Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YPR189W and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_SKI3/YPR189W   1   MSDIKQLLKEAKQELTNRDYEETIEISEKVLKLDPDNYFAHIFLGKALSS   50
MIT_Smik_c258_22953   1   MSDVKQLLKEAKQGLKCRDYEETIEISERVLKLDPDNYFAHIFLGKALSS   50
MIT_Spar_c565_22725   1   MLDIKQLLKEAKRELTNRDYEETIEISEKVLKLDPDNYFAHIFLGKAFSS   50
MIT_Suva_c606_26166   1   MSDVKQLLKEAKLELTRRDYEETIEISKEVLKLDPDNYFAHIFLGKAFSS   50
WashU_Sbay_Contig654.34   1   MSDVKQLLKEAKLELTRRDYEETIEISKEVLKLDPDNYFAHIFLGKAFSS   50
WashU_Scas_Contig631.4   1   MSEVKQLLKEAKIELSRADYEEAAAISEQVLKLDPENYFAQVFLGKSYSC   50
Symbols






* ::******** *. ****: **:.******:****::****: *.



SGD_Scer_SKI3/YPR189W   51   LPASNNVSSNRNLERATNHYVSAAKLVPDNLLAWKGLFLLFRTTEVVPDI   100
MIT_Smik_c258_22953   51   LPTNNDVSSNSNLQRATTHYISATKLLPDNLLAWKGLFLLFKTTEVVPDI   100
MIT_Spar_c565_22725   51   LPASNDVSSNLNLQRATTHYISATRSVPNNLLAWKGLFLLFKTTEVVPDT   100
MIT_Suva_c606_26166   51   LPPSNEGSPNRHLESATAHYISATKLAPENLLAWKGLFLLFKTTDAVPNI   100
WashU_Sbay_Contig654.34   51   LPPSNEGSPNRHLESATAHYISATKLAPENLLAWKGLFLLFKTTDAVPNI   100
WashU_Scas_Contig631.4   51   IEN--------KMKDAVSHYVAATDLLPNNMLAWKGFFILLNSEGVVPST   92
Symbols






: ::: *. **::*: *:*:*****:*:*:.: .**.



SGD_Scer_SKI3/YPR189W   101   LSYDEYFDLCGQYADALLKQEQSQVELINDIKLLKKTHPDCQKAFYQHLK   150
MIT_Smik_c258_22953   101   LSYDEYFDLCGQYADALLKQEQSQVELVNDIKLLKKTHPDCQKAFYQHLK   150
MIT_Spar_c565_22725   101   LSYDEYFDLCGQYADALLKQEQSQVELINDIKLLKKTHPDCQRAFYQHLK   150
MIT_Suva_c606_26166   101   LSYDEYFDLCGQYADILLKQEQSQIDLINDIKLLKKTHTDCRRAFYEHLK   150
WashU_Sbay_Contig654.34   101   LSYDEYFDLCGQYADILLKQEQSQIDLINDIKLLKKTHTDCRRAFYEHLK   150
WashU_Scas_Contig631.4   93   VSFDDYFNLCGKYAETLIQNELPLVELIHELRVMKKKFPQSHESFYRHMR   142
Symbols






:*:*:**:***:**: *:::* . ::*:::::::**...:.:.:**.*::



SGD_Scer_SKI3/YPR189W   151   PGSLMAETIGRHLSTPQDALLNLIKILSNIETTEIGKTLSQNRLKLKASD   200
MIT_Smik_c258_22953   151   PGSLMAETIGRHLSTSQDALLNLIRILTNIETTEIGKAVSQNRLKLKASD   200
MIT_Spar_c565_22725   151   PGSLMAETIGRHLSTPQDALLNLIKILASIETTEIGKTLSQNRLKLKASD   200
MIT_Suva_c606_26166   151   PGSLMAETIGRHLATPQDALLNLIKIMSNTEITEIGKAVSQNRLRLKASD   200
WashU_Sbay_Contig654.34   151   PGSLMAETIGRHLATPQDALLNLIKIMSNTEITEIGKAVSQNRLRLKASD   200
WashU_Scas_Contig631.4   143   PGTPMAERLGRHLITPQDALKGLITIINDRELESIAKIVSRERLRLSTND   192
Symbols






**: *** :**** *.**** .** *: . * .*.* :*::**:*.:.*



SGD_Scer_SKI3/YPR189W   201   PDYQIKLNSFSWEIIKNSEIDQLYNQLVNILADDQKRSEIENQWLEYRIK   250
MIT_Smik_c258_22953   201   PDYQIKLNSFSWEIIKNSEIDQLYNQLVNILTDDQLRSEIENQWLEYRMK   250
MIT_Spar_c565_22725   201   PDYQIKLNSFSWEIIKNSEIDQLYNQLVNILADDQLRSEIENQWLEYRIK   250
MIT_Suva_c606_26166   201   PDYQIKLNSFSWEIIKNSEIDQLYNQLVNILTDDQLRSDTENEWLEYRIK   250
WashU_Sbay_Contig654.34   201   PDYQIKLNSFSWEIIKNSEIDQLYNQLVNILTDDQLRSDTENEWLEYRIK   250
WashU_Scas_Contig631.4   193   PDYQIKINALAWEVFNTSELDDLYNQLINILDDDDTRAKYESLWLEYRIR   242
Symbols






******:*:::**:::.**:*:*****:*** **: *:. *. *****::



SGD_Scer_SKI3/YPR189W   251   VLKSMPLDVKKDFFTKVKEMVEDMVLVNHQSLLAWQKYFEWTDYEDLDNM   300
MIT_Smik_c258_22953   251   VLKSMPLDVKKDFFTKVKNMVEDMVLVNHQSLLAWQKFFEWTDYEDLDNM   300
MIT_Spar_c565_22725   251   VLKSMPLDVKKDFFTKVKEMVEDMVLVNHQSLLAWQKFFEWTDYEDLDNM   300
MIT_Suva_c606_26166   251   VLKSMPLDVKKDFFMKVKEMVEDMVLVDHQSLLAWQKFFEWKDYEDLDNM   300
WashU_Sbay_Contig654.34   251   VLKSMPLDVKKDFFMKVKEMVEDMVLVDHQSLLAWQKFFEWKDYEDLDNM   300
WashU_Scas_Contig631.4   243   VLKSMPIDLKLNFFFKVKNMVEDMVLVDHGSLLVWSLYFEWHDYEDLDKM   292
Symbols






******:*:* :** ***:********:* ***.*. :*** ******:*



SGD_Scer_SKI3/YPR189W   301   DAPLIIKYFKKFPKDPLAMILYSWLSSKLSKYDIKSLESANKPPEGHKKT   350
MIT_Smik_c258_22953   301   DAALILKYFKKFPKDPLAMILYSWLSSKLSKYDVKSLESASQSSGSNNNE   350
MIT_Spar_c565_22725   301   DAALILKYFKKFPKDPLAMILYSWLSSKLSKYDIKSLESANQSPESQNKG   350
MIT_Suva_c606_26166   301   DATLILQYFKKFPKDPLAMILYSWVFSKLSKYDIKSLEATNQPPESHDKG   350
WashU_Sbay_Contig654.34   301   DATLILQYFKKFPKDPLAMILYSWVFSKLSKYDIKSLEATNQPPESHDKG   350
WashU_Scas_Contig631.4   293   DKNLILKFFKKFPTEPLAMILYAWICSSFSKYDISEFDNNDKKNEKTETI   342
Symbols






* **:::*****.:*******:*: *.:****:..:: .: ..



