Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YPL227C and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_ALG5/YPL227C   1   ------MRALRFLIENRNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEE   44
MIT_Smik_c11_21417   1   ------MVALRFLIENKNTVCFTLLVALVLSLYLLVYLFSHNPRPSYPEE   44
MIT_Spar_c381_22007   1   ------MRTLTFLIENKNTVCFTLLVAIALSLYLLVYLFSHTPRPPYPEE   44
MIT_Suva_c904_24522   1   ------MIELRFLVDNKNTVCFTLFVALVLSVYLLIYLFSHTPRPPYPEE   44
WashU_Sbay_Contig477.6   1   ------MIELRFLVDNKNTVCFTLFVALVLSVYLLIYLFSHTPRPPYPEE   44
WashU_Scas_Contig532.9   1   MFDSIVNGLSAWQVVDKQNLAATTIIGFACALYLIIYLLSHKPRQPLPEE   50
WashU_Sklu_Contig2403.7   1   ---MLQTYVDKLRALDLNVLFVTVLLAAAASLYIIVYLLSHSPRKPFPEE   47
WashU_Skud_Contig1934.7   1   ------MVALEFLIENKNTVCFTLLVALVLSLYLLVYLFSHTPRPPYPEE   44
WashU_Smik_Contig2764.3   1   ------MVALRFLIENKNTVCFTLLVALVLSLYLLVYLFSHNPRPSYPEE   44
Symbols






: : : * ::. . ::*:::**:**.** . ***



SGD_Scer_ALG5/YPL227C   45   LKYIAIDEKGHEVSRALPNLNEHQ-DDEE--IFLSVVIPSYNETGRILLM   91
MIT_Smik_c11_21417   45   LKYTAIDDNGVEITRALPNLGELQ-GDEDQKIFLSVVIPSYNETARILLM   93
MIT_Spar_c381_22007   45   LKYTAIDENGLEISRALPNLSEHQ-DDEE--IFLSVVIPSYNETGRILLM   91
MIT_Suva_c904_24522   45   LQYTAINENGVEVTRALPTLGEDQKNGDDEEIILSVVIPSYNETGRILLM   94
WashU_Sbay_Contig477.6   45   LQYTAINENGVEVTRALPTLGEDQKNGDDEEIILSVVIPSYNETGRILLM   94
WashU_Scas_Contig532.9   51   LQYQTINASGKIITRTLPTLMEMKEKKLDSDVILSVVIPSYNETARIKSM   100
WashU_Sklu_Contig2403.7   48   LKYLTNDGKGGTITGDLPDTVLEK--KNLDGIELSVVVPSFNETGRILVM   95
WashU_Skud_Contig1934.7   45   LKYTAIDENGLKITRALPNLGEHQ-DDEDEEIFLSVIIPSYNETGRILLM   93
WashU_Smik_Contig2764.3   45   LKYTAIDDNGVEITRALPNLGELQ-GDEDQKIFLSVVIPSYNETARILLM   93
Symbols






*:* : : .* :: ** : : ***::**:***.** *



SGD_Scer_ALG5/YPL227C   92   LTDAISFLKEKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRI   141
MIT_Smik_c11_21417   94   LTDAINFLKKKYGTRWEIVIVDDGSTDNTTQYCLKICREQFKLNYEQFRI   143
MIT_Spar_c381_22007   92   LTDAINFLKGKYGSRWEIVIVDDGSTDNTTQYCLKICREQFKLNYKQFRV   141
MIT_Suva_c904_24522   95   LTDAIKFLKEKYGSKWEIVIVDDGSTDNTTQYCLKICKEQFQLDYRQFRI   144
WashU_Sbay_Contig477.6   95   LTDAIKFLKEKYGSKWEIVIVDDGSTDNTTQYCLKICKEQFQLDYRQFRI   144
WashU_Scas_Contig532.9   101   LSESIKYLDESIHKRWEILIVDDGSSDGTSEYCLKLAHEKFHLHNGELRV   150
WashU_Sklu_Contig2403.7   96   LSEAIEYLEKELPGKWEIIIVDDGSRDGTSEYCLNLADEKFGLKPNQLRV   145
WashU_Skud_Contig1934.7   94   LTDAINFLKAKYGSKWEIVIVDDGSTDNTTEYCLKICKETFKLDYRQFRI   143
WashU_Smik_Contig2764.3   94   LTDAINFLKKKYGTRWEIVIVDDGSTDNTTQYCLKICREQFKLNYEQFRI   143
Symbols






*:::*.:*. . :***:****** *.*::***::. * * *. ::*:



