Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YPL180W and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_TCO89/YPL180W   1   MVHRGRTLKSDTDVTSLNASTVSHQSKPFRQFSTRSRAKSNASFKGLRRV   50
MIT_Smik_c17_21587   1   MVHRGRTLKSDAEIASPIASTVSHQSKPFRQFSTRSRAKSNASFKGLRRV   50
MIT_Spar_c381_22193   1   MVHRGRTLKSDTDITSLNAPTVSHQSKPFRQFSTRSRAKSNASFKGLRRV   50
MIT_Suva_c559_24639   1   MVHRGRTLKSDTDTTSPNGSAVPHQSKPFRQFSTRSRAKSNASFKGLRRV   50
WashU_Sbay_Contig658.45   1   MVHRGRTLKSDTDTTSPNGSAVPHQSKPFRQFSTRSRAKSNASFKGLRRV   50
WashU_Scas_Contig465.3   1   MVHRGRSLRSETEPHTG-----SSNVKQFRQFTTRSRAKSTASFKGLRRV   45
Symbols






******:*:*::: : . : * ****:*******.*********



SGD_Scer_TCO89/YPL180W   51   LTHDGTLDNDYFNKHNVSQKCKSSDALFRKRTISGLNMTALTRVKSNQGK   100
MIT_Smik_c17_21587   51   LTHDGTLDNDYFNKHNISQKCKSTDALFRKRTISGLNMTALTRVKSNQGK   100
MIT_Spar_c381_22193   51   LTHDGTLDSDYFNKHSISQKCKSSDALFRKRTISGLNMTALTRVRSNQGK   100
MIT_Suva_c559_24639   51   LTHDGTLDSDYFNKHNISQKCKSSDALFRKRTISGLNMTALTRVRSNQGK   100
WashU_Sbay_Contig658.45   51   LTHDGTLDSDYFNKHNISQKCKSSDALFRKRTISGLNMTALTRVRSNQGK   100
WashU_Scas_Contig465.3   46   LTHDGTFDEGHG-RHSSFQKCKSSDALSRKRVISGLSMTTLTRVKSNPG-   93
Symbols






******:*..: :*. *****:*** ***.****.**:****:** *



SGD_Scer_TCO89/YPL180W   101   RSASFHSPVHNTLLSPKNSSHSNTGTAGFGLKPRRSKSTQSVLSLRDAQE   150
MIT_Smik_c17_21587   101   RSASFHSPVHNTLLSPKSSSHSNSGGGGFSLKPRRSKSTQSVLSLRDAQA   150
MIT_Spar_c381_22193   101   RSASFHSPVHNTLLSPKNSSHSNSGSAGFGLKPRRSKSTQSVLSLRDAQE   150
MIT_Suva_c559_24639   101   RSASFHSPVHNTLLSPKSSSHSNSASSGFGLKPRRSKSTQSVLSLRDAQE   150
WashU_Sbay_Contig658.45   101   RSASFHSPVHNTLLSPKSSSHSNSASSGFGLKPRRSKSTQSVLSLRDAQE   150
WashU_Scas_Contig465.3   94   -----------SVVSPTRDVIGNFG----GIKPTRSKSTHSVLNLQEIAE   128
Symbols






:::**. . .* . .:** *****:***.*::



SGD_Scer_TCO89/YPL180W   151   SKKSESTTDEEVECFSEDNIEDGKVNNDKVIAEHVMPEEKKNVQQLNQNE   200
MIT_Smik_c17_21587   151   SNKNESTTDEEVEYFSEDNVEDEKMKNDRIRTEQIMSEQKKNTPHLSHNK   200
MIT_Spar_c381_22193   151   SNKSESTTDEEVECFSEDNNENGKVNNDKITAEHIVPVEKKIVEHVIQNK   200
MIT_Suva_c559_24639   151   SDDSGSTTDEEVECFSEDDAENERIKSDKIRNQPIVPKQKESNPHLIDSE   200
WashU_Sbay_Contig658.45   151   SDDSGSTTDEEVECFSEDDAENERIKSDKIRNQPIVPKQKESNPHLIDSE   200
WashU_Scas_Contig465.3   129   RFNREGGAKDDSSVDEDEDEDEQEEEVDYFSDDSEKEKPNNHENAGPISY   178
Symbols






. . :.:: . .::: :: . : * . : :: .



