Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YPR091C and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_NVJ2/YPR091C   1   MASLKVFLAVYLLGGITFLPLVLFTLYKIHLLYSNLKSASKKELDHDTAD   50
MIT_Smik_c249_22591   1   MTSLKIFFAVYLFGGVTFLPLVLYTIYKVHVLYSNFKSAKKKVLDHNKGK   50
MIT_Spar_c58_23104   1   MASLKVLLAVYLLGGFTFLPLVLFTFYKVHVLYSNLKSVSKKGLDHDAAD   50
MIT_Suva_c25_25879   1   MTSLKVFFAVYLLGGITFLPLVLFTAYKVHSLYSNFKSALEEEVDRG---   47
WashU_Sbay_Contig636.38   1   MTSLKVFFAVYLLGGITFLPLVLFTAYKVHSLYSNFKSALEEEVDRG---   47
WashU_Scas_Contig705.42   1   MTSFRTFIYIYLFGGVTFIPLVIVSLWCLNKRLESNEEKEDK--------   42
WashU_Sklu_Contig2204.1   1   MIGLKTLIAIYLFGGITFLPLLLLAFIHFTAKPKEDKRRQRP--------   42
WashU_Skud_Contig1982.10   1   MANLKVLLAVYLFGGITFLPFVLFILYEVHVLYSNLESASKKEANHDEGE   50
Symbols






* .:: :: :**:**.**:*::: . .. :



SGD_Scer_NVJ2/YPR091C   51   EIDEKTRLLARDIDPEFKARKLEEQLGVKVFNKGWITVTKQYYYHSSEVA   100
MIT_Smik_c249_22591   51   KVDEKSRLLVNGIDPDFKAGKLEEQLGVKVFNKGWVTVTKQYYYHSSEVA   100
MIT_Spar_c58_23104   51   EVDEKTRLLVHDIDPEFKAGKSEEQLGVKVFNKGWITVTKQYYYHSSEVA   100
MIT_Suva_c25_25879   48   ---EKDRLLTHGIDPDFKAGKLEELSGVKVVNKGWITLTKQYYYHSTEVA   94
WashU_Sbay_Contig636.38   48   ---EKDRLLTHGIDPDFKAGKLEELSGVKVVNKGWITLTKQYYYHSTEVA   94
WashU_Scas_Contig705.42   43   ----EDPLLVPDINPDFKAGALEEDKGVKVFKKGWITVTNQYYYHFTELA   88
WashU_Sklu_Contig2204.1   43   ---AANALLADEIEPEFKSGAIEEKKGVDVFKKGWITVTNRYFYHQTELL   89
WashU_Skud_Contig1982.10   51   QVDEKSRLLARDIDPDFKAGRLEEKLGVDVSSKGWITVTKQYYYHSSEVA   100
Symbols






**. *:*:**: ** **.* .***:*:*::*:** :*:



SGD_Scer_NVJ2/YPR091C   101   VILKNSNNNKDSDTALQEQILQRTDLKKKQRFFAVLRHGNLFLYKDDSQN   150
MIT_Smik_c249_22591   101   VILKNANNNKDSDTALQEQILERTDLKKKQNFFAVLRHGNLFLYKDDSQN   150
MIT_Spar_c58_23104   101   VILKNSNNNKDSDTALQEQILQRTDLKKKQRFFAVLRHGNLFLYKDDSQN   150
MIT_Suva_c25_25879   95   TILKTFNNNKDSDAVQQEQILQRTELKKKQRFFAVLRHGNLFLYKDDTQN   144
WashU_Sbay_Contig636.38   95   TILKTFNNNKDSDAVQQEQILQRTELKKKQRFFAVLRHGNLFLYKDDTQN   144
WashU_Scas_Contig705.42   89   NLQS------NDDNKTNENILQRSQLKKKQKFYAVLKHGNLFLYRDDSPK   132
WashU_Sklu_Contig2204.1   90   ESEN-----------TDATVPTRDKLKKKHRFFGILKHGNLFLYRDESNQ   128
WashU_Skud_Contig1982.10   101   VILKNSSN-KDSDTALQEQILQRTDLKKKQRFFAVLRHGNLFLYKDGSQN   149
Symbols






. : : * .****:.*:.:*:*******:* : :



SGD_Scer_NVJ2/YPR091C   151   ANLVHAISLQNRFITIWPRFDELGKEELPDASLFTKRTCIAIFKNDLVSI   200
MIT_Smik_c249_22591   151   ANLVHAISLQNRFVTIWPRYDETGKEELLDASLFTKRTCIAIFKNDLVSI   200
MIT_Spar_c58_23104   151   ANLVHAISLQNRFITIWPRYDELGKEELPDASLFTKRTCIAIFKNDLVSI   200
MIT_Suva_c25_25879   145   ANLVHAISLQDKFVTIWPRYDETGKTELPDASLFTKRTCIAIFKNDLVSI   194
WashU_Sbay_Contig636.38   145   ANLVHAISLQDKFVTIWPRYDETGKTELPDASLFTKRTCIAIFKNDLVSI   194
WashU_Scas_Contig705.42   133   SSILHAIALADSFVTIWPRDTTN---EMLDASLFTKRTCVALFRNNTAYF   179
WashU_Sklu_Contig2204.1   129   SSVSQVVVLKNSFVTIWPRNSED---ELLDASLFTKRTCIAILKNNVVHL   175
WashU_Skud_Contig1982.10   150   ANLVHAISLQNRFITIWPRYDEMGKEELSDASLFTKRTCIAIFKNELVSI   199
Symbols






