IGLCTILVLKGMGASKIVVSEVAERRIEMAKKLGVEVFNPSKHGHKSIEI   250
YAL060W_T7   201   IGLCTILVLKGMGASKIVVSEVAERRIEMAKKLGVEVFNPSKHGHKSIEI   250
YAL060W_T73   201   IGLCTILVLKGMGASKIVVSEVAERRIEMAKKLGVEVFNPSKHGHKSIEI   250
YAL060W_UC5   201   IGLCTILVLKGMGASKIVVSEVAERRIEMAKKLGVEVFNPSKHGHKSIEI   250
YAL060W_UWOPS05_217_3   201   IGLCTILVLKGMGASKIVVSEVAERRIEMAKKLGVEVFNPSKHGQKSIEI   250
YAL060W_VL3   186   IGLCTILVLKGMGXSKIVVSEVAERRIEMAKKLGVEVFNPSKHGHKSIEI   235
YAL060W_Vin13   201   IGLCTILVLKGMGASKIVVSEVAERRIEMAKKLGVEVFNPSKHGHKSIEI   250
YAL060W_W303   201   IGLCTILVLKGMGASKIVVSEIAERRIEMAKKLGVEVFNPSKHGHKSIEI   250
YAL060W_X2180-1A   201   IGLCTILVLKGMGASKIVVSEIAERRIEMAKKLGVEVFNPSKHGHKSIEI   250
YAL060W_Y55   201   IGLCTILVLKGMGASKIVVSEIAERRIEMAKKLGVEVFNPSKHGHKSIEI   250
YAL060W_YJM269   201   IGLCTILVLKGMGASKIVVSEVAERRIEMAKKLGVEVFNPSKHGHKSIEI   250
YAL060W_YJM339   201   IGLCTILVLKGMGASKIVVSEVAERRIEMAKKLGVEVFNPSKHGHKSIEI   250
YAL060W_YJM789   201   IGLCTILVLKGMGASKIVVSEVAERRIEMAKKLGVEVFNPSKHGQKSIEI   250
YAL060W_YPH499   201   IGLCTILVLKGMGASKIVVSEIAERRIEMAKKLGVEVFNPSKHGHKSIEI   250
YAL060W_YPS128   201   IGLCTILVLKGMGASKIVVSEVAERRIEMAKKLGVEVFNPSKHGHKSIEI   250
YAL060W_YPS163   201   IGLCTILVLKGMGASKIVVSEVAERRIEMAKKLGVEVFNPSKHGHKSIEI   250
YAL060W_YS9   201   IGLCTILVLKGMGASKIVVSEVAERRIEMAKKLGVEVFNPSKHGHKSIEI   250
YAL060W_ZTW1   201   IGLCTILVLKGMGASKIVVSEVAERRIEMAKKLGVEVFNPSKHGHKSIEI   250
         