SGD_Scer_SKI3/YPR189W   351   EKETDIKDVDETNEDEVKDRVEDEVKDRVEDEVKDQDEEAKEDEEEDLDD   400
MIT_Smik_c258_22953   351   KKEADIKVIDEGDEHEVKDHGENETK---------------EDDEEDLDD   385
MIT_Spar_c565_22725   351   TKETDIKDIDEGNEDKVKDHGEDESKNQNENEN-----DAKEDEEEDLDD   395
MIT_Suva_c606_26166   351   TKETDVKNTDEHVIKDQNENENENENEPKEDEP-------KEDDEEDLDD   393
WashU_Sbay_Contig654.34   351   TKETDVKNTDEHVIKDQNENENENENEPKEDEP-------KEDDEEDLDD   393
WashU_Scas_Contig631.4   343   RESETETEDDELN-----------------------------ELVENEEE   363
Symbols






:. . ** : *: ::



SGD_Scer_SKI3/YPR189W   401   IEIGLLEEEVVTVLTENIVKCKNNILAHRILCQYYLLTKEYEAALPYIKN   450
MIT_Smik_c258_22953   386   IEIGLLEDEVVTVLTENILKCKNNILAHRILCQYYLLTKEYEAALPYIKN   435
MIT_Spar_c565_22725   396   IEIGLLEEEVVTVLTENIVKCKNNILAHRILCQYYLLTKEYEAALPYIKN   445
MIT_Suva_c606_26166   394   MEISLLEDEVVTALTENIVKCKNNILAHRILCQYYLLTKEYEASLPYIKT   443
WashU_Sbay_Contig654.34   394   MEISLLEDEVVTALTENIVKCKNNILAHRILCQYYLLTKEYEASLPYIKT   443
WashU_Scas_Contig631.4   364   DSQTLKEDDILIALNDNISKAQNNALAHRIISQYYIFSKEYEAALPYIKK   413
Symbols






. * *:::: .*.:** *.:** *****:.***:::*****:*****.



SGD_Scer_SKI3/YPR189W   451   GISLIAYNIKDLGVHLPLTKREFSLDLATVYTYVDAPKDHNAALKLYDNI   500
MIT_Smik_c258_22953   436   GISLIAYNIKDLGVFLPLTKREFSLDLATVYTYVDAPKDHNAALRLYDNI   485
MIT_Spar_c565_22725   446   GISLIAYNIKDLGVYLPLTKREFSLDLATVYTYVDAPKDHNAALRLYDNI   495
MIT_Suva_c606_26166   444   GISLIAYNIKDLGVYLPLTKRAFSLDLATVYTYVDAPKDHNAALKLYDNI   493
WashU_Sbay_Contig654.34   444   GISLIAYNIKDLGVYLPLTKRAFSLDLATVYTYVDAPKDHNAALKLYDNI   493
WashU_Scas_Contig631.4   414   GISLVSHKIRDLGCQLIHTKREFSLTLATCYTYVDAPQFHNAAMTLFDRI   463
Symbols






****::::*:*** * *** *** *** *******: ****: *:*.*



SGD_Scer_SKI3/YPR189W   501   LSGDFSNIQAKMGKGIIFIERKNWKDAMTLLTQVHEQSPNNLEVLSELSW   550
MIT_Smik_c258_22953   486   LSGDSDNIQAKMGKGIIFIERKNWKDAMTLLTEVHEQSPDNLEVLSELSW   535
MIT_Spar_c565_22725   496   LSGDSDNIQAKMGKGIIFIERKNWKDAMTLLTQVHEQSPDNLEVLSELSW   545
MIT_Suva_c606_26166   494   LSGDSDNIQAKMGKGIIFIERKNWEEAMTLLTEVHEQSPDNLEVLSELSW   543
WashU_Sbay_Contig654.34   494   LSGDSDNIQAKMGKGIIFIERKNWEEAMTLLTEVHEQSPDNLEVLSELSW   543
WashU_Scas_Contig631.4   464   LQESPDNTRAKMGKGIIYIERENWQDANKLLKEVINEYPDNLDVLSELGW   513
Symbols






*. . .* :********:***:**::* .**.:* :: *:**:*****.*



SGD_Scer_SKI3/YPR189W   551   SKAHMGYMDEALAGLDTVIKGIKGMDLRSIDFRALNLWRQAKVYIMKHAS   600
MIT_Smik_c258_22953   536   SKAHMGQMDESLIGLDTVVKAIKGMDLRSIDFRALNLWRQAKVYIMIHTS   585
MIT_Spar_c565_22725   546   SKAHMDYTDDALAGLDTVVKGIKGMDLRSIDFRALNLWRQAKVYIMKHAS   595
MIT_Suva_c606_26166   544   SKAHMGYMEEALVGLDGVVKAIKGMDLRSIDFRALNLWRQAKVYLMKHAS   593
WashU_Sbay_Contig654.34   544   SKAHMGYMEEALVGLDGVVKAIKGMDLRSIDFRALNLWRQAKVYLMKHAS   593
WashU_Scas_Contig631.4   514   TKANLGQYDEAIEMLSSALRMITGNDLRTTTFRALTLWRQAKSYIFKEAA   563
Symbols






:**::. :::: *. .:: *.* ***: ****.****** *:: .::



SGD_Scer_SKI3/YPR189W   601   INDAKQENVKCAFKLLIQSIKILDTFAPGFSTLGDIYCHYYKDHLRAFKC   650
MIT_Smik_c258_22953   586   SSDPQQENIKRAFKLLIQSIKILDTFAPGFSTLGDIYCHYYKDHSRAFKC   635
MIT_Spar_c565_22725   596   IKDTKQENIKCAFKLLIQSIKILDTFAPGFSTLGDIYCHYYKDHLRAFKC   645
MIT_Suva_c606_26166   594   LDDENQENIKFAFKLLIQSIKILDTFAPGFSTLGDIYCHYYKDHSRAFKC   643
WashU_Sbay_Contig654.34   594   LDDENQENIKFAFKLLIQSIKILDTFAPGFSTLGDIYCHYYKDHSRAFKC   643
WashU_Scas_Contig631.4   564   NVSQGLENIKLAFKILVQLIKVLDTYAPAYSTLGDLYTTYYKDSGRAFKC   613
Symbols