:.: :.: * : *:***** *: **********:*:::*: . :



SGD_Scer_NVJ2/YPR091C   201   DSKNHNVILPHFDPLTSAESNNGDISTNDTTHEYQSQFHSSNQFFLYFDN   250
MIT_Smik_c249_22591   201   DSKNHNVILPHFDPLSSAESKNGDISNNDTTHEYKSQFHSSNQFFLYFDN   250
MIT_Spar_c58_23104   201   DSKNHNVILPHFDPLTSADSNNGDISTNDTTHEYQSQFHSSNQFFLYFDN   250
MIT_Suva_c25_25879   195   DSKNHNVILPHFDPLTSVESNNGDISNNDATHENQSPFHNSNQFFLYFEN   244
WashU_Sbay_Contig636.38   195   DSKNHNVILPHFDPLTSVESNNGDISNNDATHENQSPFHNSNQFFLYFEN   244
WashU_Scas_Contig705.42   180   SKKTN----------------SLQFTVTSSQEETEPSTATSNQFFLYFDN   213
WashU_Sklu_Contig2204.1   176   G---------------------------DDGNLKFREGGLMDKFFIYVDN   198
WashU_Skud_Contig1982.10   200   DSKNHNVILPHFDPLTSAESNNGDISNNDTTHEYQSQFHSSNQFFLYFDN   249
Symbols






. . . ::**:*.:*



SGD_Scer_NVJ2/YPR091C   251   NMDKEDWYYQLINASKNSNSLSTG------------LLDPNVSANAAHLK   288
MIT_Smik_c249_22591   251   NMDKEDWYYQLINASKNNNTSSAD------------LLNPSVSANAAHLN   288
MIT_Spar_c58_23104   251   NMDKEDWYYQLINASKNNNTSSTG------------LLNPSVSANAAHLK   288
MIT_Suva_c25_25879   245   NMDKEDWYYQLINTSKNNNTAPTN------------LLNPNVSANAAHLK   282
WashU_Sbay_Contig636.38   245   NMDKEDWYYQLINTSKNNNTAPTN------------LLNPNVSANAAHLK   282
WashU_Scas_Contig705.42   214   NTDKEDWYFQLINASKNINIKANNNELPSLSNIQHSILNPNITADTAHLR   263
WashU_Sklu_Contig2204.1   199   NVEKEDWYFQLINASKVAESTGDP-------------LDPNVSATTAHFR   235
WashU_Skud_Contig1982.10   250   NMDKEDWYYQLINASKSNNISSAN------------LLNPNLSANAAHLK   287
Symbols






* :*****:****:** : *:*.::* :**:.



SGD_Scer_NVJ2/YPR091C   289   TKDMLQLIQDINSTENQLTTKWLNALLGRLFLSLQQTDTLNKFIHEKICK   338
MIT_Smik_c249_22591   289   TKDMLQLIQDINSTENQLTTKWLNALLGRLFLSLQQTDTLNKFIHEKICK   338
MIT_Spar_c58_23104   289   TKDMLQLIQDINSTENQLTTKWLNALLGRLFLSLQQTDTLNKFIHEKICK   338
MIT_Suva_c25_25879   283   TKDMLQLIQDINSTENQLTTKWLNALLGRLFLSWQQTDSLNQLILEKIFK   332
WashU_Sbay_Contig636.38   283   TKDMLQLIQDINSTENQLTTKWLNALLGRLFLSWQQTDSLNQLILEKIFK   332
WashU_Scas_Contig705.42   264   THDMLYLIQTLHSTEGQLTTKWFNALIGRLFLSLQRTDTLNKALLEKVHK   313
WashU_Sklu_Contig2204.1   236   TRDMLYLIQTLNSTEGQLSTKWLNALIGRLFLSWQQTEMLSQVLREKIHK   285
WashU_Skud_Contig1982.10   288   TKDMLQLIQDINSTENQLTTKWLNALFGRIFLSLQQTDTLNEFIHEKICK   337
Symbols






*:*** *** ::***.**:***:***:**:*** *:*: *.: : **: *



SGD_Scer_NVJ2/YPR091C   339   KLNKIKTPGFLDDLVVEKVDVGDSAPLFTSPELLELSPEGSTKIAIDVQY   388
MIT_Smik_c249_22591   339   KLNKIKTPGFLDDLVVEKVDVGDSAPLFTSPELLELSPEGSTKIAIDVQY   388
MIT_Spar_c58_23104   339   KLNKIKTPGFLDDLVVEKVDVGDSAPLFTSPELLELSPEGSTKIAIDVQY   388
MIT_Suva_c25_25879   333   KLNKIKTPGFLDDLVVEKVDVGDSAPLFTSPKLLELSPDGSTKFSIDVQY   382
WashU_Sbay_Contig636.38   333   KLNKIKTPGFLDDLVVEKVDVGDSAPLFTSPKLLELSPDGSTKFSIDVQY   382
WashU_Scas_Contig705.42   314   KLNKINKPGFLDNLVVEEIDVGTSAPFITNPSLREISPEGLTKIALNLQY   363
WashU_Sklu_Contig2204.1   286   KLTKINKPGFLDDFKIENVDVGTSTPMFTHPRLEELTPEGLMKIGLNMSY   335
WashU_Skud_Contig1982.10   338   KLNKIKTPGFLDDLVVEKVDVGDSAPLFTSPELLELSPEGSTKFAIDVQY   387
Symbols