SGD_Scer_TCO89/YPL180W   201   LQSPDSIDEQEEDKSGTDGKENHRAVSLPLPHLSSNNYFGESSHSIEHQK   250
MIT_Smik_c17_21587   201   LQSPDTIDEKEERKSSIDRNEKYRAVSLPLPHLSSNDYPRETSQSVELQH   250
MIT_Spar_c381_22193   201   LQSPDPINEQEEDKSFNGEKENHRAVSLPLPHLSSDIYFGGSARSMECQN   250
MIT_Suva_c559_24639   201   LQSSEAIYEKEEEKPLDQQNKNHRAISLPLPHLTSDDYFGEPSHSEERQD   250
WashU_Sbay_Contig658.45   201   LQSSEAIYEKEEEKPLDQQNKNHRAISLPLPHLTSDDYFGEPSHSEERQD   250
WashU_Scas_Contig465.3   179   KPPSKFIKEEDKVDGANIENVSIRSTDNDTKNVGSQPVIVEDDHIDHSN-   227
Symbols






... * *::: . : . *: . :: *: : . :



SGD_Scer_TCO89/YPL180W   251   DGETSPSSIETKLNATSVINEEGQSKVTKEADIDDLSSHSQNLRASLVKA   300
MIT_Smik_c17_21587   251   NGQEAPSLTETKLIKESIINEQEQPNSITGSDVGVKSDDSKKFKLSLEKS   300
MIT_Spar_c381_22193   251   NGEASSSSTETKLNEKSIINEEEQSNSTKEAHIDAISNNSKNLKASSMKA   300
MIT_Suva_c559_24639   251   DGNVSSSSTETKLNVNHIINEEEQSSTRNNADAETEHPPKMNSPLMEADD   300
WashU_Sbay_Contig658.45   251   DGNVSSSSTETKLNVNHIINEEEQSSTRNNADAETEHPPKMNSPLMEADD   300
WashU_Scas_Contig465.3   228   ---------------------------LNEIDVGNVIEPSLHTLTRQGSM   250
Symbols






. . . : .



SGD_Scer_TCO89/YPL180W   301   GDNISEAPYDKEKKILDVGNTLAAHKSNQKPSHSDEQFDQEDHIDAPRSN   350
MIT_Smik_c17_21587   301   GDGISHASSNIQEKILDVGNTLDAHRDNHVPSHSEEQFDQEDHIDAPRSS   350
MIT_Spar_c381_22193   301   GDHTSQVPYNKEKKILDIGNTLSAHKSNRKPSNSNEQFDQEDHIDAPRSN   350
MIT_Suva_c559_24639   301   NISRTPYNANEREKILDIGNTLAVHKSSEKPRNLDEHFDQEDRIDAPRSN   350
WashU_Sbay_Contig658.45   301   NISRTPYNANEREKILDIGNTLAVHKSSEKPRNLDEHFDQEDRIDAPRSN   350
WashU_Scas_Contig465.3   251   FANLPKKVTDKEKIVLDKIDTSNDSSANAGPATRIANFENDN--------   292
Symbols






. : .: :** :* . * :*::::



SGD_Scer_TCO89/YPL180W   351   SSRKSDSSFMSLRRQSSKQHKLLNEEEDLIKPD--DISSAG--TKDIEGH   396
MIT_Smik_c17_21587   351   SSRKSDSSFMPLRRQSSKQHKLLNEEEDLIKPG--NISSTDGNVKDIEGN   398
MIT_Spar_c381_22193   351   SSRKSDSSFMSLRRQSSKQRKLLNEEEDFIKPG--NISSGD--AKDIEGH   396
MIT_Suva_c559_24639   351   SSRKSDASFMSLRRQSSKQRQLLNEEDDLIKPDPENISSNDINGKDIEGA   400
WashU_Sbay_Contig658.45   351   SSRKSDASFMSLRRQSSKQRQLLNEEDDLIKPDPENISSNDINGKDIEGA   400
WashU_Scas_Contig465.3   293   -NNLFDKPPMDTNKNNNKVSK-----------------------------   312
Symbols