. **:* ***:*:* **:***:**.:*****:* **** *****



SGD_Scer_SKI3/YPR189W   651   YFKAFDLDAGDYTAAKYITETYASKPNWQAASSIASRLIKGEKAKAELRS   700
MIT_Smik_c258_22953   636   YFKAFDLNAGDYTASKYITETYANKPNWQAASSIASRLIKGEKAKAELRK   685
MIT_Spar_c565_22725   646   YFKAFDLDAGDYTAAKYITETYASKPNWQAASSIASRLIKSEKAKAQLRS   695
MIT_Suva_c606_26166   644   YFKAFDLDAGDYTAAKYITETYASKPNWQAASSIASRLIKGEKAKAEIRS   693
WashU_Sbay_Contig654.34   644   YFKAFDLDAGDYTAAKYITETYASKPNWQAASSIASRLIKGEKAKAEIRS   693
WashU_Scas_Contig631.4   614   YYKAFELDAGDHIAANYMTEVYAKSNNWSSAVQIAERLVKAEKAKRVLQT   663
Symbols






*:***:*:***: *::*:**.**.. **.:* .**.**:*.**** ::.



SGD_Scer_SKI3/YPR189W   701   NNWPFRVVGIAHLEKQEESDSIEWFQSALRVDPNDVESWVGLGQAYHACG   750
MIT_Smik_c258_22953   686   NNWPFRVVGIAHLEKQEESDSIEWFQSALRIDPNDVESWVGLGQAYHACG   735
MIT_Spar_c565_22725   696   NNWPFRAVGIAHLEKQEESDSIEWFQSALRVDPNDVESWVGLGQAYHACG   745
MIT_Suva_c606_26166   694   NNWPFRVVGIAHLEKQEESDSIEWFQSALRVDPNDVESWVGLGQAYHACG   743
WashU_Sbay_Contig654.34   694   NNWPFRVVGIAHLEKQEESDSIEWFQSALRVDPNDVESWVGLGQAYHACG   743
WashU_Scas_Contig631.4   664   MNWPYRVIGIGNLERQQESDSIEWFQSAIRVDPNDVESWIGLGQAYLGCG   713
Symbols






***:*.:**.:**:*:***********:*:********:****** .**



SGD_Scer_SKI3/YPR189W   751   RIEASIKVFDKAIQLRPSHTFAQYFKAISLCDVGEYLESLDILEKVCQEA   800
MIT_Smik_c258_22953   736   RIEASIKVFDKAIQLRPSHTYAQYFKAVSLCDIGEYLESLEILKKVCQED   785
MIT_Spar_c565_22725   746   RIEASIKVFDKAIQLRPSHTYAQYFKAISLCDVGEYLESLEILEKVCQET   795
MIT_Suva_c606_26166   744   RIEASIKVFDKAIELQPSHTYARYFRALSLCDMGEYLESLETLEKVCQEV   793
WashU_Sbay_Contig654.34   744   RIEASIKVFDKAIELQPSHTYARYFRALSLCDMGEYLESLETLEKVCQEV   793
WashU_Scas_Contig631.4   714   RIEASIKVFEKAIELDSSHTYAKYFKSIALSEMGEFTESIPLLKEITGTH   763
Symbols






*********:***:* .***:*:**::::*.::**: **: *:::



SGD_Scer_SKI3/YPR189W   801   ATEESFQIGLVEVLMRCSLDLYSQGFLLKSVSIAKDTIERIKIIISELKC   850
MIT_Smik_c258_22953   786   STEESFQSALVEVLMKYSLDLYSQGFLLKSVSIANDTIERIKVIITELKC   835
MIT_Spar_c565_22725   796   ATEESFQIGLVEVLMRYSLDLYSQGFLLKSVAIANDTIERIKIIITELKC   845
MIT_Suva_c606_26166   794   ATEESFQIGLVDVLVKYSLDLYAQGFLMKSVAVANDTIERIRIIITELKC   843
WashU_Sbay_Contig654.34   794   ATEESFQIGLVDVLVKYSLDLYAQGFLMKSVAVANDTIERIRIIITELKC   843
WashU_Scas_Contig631.4   764   PEEETFQVSLATTLVNYAYDLYYEGFLMKSISIVLDSIEVMKFIVSELSC   813
Symbols






. **:** .*. .*:. : *** :***:**:::. *:** ::.*::**.*



SGD_Scer_SKI3/YPR189W   851   ENQQVWIYLSQVLRLFIWIESKVDTLPVESLVSIFENSQFSGSEEIDSVD   900
MIT_Smik_c258_22953   836   INQRVWICLSQVLRLFIWIESKVDTLPVESLVSIFETSELSGSKEIDSID   885
MIT_Spar_c565_22725   846   VNQQVWICLSQVLRLFIWIESKVDTLPVESLVSIFESSELTGSEEIDSID   895
MIT_Suva_c606_26166   844   TNQQIWICLSQVLRLFIWIESKVDTLPVESLVSIFKISELAETKEVDSID   893
WashU_Sbay_Contig654.34   844   TNQQIWICLSQVLRLFIWIESKVDTLPVESLVSIFKISELAETKEVDSID   893
WashU_Scas_Contig631.4   814   SVQNLWISLSRALKLFVFVESRIDCLPVESLVEIFSSKGLIGTKDVDQID   863
Symbols






*.:** **:.*:**:::**::* *******.**. . : ::::*.:*



SGD_Scer_SKI3/YPR189W   901   NIKIDTLLDSTTDDNVSIACKFLILASKYSVSDQKFTDIAGTVRASYWYN   950
MIT_Smik_c258_22953   886   DIKIETLLDSTIDDNVSIACKFLILASKYSVSNENFSDIAGTVRASYWYN   935
MIT_Spar_c565_22725   896   NIKIDTLLDSTTDDNVSIACKFLILASKYSVSNQNFSDIAGTVRASYWYN   945
MIT_Suva_c606_26166   894   NIKIDTLLDSTTDDNVSIACKFLILASKYSVSNQSMSDIAGTIRASYWYN   943
WashU_Sbay_Contig654.34   894   NIKIDTLLDSTTDDNVSIACKFLILASKYSVSNQSMSDIAGTIRASYWYN   943
WashU_Scas_Contig631.4   864   DVELKTILASSDEDNITIGCQFLILAAKYAIPSENLTEYAATVRSALWCN   913
Symbols