YAL060W_S288C   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFKGTATNIAVWGPKPVPF   300
YAL060W_AWRI1631   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFRGTATNIAVWGPKPVPF   300
YAL060W_AWRI796   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFRGTATNIAVWGPKPVPF   300
YAL060W_BC187   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFRGTATNIAVWGPKPVPF   300
YAL060W_BY4741   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFKGTATNIAVWGPKPVPF   300
YAL060W_BY4742   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFKGTATNIAVWGPKPVPF   300
YAL060W_CEN.PK   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFKGTATNIAVWGPKPVPF   300
YAL060W_D273-10B   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFKGTATNIAVWGPKPVPF   300
YAL060W_DBVPG6044   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFKGTATNIAVWGPKPVPF   300
YAL060W_EC1118   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFRGTATNIAVWGPKPVPF   300
YAL060W_FL100   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFKGTATNIAVWGPKPVPF   300
YAL060W_FY1679   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFKGTATNIAVWGPKPVPF   300
YAL060W_FostersB   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFRGTATNIAVWGPKPVPF   300
YAL060W_FostersO   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFRGTATNIAVWGPKPVPF   300
YAL060W_JAY291   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFRGTATNIAVWGPKPVPF   300
YAL060W_JK9-3d   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFKGTATNIAVWGPKPVPF   300
YAL060W_K11   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFKGTATNIAVWGPKPVPF   300
YAL060W_Kyokai7   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFKGTATNIAVWGPKPVPF   300
YAL060W_L1528   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFRGTATNIAVWGPKPVPF   300
YAL060W_LalvinQA23   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFRGTATNIAVWGPKPVPF   300
YAL060W_M22   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFRGTATNIAVWGPKPVPF   300
YAL060W_PW5   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFKGTATNIAVWGPKPVPF   300
YAL060W_RM11-1a   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFRGTATNIAVWGPKPVPF   300
YAL060W_RedStar   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFKGTATNIAVWGPKPVPF   300
YAL060W_SEY6210   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFKGTATNIAVWGPKPVPF   300
YAL060W_SK1   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFRGTATNIAVWGPKPVPF   300
YAL060W_T7   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFRGTATNIAVWGPKPVPF   300
YAL060W_T73   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFRGTATNIAVWGPKPVPF   300
YAL060W_UC5   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFKGTATNIAVWGPKPVPF   300
YAL060W_UWOPS05_217_3   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFKGTATNIAVWGPKPVPF   300
YAL060W_VL3   236   LRGLTKSHDGFDYSYDCSGIQXTFETSLKALTFXGTATNIAVWGPKPXPF   285
YAL060W_Vin13   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFRGTATNIAVWGPKPVPF   300
YAL060W_W303   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFKGTATNIAVWGPKPVPF   300
YAL060W_X2180-1A   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFKGTATNIAVWGPKPVPF   300
YAL060W_Y55   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFKGTATNIAVWGPKPVPF   300
YAL060W_YJM269   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFKGTATNIAVWGPKPVPF   300
YAL060W_YJM339   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFKGTATNIAVWGPKPVPF   300
YAL060W_YJM789   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFRGTATNIAVWGPKPVPF   300
YAL060W_YPH499   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFKGTATNIAVWGPKPVPF   300
YAL060W_YPS128   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFRGTATNIAVWGPKPVPF   300
YAL060W_YPS163   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFRGTATNIAVWGPKPVPF   300
YAL060W_YS9   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFRGTATNIAVWGPKPVPF   300
YAL060W_ZTW1   251   LRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFRGTATNIAVWGPKPVPF   300
         

YAL060W_S288C   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDIAMEDCKQLITGKQRI   350
YAL060W_AWRI1631   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDITMEDCKQLITGKQRI   350
YAL060W_AWRI796   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDITMEDCKQLITGKQRI   350
YAL060W_BC187   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDITMEDCKQLITGKQRI   350
YAL060W_BY4741   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDIAMEDCKQLITGKQRI   350
YAL060W_BY4742   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDIAMEDCKQLITGKQRI   350
YAL060W_CEN.PK   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDIAMEDCKQLITGKQRI   350
YAL060W_D273-10B   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDIAMEDCKQLITGKQRI   350
YAL060W_DBVPG6044   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDITMEDCKQLITGKQRI   350
YAL060W_EC1118   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDITMEDCKQLITGKQRI   350
YAL060W_FL100   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDIAMEDCKQLITGKQRI   350
YAL060W_FY1679   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDIAMEDCKQLITGKQRI   350
YAL060W_FostersB   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDITMEDCKQLITGKQRI   350
YAL060W_FostersO   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDITMEDCKQLITGKQRI   350
YAL060W_JAY291   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDITMEDCKQLITGKQRI   350
YAL060W_JK9-3d   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDIAMEDCKQLITGKQRI   350
YAL060W_K11   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDIAMEDCKQLITGKQRI   350
YAL060W_Kyokai7   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDIAMEDCKQLITGKQRI   350
YAL060W_L1528   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDITMEDCKQLITGKQRI   350
YAL060W_LalvinQA23   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDITMEDCKQLITGKQRI   350
YAL060W_M22   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDITMEDCKQLITGKQRI   350
YAL060W_PW5   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDIAMEDCKQLITGKQRI   350
YAL060W_RM11-1a   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAILNGDITMEDCKQLITGKQRI   350
YAL060W_RedStar   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDITMEDCKQLITGKQRI   350
YAL060W_SEY6210   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDIAMEDCKQLITGKQRI   350
YAL060W_SK1   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDITMEDCKQLITGKQRI   350
YAL060W_T7   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDITMEDCKQLITGKQRI   350
YAL060W_T73   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDITMEDCKQLITGKQRI   350
YAL060W_UC5   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDIAMEDCKQLITGKQRI   350
YAL060W_UWOPS05_217_3   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDIAMEDCKQLITGKQRI   350
YAL060W_VL3   286   QPMDVTLQEKVMTGSIGYVVEDXEEVVRAIHNGDIXMEDCKQLITGKQRI   335
YAL060W_Vin13   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDITMEDCKQLITGKQRI   350
YAL060W_W303   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDIAMEDCKQLITGKQRI   350
YAL060W_X2180-1A   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDIAMEDCKQLITGKQRI   350
YAL060W_Y55   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDITMEDCKQLITGKQRI   350
YAL060W_YJM269   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDIAMEDCKQLITGKQRI   350
YAL060W_YJM339   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDIAMEDCKQLITGKQRI   350
YAL060W_YJM789   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDITMEDCKQLITGKQRI   350
YAL060W_YPH499   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDIAMEDCKQLITGKQRI   350
YAL060W_YPS128   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDITMEDCKQLITGKQRI   350
YAL060W_YPS163   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDITMEDCKQLITGKQRI   350
YAL060W_YS9   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDITMEDCKQLITGKQRI   350
YAL060W_ZTW1   301   QPMDVTLQEKVMTGSIGYVVEDFEEVVRAIHNGDITMEDCKQLITGKQRI   350
         