**.**:.*****:: :*::*** *:*::* * * *::*:* *:.:::.*



SGD_Scer_NVJ2/YPR091C   389   RGNLTIIIATKASINLGSRFKQREVSLQLSIKIKEFSGPLLFLIKPPPSN   438
MIT_Smik_c249_22591   389   KGNLTIIIATKANINLGSHFKQREVSLQLSIKIKEFSGPLLFLIKPPPSN   438
MIT_Spar_c58_23104   389   KGNLTIIIATKANINLGSHFKQREVSLQLSIKIKEFSGPLLFLIKPPPSN   438
MIT_Suva_c25_25879   383   RGNLTIIIATKASINLGSHFKQREVSLQLSIKVKELSGPLLFLIKPPPSN   432
WashU_Sbay_Contig636.38   383   RGNLTIIIATKASINLGSHFKQREVSLQLSIKVKELSGPLLFLIKPPPSN   432
WashU_Scas_Contig705.42   364   KGNLSVIISTKVNINLGSRFKPREVSVQLAIKVKEISGPLIVLIKPPPSN   413
WashU_Sklu_Contig2204.1   336   KGNLSLIISTKMNINLGSRFKTREVNIELAITVKEIKGPMVIMIKPPPSN   385
WashU_Skud_Contig1982.10   388   RGNLTIIIATKANINLGSHFKQREVSLQLSIKIKELSGPLLFLIKPPPSN   437
Symbols






:***::**:** .*****:** ***.::*:*.:**:.**::.:*******



SGD_Scer_NVJ2/YPR091C   439   RIWYAFRTEPIMDFEIEPIVSSSKLSYNVVTNAIKSKFAEAVKESLVVPF   488
MIT_Smik_c249_22591   439   RVWYAFRSEPIMDFEIEPIVSSSKLSYNVVTNAIKSKFAEAVKESLVVPY   488
MIT_Spar_c58_23104   439   RVWYAFRTEPIMDFEIEPIVSSSKLSYNVVTNAIKSKFAEAVKESLVVPF   488
MIT_Suva_c25_25879   433   RIWYAFQTEPIMDFEIEPIVSSSKLSYNVVTNAIKSKFAEAMKESLVVPF   482
WashU_Sbay_Contig636.38   433   RIWYAFQTEPIMDFEIEPIVSSSKLSYNVVTNAIKSKFAEAMKESLVVPF   482
WashU_Scas_Contig705.42   414   RIWYAFETEPIIDLEIEPVVSSSKLSYTMITNVIKGKFVEGIKESLVMPY   463
WashU_Sklu_Contig2204.1   386   RLWYSFEIEPHIDLDIEPVVSTRQLSYNMVTKAIKSKFQEAIKESLVMPY   435
WashU_Skud_Contig1982.10   438   RVWYAFRSEPIMDFEIEPIVSSSKLSYNVVTNAIKSKFAEAIKESLVVPF   487
Symbols






*:**:*. ** :*::***:**: :***.::*:.**.** *.:*****:*:



SGD_Scer_NVJ2/YPR091C   489   MDDIVFYPTPNEVYRGGIWEEQDP-EAAARARTAAAASDMNNTSAKEHLE   537
MIT_Smik_c249_22591   489   MDDIVFYPTPNEIYRGGIWEEQDP-ETVERARTAAAAAGTN-TSARDHLV   536
MIT_Spar_c58_23104   489   MDDIVFYPTPNEIYRGGIWEEQDP-EAVARAHTTAAASGMNNTSAREHLA   537
MIT_Suva_c25_25879   483   MDDIVFYPTPNEIYRGGIWEEHDP-EMNASVSVTAEAPGTN-TSAKEHLA   530
WashU_Sbay_Contig636.38   483   MDDIVFYPTPNEIYRGGIWEEHDP-EMNASVSVTAEAPGTN-TSAKEHLA   530
WashU_Scas_Contig705.42   464   MDDIVFYSTDDEVYRGGIWESHIVSTWNTDKHPSSPSAGISIGNNDKDNE   513
WashU_Sklu_Contig2204.1   436   MDDIVFYKTTEELYRGGIWEKNRPKHPIRQDSVSETDKRIPGAESTEEVP   485
WashU_Skud_Contig1982.10   488   MDDIVFYSTPNEIYRGGIWEEQDP-EAVVEAHATAAVPGTN-TSAKEHLA   535
Symbols