::::.*:* *: :**::*.*:*****:**::..:.::: *.*:*:: * *



SGD_Scer_SKI3/YPR189W   951   IGISELTAFITLKEPQYRDAAIFAFKKSIQLQSNTSETWIGLGIATMDIN   1000
MIT_Smik_c258_22953   936   IGISELTAFITLKEPQYKNAAVFAFKKSIQLQSNASETWIGLGIATMDIN   985
MIT_Spar_c565_22725   946   IGISELTAFITLKEPQYRDAAIFAFKKSIQLQSNTSETWIGLGIATMDIN   995
MIT_Suva_c606_26166   944   IGISELTAFVTLKDSHYRDAAVFAFKKSIQLQSNTSETWIGLGIATMDIN   993
WashU_Sbay_Contig654.34   944   IGISELTAFVTLKDSHYRDAAVFAFKKSIQLQSNTSETWIGLGIATMDIN   993
WashU_Scas_Contig631.4   914   IGVTELTASLVLKEAKFRDAAIFSFKRSIKYQSNTTEAWIGLGIATMDVN   963
Symbols






**::**** :.**:.::::**:*:**:**: ***::*:**********:*



SGD_Scer_SKI3/YPR189W   1001   FRVSQHCFIKATALEPKATNTWFNLAMLGLKKKDTEFAQQVLNKLQSLAP   1050
MIT_Smik_c258_22953   986   FRVSQHCFIKATALEPKATDTWFNLAMLGLKKNDTEFAQQVLNKLQSLAP   1035
MIT_Spar_c565_22725   996   FRVSQHCFIKATALEPKAADVWFNLAMLGLKKNDTEFAQQVLNKLQSLAP   1045
MIT_Suva_c606_26166   994   FRVSQHCFIKATALEPKATDIWFNLAMLGLKKNDTEFAQQVLNRLQSLAP   1043
WashU_Sbay_Contig654.34   994   FRVSQHCFIKATALEPKATDIWFNLAMLGLKKNDTEFAQQVLNRLQSLAP   1043
WashU_Scas_Contig631.4   964   YRVSQHCFIKAVALAPKDIEISFNLAMLALKNNDLEFAEQILMRSQSVAP   1013
Symbols






:**********.** ** : ******.**::* ***:*:* : **:**



SGD_Scer_SKI3/YPR189W   1051   QDSSPWLGMALILEEQGDIIGSSKLFAHSFILSNGRSKAAQFMYAKNVLE   1100
MIT_Smik_c258_22953   1036   QDSSPWLGMALILEKQGNVIESSKLFAHSFILSNGRSKAAQFLYAKNVLE   1085
MIT_Spar_c565_22725   1046   QDSSPWLGMALIFEEQGDVIESSKLFAHSFILSNGRSKAAQFLYAKNVLE   1095
MIT_Suva_c606_26166   1044   QDSSPWLGMALILEEQGNIVESSKLFAHSYILSNGRSKAAQVLYAKSVLE   1093
WashU_Sbay_Contig654.34   1044   QDSSPWLGMALILEEQGNIVESSKLFAHSYILSNGRSKAAQVLYAKSVLE   1093
WashU_Scas_Contig631.4   1014   QDSSPWLGLALILEKNGNTADSCSLFAHSFILSNGRSKMSQLLYAKSTLQ   1063
Symbols






********:***:*::*: *..*****:******** :*.:***..*:



SGD_Scer_SKI3/YPR189W   1101   NHINNGDDERDIETVEKLTTASIALEQFFKKSPDSQFALQCALLTLERLH   1150
MIT_Smik_c258_22953   1086   NHINNGDDERDIEIVEKLTTTSIALEQFFKKSPENPFALQCALLTIERLH   1135
MIT_Spar_c565_22725   1096   NHINNGDDERDIETVERLTAASIALEQFFKKSPDNSFALQCALLTLERLH   1145
MIT_Suva_c606_26166   1094   NHIDNGDDERDIETVEKLTTVSIALDQFFKKSPENPFALQCALLTLERLH   1143
WashU_Sbay_Contig654.34   1094   NHIDNGDDERDIETVEKLTTVSIALDQFFKKSPENPFALQCALLTLERLH   1143
WashU_Scas_Contig631.4   1064   KYIGNENDERNIQVVEELTTVINALDQYFKKEPENAFALECALLTLERLH   1113
Symbols






::*.* :***:*: **.**:. **:*:***.*:. ***:*****:****



SGD_Scer_SKI3/YPR189W   1151   HYENANELANRLIGILEKKFEKTQDERELFNFAIIKGQFARIHLGLGNFE   1200
MIT_Smik_c258_22953   1136   HYQHANELANRLIGILEKRFEKTQDERELFTFGIIKGQFARIHLGLGNFE   1185
MIT_Spar_c565_22725   1146   HYENASELANRLIGILEKRFEKTQDEKELFTFAIIKGQFARIHLGLGNFE   1195
MIT_Suva_c606_26166   1144   HYEPANKFANQLAGILEKRFEKSQDEKELFNFGIIKGQFARIHLGLGNFE   1193
WashU_Sbay_Contig654.34   1144   HYEPANKFANQLAGILEKRFEKSQDEKELFNFGIIKGQFARIHLGLGNFE   1193
WashU_Scas_Contig631.4   1114   NFKFANNLSEKLTELLESRFEKTQNENELFNFAIIRAQFARIQLGLRNFK   1163
Symbols






::: *.:::::* :**.:***:*:*.***.*.**:.*****:*** **:



SGD_Scer_SKI3/YPR189W   1201   LSIENADLSQGIISESSDEKSMKTKISNHICLGLSYFFLNDFDQTLNQFQ   1250
MIT_Smik_c258_22953   1186   LSIENAELSQGIISESSDRNSMKTKISNHICLGLSHFFLNEFDQTLSQFQ   1235
MIT_Spar_c565_22725   1196   LSIENADLSQGIISESRDEKSMKTKISNHICLGLSYFFLNDFDQTLNQFQ   1245
MIT_Suva_c606_26166   1194   LSIENAELSQGIISESSDKKALRTKISNHISLGLSYFFLNDFDQTLSQFQ   1243
WashU_Sbay_Contig654.34   1194   LSIENAELSQGIISESSDKKALRTKISNHISLGLSYFFLNDFDQTLSQFQ   1243
WashU_Scas_Contig631.4   1164   SAIENSELSQGILADFSNDRVISAQISNHICLGLSYFFLDDFDETLAHFQ   1213
Symbols






