Q0010 S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

Q0010_S288C   1   MYYIMFLYNMLLIIILIFYSIVGVPIIIFNNNYYWDPDIFLFIIYYFIKF   50
Q0010_JK9-3d   1   -------MCALYIFNILVIITHPLPXXXXXXXXXXXXXXXXXXXXXXXXX   43
         

Q0010_S288C   51   IIIFNLYLYYMINYIVYTPSGSPPGRGTYILLYNMLYSYNMFIDYVMKFI   100
Q0010_JK9-3d   44   XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX   93
         

Q0010_S288C   101   TCVTYMYLMFWLLSPTPSPYYVSEVPVS   128
Q0010_JK9-3d   94   XXXXXXXXXXXXXXXXXXXXXXXXXPVS   121
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for Q0010_S288C from SGD:

Q0010_S288C [source=SGD]  Length: 129  Tue Sep 19 07:40:00 2017  Type: P  Check: 6711  ..

       1  MYYIMFLYNM LLIIILIFYS IVGVPIIIFN NNYYWDPDIF LFIIYYFIKF

      51  IIIFNLYLYY MINYIVYTPS GSPPGRGTYI LLYNMLYSYN MFIDYVMKFI

     101  TCVTYMYLMF WLLSPTPSPY YVSEVPVS*

Protein Sequence for Q0010_JK9-3d from Stanford:

Q0010_JK9-3d [source=Stanford]  Length: 122  Tue Sep 19 07:40:00 2017  Type: P  Check: 1756  ..

       1  MCALYIFNIL VIITHPLPXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX

      51  XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX

     101  XXXXXXXXXX XXXXXXXXPV S*