******* * :*:*******.: : . ..



SGD_Scer_NVJ2/YPR091C   538   ALQEGGMKTQSRIKKALRPE------------------------------   557
MIT_Smik_c249_22591   537   ALQEGGTKSQSRIKKVLRPE------------------------------   556
MIT_Spar_c58_23104   538   AVQEGGTKTQSRIKKALRPE------------------------------   557
MIT_Suva_c25_25879   531   AVQENGTKSHRRIKRVSRTE------------------------------   550
WashU_Sbay_Contig636.38   531   AVQENGTKSHRRIKRVSRTE------------------------------   550
WashU_Scas_Contig705.42   514   DIQDKGVDVDFERRSSLGRKDSYVRKSMA---------------------   542
WashU_Sklu_Contig2204.1   486   ENSTDDSKNGSNSIISRSTNSSIQSNDFTGLDVRSSPPWQRSTEESIISG   535
WashU_Skud_Contig1982.10   536   AVQDGRTRTQSRIKKVLRSE------------------------------   555
Symbols






. . :



SGD_Scer_NVJ2/YPR091C   558   -------------------------------RKKENLKDLVDAS-GVATK   575
MIT_Smik_c249_22591   557   -------------------------------RKKDNLKDVVDLT-GVTN-   573
MIT_Spar_c58_23104   558   -------------------------------RKKENLKDLVDVS-GVTTK   575
MIT_Suva_c25_25879   551   -------------------------------KKKEKLKGIIDTTSALAAK   569
WashU_Sbay_Contig636.38   551   -------------------------------KKKEKLKGIIDTTSALAAK   569
WashU_Scas_Contig705.42   543   --------------------SMDSSDSQFKNRAVQNIKNVLKSKTQTGHE   572
WashU_Sklu_Contig2204.1   536   LDDTIEPPTRDGNDSTIKTRTLQKVETFKTLLKTHSDNTIDSSEPYDSNG   585
WashU_Skud_Contig1982.10   556   -------------------------------RKKENLKDVVDAP-AVTTK   573
Symbols






.. : : .



SGD_Scer_NVJ2/YPR091C   576   TTTQTTVTTATNDDVSSSENSTKSRKYFKNSIKKIGRWYKDNVGNSSDTE   625
MIT_Smik_c249_22591   574   ATSQTAVATAANDDASSSENSTKSKKYFKNSIKKIGRWYKDNVGNSSDTE   623
MIT_Spar_c58_23104   576   TTAQTTVTTATNDDVSSSENSTKSRKYFKNSIKKIGRWYKDNVGNSSDTE   625
MIT_Suva_c25_25879   570   TTTQTTVTAATNDDVSSSEASTKSRKYFKNSIKKIGKWYKDNVGNPSDSE   619
WashU_Sbay_Contig636.38   570   TTTQTTVTAATNDDVSSSEASTKSRKYFKNSIKKIGKWYKDNVGNPSDSE   619
WashU_Scas_Contig705.42   573   ESEGSLKNSLDALHSDEEDDPIKPKQYIKSSIKKFGKWYSEKVSTNN---   619
WashU_Sklu_Contig2204.1   586   SSSPTLRGKRESTMSLISDEASASKKYIQTGFKKFGRWYKDTVNSSAKDL   635
WashU_Skud_Contig1982.10   574   TTTQATVTTATNDDVSSSENSTKSRKYFKNSIKKIGKWYKDNVGNSSDTE   623
Symbols






: : .: . .::*::..:**:*:**.:.*..



SGD_Scer_NVJ2/YPR091C   626   DMDEIDVQDKKNDDSADER-------------------------------   644
MIT_Smik_c249_22591   624   DMDDLDVQDKKKDDSTDEK-------------------------------   642
MIT_Spar_c58_23104   626   DMDDMDVQDKKNDDSADEK-------------------------------   644
MIT_Suva_c25_25879   620   DSEDLDIQDKKEDDSADEK-------------------------------   638
WashU_Sbay_Contig636.38   620   DSEDLDIQDKKEDDSADEK-------------------------------   638
WashU_Scas_Contig705.42   620   -------LDSDESSSASSL-------------------------------   631
WashU_Sklu_Contig2204.1   636   DVGQPDTSITHPPEMISNRRTLPKNKGRVASATHAVIASEVSGSGAAEMF   685
WashU_Skud_Contig1982.10   624   DMDYADLQDKKNDDSTEEK-------------------------------   642
Symbols






.. . ..



SGD_Scer_NVJ2/YPR091C   645   -----------ESDNPILTSNPKMISNRRPVPRRPSQ-PLNTL-------   675
MIT_Smik_c249_22591   643   -----------ESDNPTLASNPRMISNRRPVPRRPPQQPLNSS-------   674
MIT_Spar_c58_23104   645   -----------ESDNPTLTSNPKMISNRRPVPRRPSQQPLNTL-------   676
MIT_Suva_c25_25879   639   -----------ESDTPLLNSSPKMISNRRPVPRRPSQQALNSL-------   670
WashU_Sbay_Contig636.38   639   -----------ESDTPLLNSSPKMISNRRPVPRRPSQQALNSL-------   670
WashU_Scas_Contig705.42   632   -----------VTKNEKITQPPKMISNRRRVPPKPPVTPYEHQGKVSDVP   670
WashU_Sklu_Contig2204.1   686   ANRSRTRATSSESGSSSPVNNNFKFNNSAANMPSPPMRFTSELHGFPQEF   735
WashU_Skud_Contig1982.10   643   -----------ESDNPILTCSPKMISNRRPVPRRPSQQALNSA-------   674
Symbols






: . :.* *. .