SGD_Scer_ALG5/YPL227C   142   IKFSQNRGKGGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDAISKIE   191
MIT_Smik_c11_21417   144   IKLSENRGKGGAVRQGFLHIRGRYGLFADADGASKFSDVEKLVEAIKTIE   193
MIT_Spar_c381_22007   142   IKFSQNRGKGGAVRQGFLHIRGKYGLFADADGASKFSDVDKLIEAIRTIE   191
MIT_Suva_c904_24522   145   IKFSQNRGKGGAVRQGFLHIRGKYGLFADADGASKFSDVAKLIEAIKTFE   194
WashU_Sbay_Contig477.6   145   IKFSQNRGKGGAVRQGFLHIRGKYGLFADADGASKFSDVAKLIEAIKTFE   194
WashU_Scas_Contig532.9   151   LKFFQNRGKGGAVREGMLHVRGKYTLFADADGASKFSDVEKLMASVQNME   200
WashU_Sklu_Contig2403.7   146   VKLAKNRGKGGAVRHGLLHIRGKYGLFADADGASKFSDVGRMLDLIEKEE   195
WashU_Skud_Contig1934.7   144   IKFSQNRGKGGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIETIKTFE   193
WashU_Smik_Contig2764.3   144   IKLSENRGKGGAVRQGFLHIRGKYGLFADADGASKFSDVEKLVEAIKTIE   193
Symbols






:*: :*********.*:**:**:* ************** ::: : . *



SGD_Scer_ALG5/YPL227C   192   TSSTDLKTTKPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGI   241
MIT_Smik_c11_21417   194   TSDTDANAIKPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGI   243
MIT_Spar_c381_22007   192   ASSTDVKTIKPAVAIGSRAHMVNTEAVIKRSMVRNCLMYGFHTLVFIFGI   241
MIT_Suva_c904_24522   195   TSGTIGKTVKPVVAIGSRAHMVNTEAVIKRSMIRNCLMVWFPHLSIHIWY   244
WashU_Sbay_Contig477.6   195   TSGTIGKTVKPVVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGI   244
WashU_Scas_Contig532.9   201   R-IKEGTNTYPAIALGSRAHMVNTEAVIKRSLLRNCLMYGFHTLVYIFGI   249
WashU_Sklu_Contig2403.7   196   RANPNG----SAIAIGSRAHMVNTDAVVKRSFIRNFLMYGLHTLVFIFGI   241
WashU_Skud_Contig1934.7   194   TSGIDVKTIKPAVVIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGI   243
WashU_Smik_Contig2764.3   194   TSDTDANAIKPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGI   243
Symbols






..:.:*********:**:***::** ** : * :



SGD_Scer_ALG5/YPL227C   242   RSIKDTQCGFKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEI   291
MIT_Smik_c11_21417   244   RSIKDTQCGFKLFNRAAILRIFPYLHTEGWIFDVEILILAIRKRIQIKEI   293
MIT_Spar_c381_22007   242   RSIKDTQCGFKLFNRAAILRIFPYLHTEGWIFDVEILILAIRKRIQIKEI   291
MIT_Suva_c904_24522   245   QVY-----------------------------------------------   247
WashU_Sbay_Contig477.6   245   RSIKDTQCGFKLFNKPAILEIFPYLHTEGWIFDVEILILAIRKRIRIEEI   294
WashU_Scas_Contig532.9   250   HSIKDTQCGFKLFNREAIEQIFPYLHTEGWIFDVEILILAMRKNIAFKEI   299
WashU_Sklu_Contig2403.7   242   RSIKDTQCGFKLFNKSAVSEIFPHLHTEGWIFDVEILILGIRKKIPIEEV   291
WashU_Skud_Contig1934.7   244   RSIKDTQCGFKLFNKPAILNIFPYLHTEGWIFDVEILILAIRKRIQIKEI   293
WashU_Smik_Contig2764.3   244   RSIKDTQCGFKLFNRAAILRIFPYLHTEGWIFDVEILILAIRKRIQIKEI   293
Symbols






:



SGD_Scer_ALG5/YPL227C   292   PISWHEVDGSKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC----   334
MIT_Smik_c11_21417   294   PISWHEVDGSKMALAVDSIKMAKDLVVIRMAYLLGIYRDNKKC----   336
MIT_Spar_c381_22007   292   PISWHEVDGSKMALAIDSIKMAKDLVVIRMAYLLGIYRDNKKC----   334
MIT_Suva_c904_24522   
   -----------------------------------------------   
WashU_Sbay_Contig477.6   295   PISWHEVDGSKMALAVDSIKMAKDLVVIRMAYLLGIYKDNRKC----   337
WashU_Scas_Contig532.9   300   PISWHEVSGSKMDLAIDSIMMAKDLVVIRMAYLFGIYQDTRVVTKLD   346
WashU_Sklu_Contig2403.7   292   AISWHEVDGSKMDLARDSVNMAKDLVVIRLAYILGIYSDRVAC----   334
WashU_Skud_Contig1934.7   294   PISWHEVDGSKMALAIDSIKMAKDLVVIRMAYLLGIYRDDKKS----   336
WashU_Smik_Contig2764.3   294   PISWHEVDGSKMALAVDSIKMAKDLVVIRMAYLLGIYRDNKKC----   336
Symbols










Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_ALG5/YPL227C:

SGD_Scer_ALG5/YPL227C  Length: 335  Mon Nov  7 16:48:52 2016  Type: P  Check: 860  ..