:***::*****::: : . : ::*****.****:***::**:** :**



SGD_Scer_SKI3/YPR189W   1251   ELLSISKDSKHLVVLIAKVLYDVGESDTKEIALQELTEYIATSGADLLVT   1300
MIT_Smik_c258_22953   1236   ELLSVSKDSKHLVILIAKVLYDVGESEAKEIALQELTEYITIKGADLLIT   1285
MIT_Spar_c565_22725   1246   ELLSVSKDSKHLVILIAKVLYDVGESDTKEIALQELTEYITIKGADLLIT   1295
MIT_Suva_c606_26166   1244   ELLKVSKESKHLVILIAKVLYDVGENDTKDIALQELTEYITANGADLLIT   1293
WashU_Sbay_Contig654.34   1244   ELLKVSKESKHLVILIAKVLYDVGENDTKDIALQELTEYITANGADLLIT   1293
WashU_Scas_Contig631.4   1214   ELLNISKDSKNLVLLIVKVLYEVGTPDTKLIAMQELTDYVKTQGVDLLTT   1263
Symbols






***.:**:**:**:**.****:** ::* **:****:*: .*.*** *



SGD_Scer_SKI3/YPR189W   1301   LTIAAMSILDDKREDLSIILEELKALPLSKQIIDKHKDAPYLIEEITKRL   1350
MIT_Smik_c258_22953   1286   LTIAAMSILDGKRQDLSIILEELKALPLSSQIIDKHKDAPYLIEEITKRL   1335
MIT_Spar_c565_22725   1296   LTIAAMSILEDKHEDLNIILDELKALPLSKQIMDRHKDAPYLIEEITKRL   1345
MIT_Suva_c606_26166   1294   LTIAAMSILDDKREDLSIIVNELKTLPLSSLIADKHKDAPYLIEEITKRL   1343
WashU_Sbay_Contig654.34   1294   LTIAAMSILDDKREDLSIIVNELKTLPLSSLIADKHKDAPYLIEEITKRL   1343
WashU_Scas_Contig631.4   1264   LTIAAMTILDKKKEDFRTILKELNTMNLSDMILDTYKESPLLIEQVERSL   1313
Symbols






******:**: *::*: *:.**::: **. * * :*::* ***:: : *



SGD_Scer_SKI3/YPR189W   1351   YRN---DTGKQVWQRSAYFFPNNLKVWERLDKNIQRRIASNGQNKVTAEE   1397
MIT_Smik_c258_22953   1336   HFN---DTGKQVWQRSAYFFPNNLKVWEMLNKTIQRRIASDGQNKVTAED   1382
MIT_Spar_c565_22725   1346   YHN---DSGKQVWQRSAYFFPNNLKVWERLNKNIQRKIASDGQNKVTAEE   1392
MIT_Suva_c606_26166   1344   YN----DTGKQTWQRSAYFFPNNLEVWARLNKNIQRKIASNGQNKVTAEE   1389
WashU_Sbay_Contig654.34   1344   YN----DTGKQTWQRSAYFFPNNLEVWARLNKNIQRKIASNGQNKVTAEE   1389
WashU_Scas_Contig631.4   1314   FQDKAVDAGKNTWQRTAFLFPNDYKSWSKLDKRIERRVSSNSACKITAQK   1363
Symbols






. *:**:.***:*::***: : * *:* *:*:::*:. *:**:.



SGD_Scer_SKI3/YPR189W   1398   MSKLYCESKNLRSIQRGMFLCPWNVTAVKALNECF   1432
MIT_Smik_c258_22953   1383   MSILYCETKNLRSVQRGMFLCPWNASAVQALRECF   1417
MIT_Spar_c565_22725   1393   MSKLYCESKNLRSIQRGVFLCPWNVTALKALNECF   1427
MIT_Suva_c606_26166   1390   MSKLYCESKNLRSVQRSVFLCPWNKTVVNALKECF   1424
WashU_Sbay_Contig654.34   1390   MSKLYCESKNLRSVQRSVFLCPWNKTVVNALKECF   1424
WashU_Scas_Contig631.4   1364   MSDIYYSSKNQRNIQRSLFLCPWNEKAVMALKECF   1398
Symbols






** :* .:** *.:**.:****** ..: **.***



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_SKI3/YPR189W:

SGD_Scer_SKI3/YPR189W  Length: 1433  Mon Nov  7 16:54:11 2016  Type: P  Check: 4874  ..