SGD_Scer_NVJ2/YPR091C   676   --------SPKLEGRKEKDTENFPVPPSASNMNASKMFANKE-NRKFSVS   716
MIT_Smik_c249_22591   675   --------SPKLEDKKEKDTEVFSIPTSSPNVNASKMFANKQ-NRKISVS   715
MIT_Spar_c58_23104   677   --------SPKLEEKKVKETEIFPAPPSASNINASKMFANKE-NRKFSVS   717
MIT_Suva_c25_25879   671   --------SLDIEGKKETEAENVSAPPSSSNTNASEMFANKE-NRKFSAS   711
WashU_Sbay_Contig636.38   671   --------SLDIEGKKETEAENVSAPPSSSNTNASEMFANKE-NRKFSAS   711
WashU_Scas_Contig705.42   671   TNPSMLNGETTMTKPVPPPRTELQTPTTSPSMHATEMFASKEKDRKLSMS   720
WashU_Sklu_Contig2204.1   736   FEKDKEDGVVDKNDYPFKALDTIDPLATETPTAKAGPLDDEEQQDEFKEN   785
WashU_Skud_Contig1982.10   675   --------SPKLEGKMEKDTEAFPVPPASSKVNASEMFANKE-NRKFSVS   715
Symbols






. .: . : : .:: : ::. .



SGD_Scer_NVJ2/YPR091C   717   SNDSQNSLKNGDPHVKASKLESSQAFVKKTSQNRFNDGFFKQDLEFEEQR   766
MIT_Smik_c249_22591   716   SNDSQNSLEKGDPHNKTSKLESSQAFVKMTSPNLFNDGFFKQDLEFEEQR   765
MIT_Spar_c58_23104   718   SNDSQNSLKNGDPHAKNSKLESSQAFVKKTSPNRFNDGFFKQDLEFEEQR   767
MIT_Suva_c25_25879   712   SKDSQNSPKNGDSNKKTSKLESSQAFVKKTSPNRFNDEFFKQDMEFEDQR   761
WashU_Sbay_Contig636.38   712   SKDSQNSPKNGDSNKKTSKLESSQAFVKKTSPNRFNDEFFKQDMEFEDQR   761
WashU_Scas_Contig705.42   721   SKSTGGYESNRIPLSPES---PSYAFAKASNNRDFSGDVFNENLEDSVDE   767
WashU_Sklu_Contig2204.1   786   KSLGSLGVQENDAFERGNLHEDEHVLIQSTLRKTMAIKGERVDLQSLNRK   835
WashU_Skud_Contig1982.10   716   SNGSQNSLNS-DPHTKTQKLESSQAFVKKTPSNRFNDGFFKQDLEFEEQR   764
Symbols






.. .. . . . .: : : . : . ::: .



SGD_Scer_NVJ2/YPR091C   767   EPKL-------------------------------------   770
MIT_Smik_c249_22591   766   EPKL-------------------------------------   769
MIT_Spar_c58_23104   768   EPKL-------------------------------------   771
MIT_Suva_c25_25879   762   E----------------------------------------   762
WashU_Sbay_Contig636.38   762   E----------------------------------------   762
WashU_Scas_Contig705.42   
   -----------------------------------------   
WashU_Sklu_Contig2204.1   836   RPVPPPPVTIEEKEIHRTTISAVEEGEPATSPADVPPLPPR   876
WashU_Skud_Contig1982.10   765   EPKV-------------------------------------   768
Symbols










Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_NVJ2/YPR091C:

SGD_Scer_NVJ2/YPR091C  Length: 771  Mon Nov  7 16:51:59 2016  Type: P  Check: 6450  ..

       1  MASLKVFLAV YLLGGITFLP LVLFTLYKIH LLYSNLKSAS KKELDHDTAD

      51  EIDEKTRLLA RDIDPEFKAR KLEEQLGVKV FNKGWITVTK QYYYHSSEVA

     101  VILKNSNNNK DSDTALQEQI LQRTDLKKKQ RFFAVLRHGN LFLYKDDSQN

     151  ANLVHAISLQ NRFITIWPRF DELGKEELPD ASLFTKRTCI AIFKNDLVSI

     201  DSKNHNVILP HFDPLTSAES NNGDISTNDT THEYQSQFHS SNQFFLYFDN

     251  NMDKEDWYYQ LINASKNSNS LSTGLLDPNV SANAAHLKTK DMLQLIQDIN

     301  STENQLTTKW LNALLGRLFL SLQQTDTLNK FIHEKICKKL NKIKTPGFLD

     351  DLVVEKVDVG DSAPLFTSPE LLELSPEGST KIAIDVQYRG NLTIIIATKA

     401  SINLGSRFKQ REVSLQLSIK IKEFSGPLLF LIKPPPSNRI WYAFRTEPIM

     451  DFEIEPIVSS SKLSYNVVTN AIKSKFAEAV KESLVVPFMD DIVFYPTPNE

     501  VYRGGIWEEQ DPEAAARART AAAASDMNNT SAKEHLEALQ EGGMKTQSRI

     551  KKALRPERKK ENLKDLVDAS GVATKTTTQT TVTTATNDDV SSSENSTKSR

     601  KYFKNSIKKI GRWYKDNVGN SSDTEDMDEI DVQDKKNDDS ADERESDNPI

     651  LTSNPKMISN RRPVPRRPSQ PLNTLSPKLE GRKEKDTENF PVPPSASNMN

     701  ASKMFANKEN RKFSVSSNDS QNSLKNGDPH VKASKLESSQ AFVKKTSQNR

     751  FNDGFFKQDL EFEEQREPKL *

Protein Sequence for MIT_Smik_c249_22591:

MIT_Smik_c249_22591  Length: 770  Mon Nov  7 16:51:59 2016  Type: P  Check: 7584  ..

