OLI1/Q0130 S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

Q0130_S288C   1   MQLVLAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDTVFPM   50
Q0130_EC9-8   1   MQLVLAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDLVFPM   50
Q0130_JAY291   1   MQLVLAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDLVFPM   50
Q0130_T73   1   MQLVLAAKYIGAGISTIGLLGAGIGIAIVFAALINGVSRNPSIKDLVFPM   50
         

Q0130_S288C   51   AILGFALSEATGLFCLMVSFLLLFGV   76
Q0130_EC9-8   51   AILGFALSEATGLFCLMVSFLLLFGV   76
Q0130_JAY291   51   AILGFALSEATGLFCLMVSFLLLFGV   76
Q0130_T73   51   AILGFALSEATGLFCLMVSFLLLFGV   76
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for Q0130_S288C from SGD:

Q0130_S288C [source=SGD]  Length: 77  Fri Jul 20 11:18:00 2018  Type: P  Check: 8495  ..

       1  MQLVLAAKYI GAGISTIGLL GAGIGIAIVF AALINGVSRN PSIKDTVFPM

      51  AILGFALSEA TGLFCLMVSF LLLFGV*

Protein Sequence for Q0130_EC9-8 from ASinica:

Q0130_EC9-8 [source=ASinica]  Length: 77  Fri Jul 20 11:18:00 2018  Type: P  Check: 8127  ..

       1  MQLVLAAKYI GAGISTIGLL GAGIGIAIVF AALINGVSRN PSIKDLVFPM

      51  AILGFALSEA TGLFCLMVSF LLLFGV*

Protein Sequence for Q0130_JAY291 from Duke:

Q0130_JAY291 [source=Duke]  Length: 77  Fri Jul 20 11:18:00 2018  Type: P  Check: 8127  ..

       1  MQLVLAAKYI GAGISTIGLL GAGIGIAIVF AALINGVSRN PSIKDLVFPM

      51  AILGFALSEA TGLFCLMVSF LLLFGV*

Protein Sequence for Q0130_T73 from WashU:

Q0130_T73 [source=WashU]  Length: 77  Fri Jul 20 11:18:00 2018  Type: P  Check: 8127  ..

       1  MQLVLAAKYI GAGISTIGLL GAGIGIAIVF AALINGVSRN PSIKDLVFPM

      51  AILGFALSEA TGLFCLMVSF LLLFGV*