       1  MSDIKQLLKE AKQELTNRDY EETIEISEKV LKLDPDNYFA HIFLGKALSS

      51  LPASNNVSSN RNLERATNHY VSAAKLVPDN LLAWKGLFLL FRTTEVVPDI

     101  LSYDEYFDLC GQYADALLKQ EQSQVELIND IKLLKKTHPD CQKAFYQHLK

     151  PGSLMAETIG RHLSTPQDAL LNLIKILSNI ETTEIGKTLS QNRLKLKASD

     201  PDYQIKLNSF SWEIIKNSEI DQLYNQLVNI LADDQKRSEI ENQWLEYRIK

     251  VLKSMPLDVK KDFFTKVKEM VEDMVLVNHQ SLLAWQKYFE WTDYEDLDNM

     301  DAPLIIKYFK KFPKDPLAMI LYSWLSSKLS KYDIKSLESA NKPPEGHKKT

     351  EKETDIKDVD ETNEDEVKDR VEDEVKDRVE DEVKDQDEEA KEDEEEDLDD

     401  IEIGLLEEEV VTVLTENIVK CKNNILAHRI LCQYYLLTKE YEAALPYIKN

     451  GISLIAYNIK DLGVHLPLTK REFSLDLATV YTYVDAPKDH NAALKLYDNI

     501  LSGDFSNIQA KMGKGIIFIE RKNWKDAMTL LTQVHEQSPN NLEVLSELSW

     551  SKAHMGYMDE ALAGLDTVIK GIKGMDLRSI DFRALNLWRQ AKVYIMKHAS

     601  INDAKQENVK CAFKLLIQSI KILDTFAPGF STLGDIYCHY YKDHLRAFKC

     651  YFKAFDLDAG DYTAAKYITE TYASKPNWQA ASSIASRLIK GEKAKAELRS

     701  NNWPFRVVGI AHLEKQEESD SIEWFQSALR VDPNDVESWV GLGQAYHACG

     751  RIEASIKVFD KAIQLRPSHT FAQYFKAISL CDVGEYLESL DILEKVCQEA

     801  ATEESFQIGL VEVLMRCSLD LYSQGFLLKS VSIAKDTIER IKIIISELKC

     851  ENQQVWIYLS QVLRLFIWIE SKVDTLPVES LVSIFENSQF SGSEEIDSVD

     901  NIKIDTLLDS TTDDNVSIAC KFLILASKYS VSDQKFTDIA GTVRASYWYN

     951  IGISELTAFI TLKEPQYRDA AIFAFKKSIQ LQSNTSETWI GLGIATMDIN

    1001  FRVSQHCFIK ATALEPKATN TWFNLAMLGL KKKDTEFAQQ VLNKLQSLAP

    1051  QDSSPWLGMA LILEEQGDII GSSKLFAHSF ILSNGRSKAA QFMYAKNVLE

    1101  NHINNGDDER DIETVEKLTT ASIALEQFFK KSPDSQFALQ CALLTLERLH

    1151  HYENANELAN RLIGILEKKF EKTQDERELF NFAIIKGQFA RIHLGLGNFE

    1201  LSIENADLSQ GIISESSDEK SMKTKISNHI CLGLSYFFLN DFDQTLNQFQ

    1251  ELLSISKDSK HLVVLIAKVL YDVGESDTKE IALQELTEYI ATSGADLLVT

    1301  LTIAAMSILD DKREDLSIIL EELKALPLSK QIIDKHKDAP YLIEEITKRL

    1351  YRNDTGKQVW QRSAYFFPNN LKVWERLDKN IQRRIASNGQ NKVTAEEMSK

    1401  LYCESKNLRS IQRGMFLCPW NVTAVKALNE CF*

Protein Sequence for MIT_Smik_c258_22953:

MIT_Smik_c258_22953  Length: 1418  Mon Nov  7 16:54:11 2016  Type: P  Check: 175  ..

       1  MSDVKQLLKE AKQGLKCRDY EETIEISERV LKLDPDNYFA HIFLGKALSS

      51  LPTNNDVSSN SNLQRATTHY ISATKLLPDN LLAWKGLFLL FKTTEVVPDI

     101  LSYDEYFDLC GQYADALLKQ EQSQVELVND IKLLKKTHPD CQKAFYQHLK

     151  PGSLMAETIG RHLSTSQDAL LNLIRILTNI ETTEIGKAVS QNRLKLKASD

     201  PDYQIKLNSF SWEIIKNSEI DQLYNQLVNI LTDDQLRSEI ENQWLEYRMK

     251  VLKSMPLDVK KDFFTKVKNM VEDMVLVNHQ SLLAWQKFFE WTDYEDLDNM

     301  DAALILKYFK KFPKDPLAMI LYSWLSSKLS KYDVKSLESA SQSSGSNNNE

     351  KKEADIKVID EGDEHEVKDH GENETKEDDE EDLDDIEIGL LEDEVVTVLT

     401  ENILKCKNNI LAHRILCQYY LLTKEYEAAL PYIKNGISLI AYNIKDLGVF

     451  LPLTKREFSL DLATVYTYVD APKDHNAALR LYDNILSGDS DNIQAKMGKG

     501  IIFIERKNWK DAMTLLTEVH EQSPDNLEVL SELSWSKAHM GQMDESLIGL

     551  DTVVKAIKGM DLRSIDFRAL NLWRQAKVYI MIHTSSSDPQ QENIKRAFKL

     601  LIQSIKILDT FAPGFSTLGD IYCHYYKDHS RAFKCYFKAF DLNAGDYTAS

     651  KYITETYANK PNWQAASSIA SRLIKGEKAK AELRKNNWPF RVVGIAHLEK

     701  QEESDSIEWF QSALRIDPND VESWVGLGQA YHACGRIEAS IKVFDKAIQL

     751  RPSHTYAQYF KAVSLCDIGE YLESLEILKK VCQEDSTEES FQSALVEVLM

     801  KYSLDLYSQG FLLKSVSIAN DTIERIKVII TELKCINQRV WICLSQVLRL

     851  FIWIESKVDT LPVESLVSIF ETSELSGSKE IDSIDDIKIE TLLDSTIDDN

     901  VSIACKFLIL ASKYSVSNEN FSDIAGTVRA SYWYNIGISE LTAFITLKEP

     951  QYKNAAVFAF KKSIQLQSNA SETWIGLGIA TMDINFRVSQ HCFIKATALE

    1001  PKATDTWFNL AMLGLKKNDT EFAQQVLNKL QSLAPQDSSP WLGMALILEK

    1051  QGNVIESSKL FAHSFILSNG RSKAAQFLYA KNVLENHINN GDDERDIEIV

    1101  EKLTTTSIAL EQFFKKSPEN PFALQCALLT IERLHHYQHA NELANRLIGI

    1151  LEKRFEKTQD ERELFTFGII KGQFARIHLG LGNFELSIEN AELSQGIISE

    1201  SSDRNSMKTK ISNHICLGLS HFFLNEFDQT LSQFQELLSV SKDSKHLVIL

    1251  IAKVLYDVGE SEAKEIALQE LTEYITIKGA DLLITLTIAA MSILDGKRQD

    1301  LSIILEELKA LPLSSQIIDK HKDAPYLIEE ITKRLHFNDT GKQVWQRSAY

    1351  FFPNNLKVWE MLNKTIQRRI ASDGQNKVTA EDMSILYCET KNLRSVQRGM

    1401  FLCPWNASAV QALRECF*

Protein Sequence for MIT_Spar_c565_22725:

MIT_Spar_c565_22725  Length: 1428  Mon Nov  7 16:54:11 2016  Type: P  Check: 7907  ..