.. * . * .::..* :



SGD_Scer_TCO89/YPL180W   397   SLLENYAPNMILSQSTGVERRFENSSSIQNSLGNEIHDSGEHMASGDTFN   446
MIT_Smik_c17_21587   399   SILENYVPNMILSQSTGVERRLENLPSIQNSLGNEIHSSGERMNLEDTFN   448
MIT_Spar_c381_22193   397   SLLENYAPDMILSQSTGVERRFENSSSIQNSLRNDIRESGEHINSGDTFD   446
MIT_Suva_c559_24639   401   NPLENYAPDMILSQSTGVERRFENLSSIQNSLGKEIQNPDDRLNSDGTFD   450
WashU_Sbay_Contig658.45   401   NPLENYAPDMILSQSTGVERRFENLSSIQNSLGKEIQNPDDRLNSDGTFD   450
WashU_Scas_Contig465.3   313   ---EKYIPTMILSQSTGMERTFEGPPSIQNSLANVLDSPIDKTSNEPIDN   359
Symbols






*:* * ********:** :*. .****** : : .. :: :



SGD_Scer_TCO89/YPL180W   447   ELDDGKLRKSKKNGGRSQLGQNIPNSQSTFPTIANIGSKDNNVPQHNFST   496
MIT_Smik_c17_21587   449   GLDDDKLRNNTKNVRQSQLGQKIPNSQSIFPPATNNTSKDNNVPQHSFST   498
MIT_Spar_c381_22193   447   EVDDGKLRKSTKNVRRSQLGQNIPNSQSSFPAATNVSSKDNTVPQHNFST   496
MIT_Suva_c559_24639   451   ELDDEKLPNDMKNMRLSKLGQNIPNSQFALPTATSIDNKDNAISQHNFST   500
WashU_Sbay_Contig658.45   451   ELDDEKLPNDMKNMRLSKLGQNIPNSQFALPTATSIDNKDNAISQHNFST   500
WashU_Scas_Contig465.3   360   GDKLNDVNNSNNIQTTIKEEIPRKDFKPTPRINTLNVTNTSAGQQHTFSS   409
Symbols






. .: :. : : : : : .: . **.**:



SGD_Scer_TCO89/YPL180W   497   SISSLTNNLRRAAPESFHG-SRMNNIFHKKGNQNLLLRSNDLNKNSAAPA   545
MIT_Smik_c17_21587   499   SISSLTNNLRRAAPESFHGSSRINSIFHKKGNQSLLLRSNDTGKNAVALN   548
MIT_Spar_c381_22193   497   SISSLTNNLRRAAPESFHGSSRMNSIFHKKGNQNLLLRSNDASKNSAVAT   546
MIT_Suva_c559_24639   501   SISSLTNNLRRAVPDSFHGSSRMNNIFHKKSSQNLLLRSNNVGKNPSASN   550
WashU_Sbay_Contig658.45   501   SISSLTNNLRRAVPDSFHGSSRMNNIFHKKSSQNLLLRSNNVGKNPSASN   550
WashU_Scas_Contig465.3   410   SISSLTNNLQHAIGNQTLLGNHYTLPNVRMNNANVSNIHKKPSQNQLLRT   459
Symbols






*********::* :. .: . : .. .: :. .:*



SGD_Scer_TCO89/YPL180W   546   SPLSNEHITSSTNSGSDANRQSNSGAKFNSFAQFLKSDGIDAESRTQRKL   595
MIT_Smik_c17_21587   549   SPLSHEHSTSSTNVNGNANKQSDSGTKFNSFAQFLKSDGIDAESRTQRKL   598
MIT_Spar_c381_22193   547   SPLSNEYSTSGTNVSGDTNRRSNGGAKFNSFAQFLKSDGIDAESRTQRKL   596
MIT_Suva_c559_24639   551   SPLVNEHSISNTNANGNANGSSDSGAKFNSFAQFLKSDGIDAESRTQRKL   600
WashU_Sbay_Contig658.45   551   SPLVNEHSISNTNANGNANGSSDSGAKFNSFAQFLKSDGIDAESRTQRKL   600
WashU_Scas_Contig465.3   460   DSTTQNGITSDLSTSLKG-KDSNIPKKFNNFQQFLKSEDVDDDSRTQRKL   508
Symbols