       1  MTSLKIFFAV YLFGGVTFLP LVLYTIYKVH VLYSNFKSAK KKVLDHNKGK

      51  KVDEKSRLLV NGIDPDFKAG KLEEQLGVKV FNKGWVTVTK QYYYHSSEVA

     101  VILKNANNNK DSDTALQEQI LERTDLKKKQ NFFAVLRHGN LFLYKDDSQN

     151  ANLVHAISLQ NRFVTIWPRY DETGKEELLD ASLFTKRTCI AIFKNDLVSI

     201  DSKNHNVILP HFDPLSSAES KNGDISNNDT THEYKSQFHS SNQFFLYFDN

     251  NMDKEDWYYQ LINASKNNNT SSADLLNPSV SANAAHLNTK DMLQLIQDIN

     301  STENQLTTKW LNALLGRLFL SLQQTDTLNK FIHEKICKKL NKIKTPGFLD

     351  DLVVEKVDVG DSAPLFTSPE LLELSPEGST KIAIDVQYKG NLTIIIATKA

     401  NINLGSHFKQ REVSLQLSIK IKEFSGPLLF LIKPPPSNRV WYAFRSEPIM

     451  DFEIEPIVSS SKLSYNVVTN AIKSKFAEAV KESLVVPYMD DIVFYPTPNE

     501  IYRGGIWEEQ DPETVERART AAAAAGTNTS ARDHLVALQE GGTKSQSRIK

     551  KVLRPERKKD NLKDVVDLTG VTNATSQTAV ATAANDDASS SENSTKSKKY

     601  FKNSIKKIGR WYKDNVGNSS DTEDMDDLDV QDKKKDDSTD EKESDNPTLA

     651  SNPRMISNRR PVPRRPPQQP LNSSSPKLED KKEKDTEVFS IPTSSPNVNA

     701  SKMFANKQNR KISVSSNDSQ NSLEKGDPHN KTSKLESSQA FVKMTSPNLF

     751  NDGFFKQDLE FEEQREPKL*

Protein Sequence for MIT_Spar_c58_23104:

MIT_Spar_c58_23104  Length: 772  Mon Nov  7 16:51:59 2016  Type: P  Check: 3436  ..

       1  MASLKVLLAV YLLGGFTFLP LVLFTFYKVH VLYSNLKSVS KKGLDHDAAD

      51  EVDEKTRLLV HDIDPEFKAG KSEEQLGVKV FNKGWITVTK QYYYHSSEVA

     101  VILKNSNNNK DSDTALQEQI LQRTDLKKKQ RFFAVLRHGN LFLYKDDSQN

     151  ANLVHAISLQ NRFITIWPRY DELGKEELPD ASLFTKRTCI AIFKNDLVSI

     201  DSKNHNVILP HFDPLTSADS NNGDISTNDT THEYQSQFHS SNQFFLYFDN

     251  NMDKEDWYYQ LINASKNNNT SSTGLLNPSV SANAAHLKTK DMLQLIQDIN

     301  STENQLTTKW LNALLGRLFL SLQQTDTLNK FIHEKICKKL NKIKTPGFLD

     351  DLVVEKVDVG DSAPLFTSPE LLELSPEGST KIAIDVQYKG NLTIIIATKA

     401  NINLGSHFKQ REVSLQLSIK IKEFSGPLLF LIKPPPSNRV WYAFRTEPIM

     451  DFEIEPIVSS SKLSYNVVTN AIKSKFAEAV KESLVVPFMD DIVFYPTPNE

     501  IYRGGIWEEQ DPEAVARAHT TAAASGMNNT SAREHLAAVQ EGGTKTQSRI

     551  KKALRPERKK ENLKDLVDVS GVTTKTTAQT TVTTATNDDV SSSENSTKSR

     601  KYFKNSIKKI GRWYKDNVGN SSDTEDMDDM DVQDKKNDDS ADEKESDNPT

     651  LTSNPKMISN RRPVPRRPSQ QPLNTLSPKL EEKKVKETEI FPAPPSASNI

     701  NASKMFANKE NRKFSVSSND SQNSLKNGDP HAKNSKLESS QAFVKKTSPN

     751  RFNDGFFKQD LEFEEQREPK L*

Protein Sequence for MIT_Suva_c25_25879:

MIT_Suva_c25_25879  Length: 763  Mon Nov  7 16:51:59 2016  Type: P  Check: 9274  ..