       1  MLDIKQLLKE AKRELTNRDY EETIEISEKV LKLDPDNYFA HIFLGKAFSS

      51  LPASNDVSSN LNLQRATTHY ISATRSVPNN LLAWKGLFLL FKTTEVVPDT

     101  LSYDEYFDLC GQYADALLKQ EQSQVELIND IKLLKKTHPD CQRAFYQHLK

     151  PGSLMAETIG RHLSTPQDAL LNLIKILASI ETTEIGKTLS QNRLKLKASD

     201  PDYQIKLNSF SWEIIKNSEI DQLYNQLVNI LADDQLRSEI ENQWLEYRIK

     251  VLKSMPLDVK KDFFTKVKEM VEDMVLVNHQ SLLAWQKFFE WTDYEDLDNM

     301  DAALILKYFK KFPKDPLAMI LYSWLSSKLS KYDIKSLESA NQSPESQNKG

     351  TKETDIKDID EGNEDKVKDH GEDESKNQNE NENDAKEDEE EDLDDIEIGL

     401  LEEEVVTVLT ENIVKCKNNI LAHRILCQYY LLTKEYEAAL PYIKNGISLI

     451  AYNIKDLGVY LPLTKREFSL DLATVYTYVD APKDHNAALR LYDNILSGDS

     501  DNIQAKMGKG IIFIERKNWK DAMTLLTQVH EQSPDNLEVL SELSWSKAHM

     551  DYTDDALAGL DTVVKGIKGM DLRSIDFRAL NLWRQAKVYI MKHASIKDTK

     601  QENIKCAFKL LIQSIKILDT FAPGFSTLGD IYCHYYKDHL RAFKCYFKAF

     651  DLDAGDYTAA KYITETYASK PNWQAASSIA SRLIKSEKAK AQLRSNNWPF

     701  RAVGIAHLEK QEESDSIEWF QSALRVDPND VESWVGLGQA YHACGRIEAS

     751  IKVFDKAIQL RPSHTYAQYF KAISLCDVGE YLESLEILEK VCQETATEES

     801  FQIGLVEVLM RYSLDLYSQG FLLKSVAIAN DTIERIKIII TELKCVNQQV

     851  WICLSQVLRL FIWIESKVDT LPVESLVSIF ESSELTGSEE IDSIDNIKID

     901  TLLDSTTDDN VSIACKFLIL ASKYSVSNQN FSDIAGTVRA SYWYNIGISE

     951  LTAFITLKEP QYRDAAIFAF KKSIQLQSNT SETWIGLGIA TMDINFRVSQ

    1001  HCFIKATALE PKAADVWFNL AMLGLKKNDT EFAQQVLNKL QSLAPQDSSP

    1051  WLGMALIFEE QGDVIESSKL FAHSFILSNG RSKAAQFLYA KNVLENHINN

    1101  GDDERDIETV ERLTAASIAL EQFFKKSPDN SFALQCALLT LERLHHYENA

    1151  SELANRLIGI LEKRFEKTQD EKELFTFAII KGQFARIHLG LGNFELSIEN

    1201  ADLSQGIISE SRDEKSMKTK ISNHICLGLS YFFLNDFDQT LNQFQELLSV

    1251  SKDSKHLVIL IAKVLYDVGE SDTKEIALQE LTEYITIKGA DLLITLTIAA

    1301  MSILEDKHED LNIILDELKA LPLSKQIMDR HKDAPYLIEE ITKRLYHNDS

    1351  GKQVWQRSAY FFPNNLKVWE RLNKNIQRKI ASDGQNKVTA EEMSKLYCES

    1401  KNLRSIQRGV FLCPWNVTAL KALNECF*

Protein Sequence for MIT_Suva_c606_26166:

MIT_Suva_c606_26166  Length: 1425  Mon Nov  7 16:54:11 2016  Type: P  Check: 4207  ..

       1  MSDVKQLLKE AKLELTRRDY EETIEISKEV LKLDPDNYFA HIFLGKAFSS

      51  LPPSNEGSPN RHLESATAHY ISATKLAPEN LLAWKGLFLL FKTTDAVPNI

     101  LSYDEYFDLC GQYADILLKQ EQSQIDLIND IKLLKKTHTD CRRAFYEHLK

     151  PGSLMAETIG RHLATPQDAL LNLIKIMSNT EITEIGKAVS QNRLRLKASD

     201  PDYQIKLNSF SWEIIKNSEI DQLYNQLVNI LTDDQLRSDT ENEWLEYRIK

     251  VLKSMPLDVK KDFFMKVKEM VEDMVLVDHQ SLLAWQKFFE WKDYEDLDNM

     301  DATLILQYFK KFPKDPLAMI LYSWVFSKLS KYDIKSLEAT NQPPESHDKG

     351  TKETDVKNTD EHVIKDQNEN ENENENEPKE DEPKEDDEED LDDMEISLLE

     401  DEVVTALTEN IVKCKNNILA HRILCQYYLL TKEYEASLPY IKTGISLIAY

     451  NIKDLGVYLP LTKRAFSLDL ATVYTYVDAP KDHNAALKLY DNILSGDSDN

     501  IQAKMGKGII FIERKNWEEA MTLLTEVHEQ SPDNLEVLSE LSWSKAHMGY

     551  MEEALVGLDG VVKAIKGMDL RSIDFRALNL WRQAKVYLMK HASLDDENQE

     601  NIKFAFKLLI QSIKILDTFA PGFSTLGDIY CHYYKDHSRA FKCYFKAFDL

     651  DAGDYTAAKY ITETYASKPN WQAASSIASR LIKGEKAKAE IRSNNWPFRV

     701  VGIAHLEKQE ESDSIEWFQS ALRVDPNDVE SWVGLGQAYH ACGRIEASIK

     751  VFDKAIELQP SHTYARYFRA LSLCDMGEYL ESLETLEKVC QEVATEESFQ

     801  IGLVDVLVKY SLDLYAQGFL MKSVAVANDT IERIRIIITE LKCTNQQIWI

     851  CLSQVLRLFI WIESKVDTLP VESLVSIFKI SELAETKEVD SIDNIKIDTL

     901  LDSTTDDNVS IACKFLILAS KYSVSNQSMS DIAGTIRASY WYNIGISELT

     951  AFVTLKDSHY RDAAVFAFKK SIQLQSNTSE TWIGLGIATM DINFRVSQHC

    1001  FIKATALEPK ATDIWFNLAM LGLKKNDTEF AQQVLNRLQS LAPQDSSPWL

    1051  GMALILEEQG NIVESSKLFA HSYILSNGRS KAAQVLYAKS VLENHIDNGD

    1101  DERDIETVEK LTTVSIALDQ FFKKSPENPF ALQCALLTLE RLHHYEPANK

    1151  FANQLAGILE KRFEKSQDEK ELFNFGIIKG QFARIHLGLG NFELSIENAE

    1201  LSQGIISESS DKKALRTKIS NHISLGLSYF FLNDFDQTLS QFQELLKVSK

    1251  ESKHLVILIA KVLYDVGEND TKDIALQELT EYITANGADL LITLTIAAMS

    1301  ILDDKREDLS IIVNELKTLP LSSLIADKHK DAPYLIEEIT KRLYNDTGKQ

    1351  TWQRSAYFFP NNLEVWARLN KNIQRKIASN GQNKVTAEEM SKLYCESKNL

    1401  RSVQRSVFLC PWNKTVVNAL KECF*

Protein Sequence for WashU_Sbay_Contig654.34:

WashU_Sbay_Contig654.34  Length: 1425  Mon Nov  7 16:54:11 2016  Type: P  Check: 4207  ..