       1  MRALRFLIEN RNTVFFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYIAI

      51  DEKGHEVSRA LPNLNEHQDD EEIFLSVVIP SYNETGRILL MLTDAISFLK

     101  EKYGSRWEIV IVDDGSTDNT TQYCLKICKE QFKLNYEQFR IIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDV EKLIDAISKI ETSSTDLKTT

     201  KPAVAIGSRA HMVNTEAVIK RSMIRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL KIFPYLHTEG WIFDVEILIL AIRKRIQIEE IPISWHEVDG

     301  SKMALAIDSI KMAKDLVIIR MAYLLGIYRD NKKC*

Protein Sequence for MIT_Smik_c11_21417:

MIT_Smik_c11_21417  Length: 337  Mon Nov  7 16:48:52 2016  Type: P  Check: 1151  ..

       1  MVALRFLIEN KNTVCFTLLV ALVLSLYLLV YLFSHNPRPS YPEELKYTAI

      51  DDNGVEITRA LPNLGELQGD EDQKIFLSVV IPSYNETARI LLMLTDAINF

     101  LKKKYGTRWE IVIVDDGSTD NTTQYCLKIC REQFKLNYEQ FRIIKLSENR

     151  GKGGAVRQGF LHIRGRYGLF ADADGASKFS DVEKLVEAIK TIETSDTDAN

     201  AIKPAVAIGS RAHMVNTEAV IKRSMIRNCL MYGFHTLVFI FGIRSIKDTQ

     251  CGFKLFNRAA ILRIFPYLHT EGWIFDVEIL ILAIRKRIQI KEIPISWHEV

     301  DGSKMALAVD SIKMAKDLVV IRMAYLLGIY RDNKKC*

Protein Sequence for MIT_Spar_c381_22007:

MIT_Spar_c381_22007  Length: 335  Mon Nov  7 16:48:52 2016  Type: P  Check: 2008  ..

       1  MRTLTFLIEN KNTVCFTLLV AIALSLYLLV YLFSHTPRPP YPEELKYTAI

      51  DENGLEISRA LPNLSEHQDD EEIFLSVVIP SYNETGRILL MLTDAINFLK

     101  GKYGSRWEIV IVDDGSTDNT TQYCLKICRE QFKLNYKQFR VIKFSQNRGK

     151  GGAVRQGFLH IRGKYGLFAD ADGASKFSDV DKLIEAIRTI EASSTDVKTI

     201  KPAVAIGSRA HMVNTEAVIK RSMVRNCLMY GFHTLVFIFG IRSIKDTQCG

     251  FKLFNRAAIL RIFPYLHTEG WIFDVEILIL AIRKRIQIKE IPISWHEVDG

     301  SKMALAIDSI KMAKDLVVIR MAYLLGIYRD NKKC*

Protein Sequence for MIT_Suva_c904_24522:

MIT_Suva_c904_24522  Length: 248  Mon Nov  7 16:48:52 2016  Type: P  Check: 3139  ..

       1  MIELRFLVDN KNTVCFTLFV ALVLSVYLLI YLFSHTPRPP YPEELQYTAI

      51  NENGVEVTRA LPTLGEDQKN GDDEEIILSV VIPSYNETGR ILLMLTDAIK

     101  FLKEKYGSKW EIVIVDDGST DNTTQYCLKI CKEQFQLDYR QFRIIKFSQN

     151  RGKGGAVRQG FLHIRGKYGL FADADGASKF SDVAKLIEAI KTFETSGTIG

     201  KTVKPVVAIG SRAHMVNTEA VIKRSMIRNC LMVWFPHLSI HIWYQVY*


Protein Sequence for WashU_Sbay_Contig477.6:

WashU_Sbay_Contig477.6  Length: 338  Mon Nov  7 16:48:52 2016  Type: P  Check: 6769  ..