YAL060W_S288C   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_AWRI1631   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_AWRI796   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_BC187   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_BY4741   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_BY4742   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_CEN.PK   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_D273-10B   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_DBVPG6044   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_EC1118   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_FL100   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_FY1679   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_FostersB   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_FostersO   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_JAY291   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_JK9-3d   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_K11   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_Kyokai7   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_L1528   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_LalvinQA23   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_M22   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_PW5   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_RM11-1a   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_RedStar   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_SEY6210   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_SK1   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_T7   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_T73   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_UC5   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_UWOPS05_217_3   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_VL3   336   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   367
YAL060W_Vin13   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_W303   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_X2180-1A   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_Y55   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_YJM269   351   EDGWEKGFQELMDHKESNVKILLTPNNHSEMK   382
YAL060W_YJM339   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_YJM789   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_YPH499   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_YPS128   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_YPS163   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_YS9   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
YAL060W_ZTW1   351   EDGWEKGFQELMDHKESNVKILLTPNNHGEMK   382
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YAL060W_S288C from SGD:

YAL060W_S288C [source=SGD]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 1330  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH KLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LVEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EIAERRIEMA KKLGVEVFNP SKHGHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFKGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDIAMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_AWRI1631 from AWRI:

YAL060W_AWRI1631 [source=AWRI]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 3341  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH KLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LIEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EVAERRIEMA KKLGVEVFNP SKHGHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFRGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDITMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_AWRI796 from AWRI:

YAL060W_AWRI796 [source=AWRI]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 3341  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH KLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LIEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EVAERRIEMA KKLGVEVFNP SKHGHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFRGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDITMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_BC187 from Stanford:

YAL060W_BC187 [source=Stanford]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 3341  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH KLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LIEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EVAERRIEMA KKLGVEVFNP SKHGHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFRGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDITMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_BY4741 from Stanford:

YAL060W_BY4741 [source=Stanford]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 1330  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH KLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LVEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EIAERRIEMA KKLGVEVFNP SKHGHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFKGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDIAMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_BY4742 from Stanford:

YAL060W_BY4742 [source=Stanford]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 1330  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH KLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LVEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EIAERRIEMA KKLGVEVFNP SKHGHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFKGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDIAMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_CEN.PK from Stanford:

YAL060W_CEN.PK [source=Stanford]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 1330  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH KLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LVEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EIAERRIEMA KKLGVEVFNP SKHGHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFKGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDIAMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_D273-10B from Stanford:

YAL060W_D273-10B [source=Stanford]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 1330  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH KLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LVEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EIAERRIEMA KKLGVEVFNP SKHGHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFKGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDIAMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_DBVPG6044 from Stanford:

YAL060W_DBVPG6044 [source=Stanford]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 2299  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH KLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LVEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EIAERRIEMA KKLGVEVFNP SKHGHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFKGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDITMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_EC1118 from Genoscope:

YAL060W_EC1118 [source=Genoscope]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 3354  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH KLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LVEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EVAERRIEMA KKLGVEVFNP SKHGHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFRGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDITMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_FL100 from Stanford:

YAL060W_FL100 [source=Stanford]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 1330  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH KLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LVEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EIAERRIEMA KKLGVEVFNP SKHGHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFKGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDIAMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_FY1679 from Stanford:

YAL060W_FY1679 [source=Stanford]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 1330  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH KLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LVEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EIAERRIEMA KKLGVEVFNP SKHGHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFKGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDIAMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_FostersB from AWRI:

YAL060W_FostersB [source=AWRI]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 3613  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH KLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LIEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EVAERRIEMA KKLGVEVFNP SKHXHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFRGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDITMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_FostersO from AWRI:

YAL060W_FostersO [source=AWRI]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 3581  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH KLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LIEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EVAERRIEMA KKLGVEVFNP SKHVHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFRGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDITMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_JAY291 from Duke:

YAL060W_JAY291 [source=Duke]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 3341  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH KLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LIEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EVAERRIEMA KKLGVEVFNP SKHGHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFRGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDITMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_JK9-3d from Stanford:

YAL060W_JK9-3d [source=Stanford]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 1161  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH KLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LVEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EIAERRIEMA KKLGVEVFNP FKHGHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFKGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDIAMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_K11 from Stanford:

YAL060W_K11 [source=Stanford]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 2005  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH NLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LVEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EVAERRIEMA KKLGVEVFNP SKHGHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFKGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDIAMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_Kyokai7 from NRIB:

YAL060W_Kyokai7 [source=NRIB]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 2005  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH NLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LVEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EVAERRIEMA KKLGVEVFNP SKHGHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFKGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDIAMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_L1528 from Stanford:

YAL060W_L1528 [source=Stanford]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 3341  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH KLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LIEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EVAERRIEMA KKLGVEVFNP SKHGHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFRGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDITMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_LalvinQA23 from AWRI:

YAL060W_LalvinQA23 [source=AWRI]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 3356  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH KLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LXEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EVAERRIEMA KKLGVEVFNP SKHGHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFRGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDITMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_M22 from WashU:

YAL060W_M22 [source=WashU]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 3341  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH KLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LIEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EVAERRIEMA KKLGVEVFNP SKHGHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFRGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDITMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_PW5 from WashU:

YAL060W_PW5 [source=WashU]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 1330  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH KLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LVEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EIAERRIEMA KKLGVEVFNP SKHGHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFKGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDIAMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_RM11-1a from Stanford:

YAL060W_RM11-1a [source=Stanford]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 3525  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH KLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LIEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EVAERRIEMA KKLGVEVFNP SKHGHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFRGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI LNGDITMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_RedStar from Stanford:

YAL060W_RedStar [source=Stanford]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 3550  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH KLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKQIPLDVAA LVEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EVAERRIEMA KKLGVEVFNP SKHGHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFKGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDITMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_SEY6210 from Stanford:

YAL060W_SEY6210 [source=Stanford]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 1330  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH KLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LVEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EIAERRIEMA KKLGVEVFNP SKHGHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFKGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDIAMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_SK1 from Stanford:

YAL060W_SK1 [source=Stanford]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 3341  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH KLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LIEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EVAERRIEMA KKLGVEVFNP SKHGHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFRGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDITMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_T7 from WashU:

YAL060W_T7 [source=WashU]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 3354  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH KLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LVEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EVAERRIEMA KKLGVEVFNP SKHGHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFRGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDITMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_T73 from WashU:

YAL060W_T73 [source=WashU]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 3354  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH KLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LVEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EVAERRIEMA KKLGVEVFNP SKHGHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFRGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDITMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_UC5 from WashU:

YAL060W_UC5 [source=WashU]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 2005  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH NLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LVEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EVAERRIEMA KKLGVEVFNP SKHGHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFKGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDIAMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_UWOPS05_217_3 from Stanford:

YAL060W_UWOPS05_217_3 [source=Stanford]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 2146  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH KLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LVEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EVAERRIEMA KKLGVEVFNP SKHGQKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFKGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDIAMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_VL3 from AWRI:

YAL060W_VL3 [source=AWRI]  Length: 368  Tue Sep 26 00:33:23 2017  Type: P  Check: 3878  ..