       1  MSDVKQLLKE AKLELTRRDY EETIEISKEV LKLDPDNYFA HIFLGKAFSS

      51  LPPSNEGSPN RHLESATAHY ISATKLAPEN LLAWKGLFLL FKTTDAVPNI

     101  LSYDEYFDLC GQYADILLKQ EQSQIDLIND IKLLKKTHTD CRRAFYEHLK

     151  PGSLMAETIG RHLATPQDAL LNLIKIMSNT EITEIGKAVS QNRLRLKASD

     201  PDYQIKLNSF SWEIIKNSEI DQLYNQLVNI LTDDQLRSDT ENEWLEYRIK

     251  VLKSMPLDVK KDFFMKVKEM VEDMVLVDHQ SLLAWQKFFE WKDYEDLDNM

     301  DATLILQYFK KFPKDPLAMI LYSWVFSKLS KYDIKSLEAT NQPPESHDKG

     351  TKETDVKNTD EHVIKDQNEN ENENENEPKE DEPKEDDEED LDDMEISLLE

     401  DEVVTALTEN IVKCKNNILA HRILCQYYLL TKEYEASLPY IKTGISLIAY

     451  NIKDLGVYLP LTKRAFSLDL ATVYTYVDAP KDHNAALKLY DNILSGDSDN

     501  IQAKMGKGII FIERKNWEEA MTLLTEVHEQ SPDNLEVLSE LSWSKAHMGY

     551  MEEALVGLDG VVKAIKGMDL RSIDFRALNL WRQAKVYLMK HASLDDENQE

     601  NIKFAFKLLI QSIKILDTFA PGFSTLGDIY CHYYKDHSRA FKCYFKAFDL

     651  DAGDYTAAKY ITETYASKPN WQAASSIASR LIKGEKAKAE IRSNNWPFRV

     701  VGIAHLEKQE ESDSIEWFQS ALRVDPNDVE SWVGLGQAYH ACGRIEASIK

     751  VFDKAIELQP SHTYARYFRA LSLCDMGEYL ESLETLEKVC QEVATEESFQ

     801  IGLVDVLVKY SLDLYAQGFL MKSVAVANDT IERIRIIITE LKCTNQQIWI

     851  CLSQVLRLFI WIESKVDTLP VESLVSIFKI SELAETKEVD SIDNIKIDTL

     901  LDSTTDDNVS IACKFLILAS KYSVSNQSMS DIAGTIRASY WYNIGISELT

     951  AFVTLKDSHY RDAAVFAFKK SIQLQSNTSE TWIGLGIATM DINFRVSQHC

    1001  FIKATALEPK ATDIWFNLAM LGLKKNDTEF AQQVLNRLQS LAPQDSSPWL

    1051  GMALILEEQG NIVESSKLFA HSYILSNGRS KAAQVLYAKS VLENHIDNGD

    1101  DERDIETVEK LTTVSIALDQ FFKKSPENPF ALQCALLTLE RLHHYEPANK

    1151  FANQLAGILE KRFEKSQDEK ELFNFGIIKG QFARIHLGLG NFELSIENAE

    1201  LSQGIISESS DKKALRTKIS NHISLGLSYF FLNDFDQTLS QFQELLKVSK

    1251  ESKHLVILIA KVLYDVGEND TKDIALQELT EYITANGADL LITLTIAAMS

    1301  ILDDKREDLS IIVNELKTLP LSSLIADKHK DAPYLIEEIT KRLYNDTGKQ

    1351  TWQRSAYFFP NNLEVWARLN KNIQRKIASN GQNKVTAEEM SKLYCESKNL

    1401  RSVQRSVFLC PWNKTVVNAL KECF*

Protein Sequence for WashU_Scas_Contig631.4:

WashU_Scas_Contig631.4  Length: 1399  Mon Nov  7 16:54:11 2016  Type: P  Check: 5043  ..

       1  MSEVKQLLKE AKIELSRADY EEAAAISEQV LKLDPENYFA QVFLGKSYSC

      51  IENKMKDAVS HYVAATDLLP NNMLAWKGFF ILLNSEGVVP STVSFDDYFN

     101  LCGKYAETLI QNELPLVELI HELRVMKKKF PQSHESFYRH MRPGTPMAER

     151  LGRHLITPQD ALKGLITIIN DRELESIAKI VSRERLRLST NDPDYQIKIN

     201  ALAWEVFNTS ELDDLYNQLI NILDDDDTRA KYESLWLEYR IRVLKSMPID

     251  LKLNFFFKVK NMVEDMVLVD HGSLLVWSLY FEWHDYEDLD KMDKNLILKF

     301  FKKFPTEPLA MILYAWICSS FSKYDISEFD NNDKKNEKTE TIRESETETE

     351  DDELNELVEN EEEDSQTLKE DDILIALNDN ISKAQNNALA HRIISQYYIF

     401  SKEYEAALPY IKKGISLVSH KIRDLGCQLI HTKREFSLTL ATCYTYVDAP

     451  QFHNAAMTLF DRILQESPDN TRAKMGKGII YIERENWQDA NKLLKEVINE

     501  YPDNLDVLSE LGWTKANLGQ YDEAIEMLSS ALRMITGNDL RTTTFRALTL

     551  WRQAKSYIFK EAANVSQGLE NIKLAFKILV QLIKVLDTYA PAYSTLGDLY

     601  TTYYKDSGRA FKCYYKAFEL DAGDHIAANY MTEVYAKSNN WSSAVQIAER

     651  LVKAEKAKRV LQTMNWPYRV IGIGNLERQQ ESDSIEWFQS AIRVDPNDVE

     701  SWIGLGQAYL GCGRIEASIK VFEKAIELDS SHTYAKYFKS IALSEMGEFT

     751  ESIPLLKEIT GTHPEEETFQ VSLATTLVNY AYDLYYEGFL MKSISIVLDS

     801  IEVMKFIVSE LSCSVQNLWI SLSRALKLFV FVESRIDCLP VESLVEIFSS

     851  KGLIGTKDVD QIDDVELKTI LASSDEDNIT IGCQFLILAA KYAIPSENLT

     901  EYAATVRSAL WCNIGVTELT ASLVLKEAKF RDAAIFSFKR SIKYQSNTTE

     951  AWIGLGIATM DVNYRVSQHC FIKAVALAPK DIEISFNLAM LALKNNDLEF

    1001  AEQILMRSQS VAPQDSSPWL GLALILEKNG NTADSCSLFA HSFILSNGRS

    1051  KMSQLLYAKS TLQKYIGNEN DERNIQVVEE LTTVINALDQ YFKKEPENAF

    1101  ALECALLTLE RLHNFKFANN LSEKLTELLE SRFEKTQNEN ELFNFAIIRA

    1151  QFARIQLGLR NFKSAIENSE LSQGILADFS NDRVISAQIS NHICLGLSYF

    1201  FLDDFDETLA HFQELLNISK DSKNLVLLIV KVLYEVGTPD TKLIAMQELT

    1251  DYVKTQGVDL LTTLTIAAMT ILDKKKEDFR TILKELNTMN LSDMILDTYK

    1301  ESPLLIEQVE RSLFQDKAVD AGKNTWQRTA FLFPNDYKSW SKLDKRIERR

    1351  VSSNSACKIT AQKMSDIYYS SKNQRNIQRS LFLCPWNEKA VMALKECF*