       1  MIELRFLVDN KNTVCFTLFV ALVLSVYLLI YLFSHTPRPP YPEELQYTAI

      51  NENGVEVTRA LPTLGEDQKN GDDEEIILSV VIPSYNETGR ILLMLTDAIK

     101  FLKEKYGSKW EIVIVDDGST DNTTQYCLKI CKEQFQLDYR QFRIIKFSQN

     151  RGKGGAVRQG FLHIRGKYGL FADADGASKF SDVAKLIEAI KTFETSGTIG

     201  KTVKPVVAIG SRAHMVNTEA VIKRSMIRNC LMYGFHTLVF IFGIRSIKDT

     251  QCGFKLFNKP AILEIFPYLH TEGWIFDVEI LILAIRKRIR IEEIPISWHE

     301  VDGSKMALAV DSIKMAKDLV VIRMAYLLGI YKDNRKC*

Protein Sequence for WashU_Scas_Contig532.9:

WashU_Scas_Contig532.9  Length: 347  Mon Nov  7 16:48:52 2016  Type: P  Check: 6602  ..

       1  MFDSIVNGLS AWQVVDKQNL AATTIIGFAC ALYLIIYLLS HKPRQPLPEE

      51  LQYQTINASG KIITRTLPTL MEMKEKKLDS DVILSVVIPS YNETARIKSM

     101  LSESIKYLDE SIHKRWEILI VDDGSSDGTS EYCLKLAHEK FHLHNGELRV

     151  LKFFQNRGKG GAVREGMLHV RGKYTLFADA DGASKFSDVE KLMASVQNME

     201  RIKEGTNTYP AIALGSRAHM VNTEAVIKRS LLRNCLMYGF HTLVYIFGIH

     251  SIKDTQCGFK LFNREAIEQI FPYLHTEGWI FDVEILILAM RKNIAFKEIP

     301  ISWHEVSGSK MDLAIDSIMM AKDLVVIRMA YLFGIYQDTR VVTKLD*


Protein Sequence for WashU_Sklu_Contig2403.7:

WashU_Sklu_Contig2403.7  Length: 335  Mon Nov  7 16:48:52 2016  Type: P  Check: 1358  ..

       1  MLQTYVDKLR ALDLNVLFVT VLLAAAASLY IIVYLLSHSP RKPFPEELKY

      51  LTNDGKGGTI TGDLPDTVLE KKNLDGIELS VVVPSFNETG RILVMLSEAI

     101  EYLEKELPGK WEIIIVDDGS RDGTSEYCLN LADEKFGLKP NQLRVVKLAK

     151  NRGKGGAVRH GLLHIRGKYG LFADADGASK FSDVGRMLDL IEKEERANPN

     201  GSAIAIGSRA HMVNTDAVVK RSFIRNFLMY GLHTLVFIFG IRSIKDTQCG

     251  FKLFNKSAVS EIFPHLHTEG WIFDVEILIL GIRKKIPIEE VAISWHEVDG

     301  SKMDLARDSV NMAKDLVVIR LAYILGIYSD RVAC*

Protein Sequence for WashU_Skud_Contig1934.7:

WashU_Skud_Contig1934.7  Length: 337  Mon Nov  7 16:48:52 2016  Type: P  Check: 1255  ..

       1  MVALEFLIEN KNTVCFTLLV ALVLSLYLLV YLFSHTPRPP YPEELKYTAI

      51  DENGLKITRA LPNLGEHQDD EDEEIFLSVI IPSYNETGRI LLMLTDAINF

     101  LKAKYGSKWE IVIVDDGSTD NTTEYCLKIC KETFKLDYRQ FRIIKFSQNR

     151  GKGGAVRQGF LHIRGKYGLF ADADGASKFS DVEKLIETIK TFETSGIDVK

     201  TIKPAVVIGS RAHMVNTEAV IKRSMIRNCL MYGFHTLVFI FGIRSIKDTQ

     251  CGFKLFNKPA ILNIFPYLHT EGWIFDVEIL ILAIRKRIQI KEIPISWHEV

     301  DGSKMALAID SIKMAKDLVV IRMAYLLGIY RDDKKS*

Protein Sequence for WashU_Smik_Contig2764.3:

WashU_Smik_Contig2764.3  Length: 337  Mon Nov  7 16:48:52 2016  Type: P  Check: 787  ..

       1  MVALRFLIEN KNTVCFTLLV ALVLSLYLLV YLFSHNPRPS YPEELKYTAI

      51  DDNGVEITRA LPNLGELQGD EDQKIFLSVV IPSYNETARI LLMLTDAINF

     101  LKKKYGTRWE IVIVDDGSTD NTTQYCLKIC REQFKLNYEQ FRIIKLSENR

     151  GKGGAVRQGF LHIRGKYGLF ADADGASKFS DVEKLVEAIK TIETSDTDAN

     201  AIKPAVAIGS RAHMVNTEAV IKRSMIRNCL MYGFHTLVFI FGIRSIKDTQ

     251  CGFKLFNRAA ILRIFPYLHT EGWIFDVEIL ILAIRKRIQI KEIPISWHEV

     301  DGSKMALAVD SIKMAKDLVV IRMAYLLGIY RDNKKC*