       1  MISXGQKSKP TMRLLSTSLG VGFVARIFTS TWMVQSSCLK MESAINLSNA

      51  ALPLAMGHEM SGIVSKVGPK VTKXKVGDHV VVDAASSCXD LHCWPHSKFY

     101  NSKPXDACQR GSENLCTHAG FVGLGVISGG FAEQVVVSQH HIIPVPKEIP

     151  LDVAALXEPL SVTWHAVKIS GFKKGSSAXV LGAGPIGLCT ILVLKGMGXS

     201  KIVVSEVAER RIEMAKKLGV EVFNPSKHGH KSIEILRGLT KSHDGFDYSY

     251  DCSGIQXTFE TSLKALTFXG TATNIAVWGP KPXPFQPMDV TLQEKVMTGS

     301  IGYVVEDXEE VVRAIHNGDI XMEDCKQLIT GKQRIEDGWE KGFQELMDHK

     351  ESNVKILLTP NNHGEMK*

Protein Sequence for YAL060W_Vin13 from AWRI:

YAL060W_Vin13 [source=AWRI]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 3482  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH KLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPX DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LXEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EVAERRIEMA KKLGVEVFNP SKHGHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFRGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDITMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_W303 from Stanford:

YAL060W_W303 [source=Stanford]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 1330  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH KLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LVEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EIAERRIEMA KKLGVEVFNP SKHGHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFKGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDIAMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_X2180-1A from Stanford:

YAL060W_X2180-1A [source=Stanford]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 1330  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH KLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LVEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EIAERRIEMA KKLGVEVFNP SKHGHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFKGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDIAMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_Y55 from Stanford:

YAL060W_Y55 [source=Stanford]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 2299  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH KLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LVEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EIAERRIEMA KKLGVEVFNP SKHGHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFKGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDITMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_YJM269 from WashU:

YAL060W_YJM269 [source=WashU]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 2449  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH NLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LVEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EVAERRIEMA KKLGVEVFNP SKHGHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFKGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDIAMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHSE MK*

Protein Sequence for YAL060W_YJM339 from Stanford:

YAL060W_YJM339 [source=Stanford]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 2005  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH NLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LVEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EVAERRIEMA KKLGVEVFNP SKHGHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFKGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDIAMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_YJM789 from Stanford:

YAL060W_YJM789 [source=Stanford]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 3519  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH NLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LVEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EVAERRIEMA KKLGVEVFNP SKHGQKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFRGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDITMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_YPH499 from Stanford:

YAL060W_YPH499 [source=Stanford]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 1330  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH KLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LVEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EIAERRIEMA KKLGVEVFNP SKHGHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFKGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDIAMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_YPS128 from Stanford:

YAL060W_YPS128 [source=Stanford]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 3354  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH KLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LVEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EVAERRIEMA KKLGVEVFNP SKHGHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFRGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDITMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_YPS163 from Stanford:

YAL060W_YPS163 [source=Stanford]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 3354  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH KLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LVEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EVAERRIEMA KKLGVEVFNP SKHGHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFRGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDITMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_YS9 from Stanford:

YAL060W_YS9 [source=Stanford]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 3782  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH KLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXVLGAGP

     201  IGLCTILVLK GMGASKIVVS EVAERRIEMA KKLGVEVFNP SKHGHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFRGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDITMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*

Protein Sequence for YAL060W_ZTW1 from Zhejiang:

YAL060W_ZTW1 [source=Zhejiang]  Length: 383  Tue Sep 26 00:33:23 2017  Type: P  Check: 3354  ..

       1  MRALAYFKKG DIHFTNDIPR PEIQTDDEVI IDVSWCGICG SDLHEYLDGP

      51  IFMPKDGECH KLSNAALPLA MGHEMSGIVS KVGPKVTKVK VGDHVVVDAA

     101  SSCADLHCWP HSKFYNSKPC DACQRGSENL CTHAGFVGLG VISGGFAEQV

     151  VVSQHHIIPV PKEIPLDVAA LVEPLSVTWH AVKISGFKKG SSALVLGAGP

     201  IGLCTILVLK GMGASKIVVS EVAERRIEMA KKLGVEVFNP SKHGHKSIEI

     251  LRGLTKSHDG FDYSYDCSGI QVTFETSLKA LTFRGTATNI AVWGPKPVPF

     301  QPMDVTLQEK VMTGSIGYVV EDFEEVVRAI HNGDITMEDC KQLITGKQRI

     351  EDGWEKGFQE LMDHKESNVK ILLTPNNHGE MK*