       1  MTSLKVFFAV YLLGGITFLP LVLFTAYKVH SLYSNFKSAL EEEVDRGEKD

      51  RLLTHGIDPD FKAGKLEELS GVKVVNKGWI TLTKQYYYHS TEVATILKTF

     101  NNNKDSDAVQ QEQILQRTEL KKKQRFFAVL RHGNLFLYKD DTQNANLVHA

     151  ISLQDKFVTI WPRYDETGKT ELPDASLFTK RTCIAIFKND LVSIDSKNHN

     201  VILPHFDPLT SVESNNGDIS NNDATHENQS PFHNSNQFFL YFENNMDKED

     251  WYYQLINTSK NNNTAPTNLL NPNVSANAAH LKTKDMLQLI QDINSTENQL

     301  TTKWLNALLG RLFLSWQQTD SLNQLILEKI FKKLNKIKTP GFLDDLVVEK

     351  VDVGDSAPLF TSPKLLELSP DGSTKFSIDV QYRGNLTIII ATKASINLGS

     401  HFKQREVSLQ LSIKVKELSG PLLFLIKPPP SNRIWYAFQT EPIMDFEIEP

     451  IVSSSKLSYN VVTNAIKSKF AEAMKESLVV PFMDDIVFYP TPNEIYRGGI

     501  WEEHDPEMNA SVSVTAEAPG TNTSAKEHLA AVQENGTKSH RRIKRVSRTE

     551  KKKEKLKGII DTTSALAAKT TTQTTVTAAT NDDVSSSEAS TKSRKYFKNS

     601  IKKIGKWYKD NVGNPSDSED SEDLDIQDKK EDDSADEKES DTPLLNSSPK

     651  MISNRRPVPR RPSQQALNSL SLDIEGKKET EAENVSAPPS SSNTNASEMF

     701  ANKENRKFSA SSKDSQNSPK NGDSNKKTSK LESSQAFVKK TSPNRFNDEF

     751  FKQDMEFEDQ RE*

Protein Sequence for WashU_Sbay_Contig636.38:

WashU_Sbay_Contig636.38  Length: 763  Mon Nov  7 16:51:59 2016  Type: P  Check: 9274  ..

       1  MTSLKVFFAV YLLGGITFLP LVLFTAYKVH SLYSNFKSAL EEEVDRGEKD

      51  RLLTHGIDPD FKAGKLEELS GVKVVNKGWI TLTKQYYYHS TEVATILKTF

     101  NNNKDSDAVQ QEQILQRTEL KKKQRFFAVL RHGNLFLYKD DTQNANLVHA

     151  ISLQDKFVTI WPRYDETGKT ELPDASLFTK RTCIAIFKND LVSIDSKNHN

     201  VILPHFDPLT SVESNNGDIS NNDATHENQS PFHNSNQFFL YFENNMDKED

     251  WYYQLINTSK NNNTAPTNLL NPNVSANAAH LKTKDMLQLI QDINSTENQL

     301  TTKWLNALLG RLFLSWQQTD SLNQLILEKI FKKLNKIKTP GFLDDLVVEK

     351  VDVGDSAPLF TSPKLLELSP DGSTKFSIDV QYRGNLTIII ATKASINLGS

     401  HFKQREVSLQ LSIKVKELSG PLLFLIKPPP SNRIWYAFQT EPIMDFEIEP

     451  IVSSSKLSYN VVTNAIKSKF AEAMKESLVV PFMDDIVFYP TPNEIYRGGI

     501  WEEHDPEMNA SVSVTAEAPG TNTSAKEHLA AVQENGTKSH RRIKRVSRTE

     551  KKKEKLKGII DTTSALAAKT TTQTTVTAAT NDDVSSSEAS TKSRKYFKNS

     601  IKKIGKWYKD NVGNPSDSED SEDLDIQDKK EDDSADEKES DTPLLNSSPK

     651  MISNRRPVPR RPSQQALNSL SLDIEGKKET EAENVSAPPS SSNTNASEMF

     701  ANKENRKFSA SSKDSQNSPK NGDSNKKTSK LESSQAFVKK TSPNRFNDEF

     751  FKQDMEFEDQ RE*

Protein Sequence for WashU_Scas_Contig705.42:

WashU_Scas_Contig705.42  Length: 768  Mon Nov  7 16:51:59 2016  Type: P  Check: 3192  ..

       1  MTSFRTFIYI YLFGGVTFIP LVIVSLWCLN KRLESNEEKE DKEDPLLVPD

      51  INPDFKAGAL EEDKGVKVFK KGWITVTNQY YYHFTELANL QSNDDNKTNE

     101  NILQRSQLKK KQKFYAVLKH GNLFLYRDDS PKSSILHAIA LADSFVTIWP

     151  RDTTNEMLDA SLFTKRTCVA LFRNNTAYFS KKTNSLQFTV TSSQEETEPS

     201  TATSNQFFLY FDNNTDKEDW YFQLINASKN INIKANNNEL PSLSNIQHSI

     251  LNPNITADTA HLRTHDMLYL IQTLHSTEGQ LTTKWFNALI GRLFLSLQRT

     301  DTLNKALLEK VHKKLNKINK PGFLDNLVVE EIDVGTSAPF ITNPSLREIS

     351  PEGLTKIALN LQYKGNLSVI ISTKVNINLG SRFKPREVSV QLAIKVKEIS

     401  GPLIVLIKPP PSNRIWYAFE TEPIIDLEIE PVVSSSKLSY TMITNVIKGK

     451  FVEGIKESLV MPYMDDIVFY STDDEVYRGG IWESHIVSTW NTDKHPSSPS

     501  AGISIGNNDK DNEDIQDKGV DVDFERRSSL GRKDSYVRKS MASMDSSDSQ

     551  FKNRAVQNIK NVLKSKTQTG HEESEGSLKN SLDALHSDEE DDPIKPKQYI

     601  KSSIKKFGKW YSEKVSTNNL DSDESSSASS LVTKNEKITQ PPKMISNRRR

     651  VPPKPPVTPY EHQGKVSDVP TNPSMLNGET TMTKPVPPPR TELQTPTTSP

     701  SMHATEMFAS KEKDRKLSMS SKSTGGYESN RIPLSPESPS YAFAKASNNR

     751  DFSGDVFNEN LEDSVDE*

Protein Sequence for WashU_Sklu_Contig2204.1:

WashU_Sklu_Contig2204.1  Length: 877  Mon Nov  7 16:51:59 2016  Type: P  Check: 1446  ..

       1  MIGLKTLIAI YLFGGITFLP LLLLAFIHFT AKPKEDKRRQ RPAANALLAD

      51  EIEPEFKSGA IEEKKGVDVF KKGWITVTNR YFYHQTELLE SENTDATVPT

     101  RDKLKKKHRF FGILKHGNLF LYRDESNQSS VSQVVVLKNS FVTIWPRNSE

     151  DELLDASLFT KRTCIAILKN NVVHLGDDGN LKFREGGLMD KFFIYVDNNV

     201  EKEDWYFQLI NASKVAESTG DPLDPNVSAT TAHFRTRDML YLIQTLNSTE

     251  GQLSTKWLNA LIGRLFLSWQ QTEMLSQVLR EKIHKKLTKI NKPGFLDDFK

     301  IENVDVGTST PMFTHPRLEE LTPEGLMKIG LNMSYKGNLS LIISTKMNIN

     351  LGSRFKTREV NIELAITVKE IKGPMVIMIK PPPSNRLWYS FEIEPHIDLD

     401  IEPVVSTRQL SYNMVTKAIK SKFQEAIKES LVMPYMDDIV FYKTTEELYR

     451  GGIWEKNRPK HPIRQDSVSE TDKRIPGAES TEEVPENSTD DSKNGSNSII

     501  SRSTNSSIQS NDFTGLDVRS SPPWQRSTEE SIISGLDDTI EPPTRDGNDS

     551  TIKTRTLQKV ETFKTLLKTH SDNTIDSSEP YDSNGSSSPT LRGKRESTMS

     601  LISDEASASK KYIQTGFKKF GRWYKDTVNS SAKDLDVGQP DTSITHPPEM

     651  ISNRRTLPKN KGRVASATHA VIASEVSGSG AAEMFANRSR TRATSSESGS

     701  SSPVNNNFKF NNSAANMPSP PMRFTSELHG FPQEFFEKDK EDGVVDKNDY

     751  PFKALDTIDP LATETPTAKA GPLDDEEQQD EFKENKSLGS LGVQENDAFE

     801  RGNLHEDEHV LIQSTLRKTM AIKGERVDLQ SLNRKRPVPP PPVTIEEKEI

     851  HRTTISAVEE GEPATSPADV PPLPPR*

Protein Sequence for WashU_Skud_Contig1982.10:

WashU_Skud_Contig1982.10  Length: 769  Mon Nov  7 16:51:59 2016  Type: P  Check: 1163  ..

       1  MANLKVLLAV YLFGGITFLP FVLFILYEVH VLYSNLESAS KKEANHDEGE

      51  QVDEKSRLLA RDIDPDFKAG RLEEKLGVDV SSKGWITVTK QYYYHSSEVA

     101  VILKNSSNKD SDTALQEQIL QRTDLKKKQR FFAVLRHGNL FLYKDGSQNA

     151  NLVHAISLQN RFITIWPRYD EMGKEELSDA SLFTKRTCIA IFKNELVSID

     201  SKNHNVILPH FDPLTSAESN NGDISNNDTT HEYQSQFHSS NQFFLYFDNN

     251  MDKEDWYYQL INASKSNNIS SANLLNPNLS ANAAHLKTKD MLQLIQDINS

     301  TENQLTTKWL NALFGRIFLS LQQTDTLNEF IHEKICKKLN KIKTPGFLDD

     351  LVVEKVDVGD SAPLFTSPEL LELSPEGSTK FAIDVQYRGN LTIIIATKAN

     401  INLGSHFKQR EVSLQLSIKI KELSGPLLFL IKPPPSNRVW YAFRSEPIMD

     451  FEIEPIVSSS KLSYNVVTNA IKSKFAEAIK ESLVVPFMDD IVFYSTPNEI

     501  YRGGIWEEQD PEAVVEAHAT AAVPGTNTSA KEHLAAVQDG RTRTQSRIKK

     551  VLRSERKKEN LKDVVDAPAV TTKTTTQATV TTATNDDVSS SENSTKSRKY

     601  FKNSIKKIGK WYKDNVGNSS DTEDMDYADL QDKKNDDSTE EKESDNPILT

     651  CSPKMISNRR PVPRRPSQQA LNSASPKLEG KMEKDTEAFP VPPASSKVNA

     701  SEMFANKENR KFSVSSNGSQ NSLNSDPHTK TQKLESSQAF VKKTPSNRFN

     751  DGFFKQDLEF EEQREPKV*