.. :: *. . . . *: ***.* *****:.:* :*******



SGD_Scer_TCO89/YPL180W   596   WLQRENSIMDLSSQNDGS--DSIFMAGNIDAKREFERISHEYSNVKRFYN   643
MIT_Smik_c17_21587   599   WLQRENSIMDLSSQNDSS--DSIFMAGNIDAKREFERISHEYSNVKRFYN   646
MIT_Spar_c381_22193   597   WLQRENSIMDLSSQNDGS--DSIFMAGNIDAKREFERISHEYSNVKRFYN   644
MIT_Suva_c559_24639   601   WLQRENSIMDLSSQNDGS--DSIFMAGNIDAKREFERISHEYSNVKRFYN   648
WashU_Sbay_Contig658.45   601   WLQRENSIMDLSSQNDGS--DSIFMAGNIDAKREFERISHEYSNVKRFYN   648
WashU_Scas_Contig465.3   509   WLQRESSIMDLSLQNDNNNPDAIXMASNVEVKREFERISHEYINIKRFSN   558
Symbols






*****.****** ***.. *:* **.*::.*********** *:*** *



SGD_Scer_TCO89/YPL180W   644   PLDEALLRVQPIITGNANNIRKKSHNDAQSIAHSSSDTDHKDEDDLLFTN   693
MIT_Smik_c17_21587   647   PLDEALLRIEPTMPGNAKNIRKKSHNDGQSIAHSNDTTDHKDENDLLFTD   696
MIT_Spar_c381_22193   645   PLDEALLRVEPTITGNANNIRKKSHNDGQSIAHSNDTTDHKDEEDLLFNN   694
MIT_Suva_c559_24639   649   PLDEALLRVEPTMVGNTNNIRKKSHNDGQSITPSNSTPDHKNKDDSLFAN   698
WashU_Sbay_Contig658.45   649   PLDEALLRVEPTMVGNTNNIRKKSHNDGQSITPSNSTPDHKNKDDSLFAN   698
WashU_Scas_Contig465.3   559   PLNEALSRLENGKKPLGIKQKGTQNNLERRTPPNSMFSNYMSSS------   602
Symbols






**:*** *:: : : ..:* : . .. .:: ...



SGD_Scer_TCO89/YPL180W   694   YDKKFDDLYPHLASAKIQAVLSGIWKSESYLFNKDVNPINKNRTTS----   739
MIT_Smik_c17_21587   697   YDKKFDNLYPHLANAKIQAVLSSIWKNESYSFNKDVNPINKNRTSS----   742
MIT_Spar_c381_22193   695   YDKKFDDLYPHLASAKIQAVLSGIWKNESYLFNKDVNPINKNRTSS----   740
MIT_Suva_c559_24639   699   YEKKFDDLYPHLGNAKIQAVLSNIWKNESFLFNKDVNPISKNKTSS----   744
WashU_Sbay_Contig658.45   699   YEKKFDDLYPHLGNAKIQAVLSNIWKNESFLFNKDVNPISKNKTSS----   744
WashU_Scas_Contig465.3   603   -KPTDEVILPELQNTKIQRILSSMWREESSLFIKDNNPLNRISHSSNMST   651
Symbols






. . : : *.* .:*** :**.:*:.** * ** **:.: :*



SGD_Scer_TCO89/YPL180W   740   -----TNHSVGHTASQNARNLLRGPMGSSTTLHHQRVINSLQPTTRAVNR   784
MIT_Smik_c17_21587   743   -----TNHSMSHAASQNTRNLLRGPIGSSTTLHHQRVINSLQPTTRAVNR   787
MIT_Spar_c381_22193   741   -----TSHSISHTASQNTRNLLRGPMGSSTTLHHQRVINSLQPTTRAVNR   785
MIT_Suva_c559_24639   745   -----TSHSMSNNAPQNARNLLRGPT---AALPHQRVINSLQPTTRAVNR   786
WashU_Sbay_Contig658.45   745   -----TSHSMSNNAPQNARNLLRGPT---AALPHQRVINSLQPTTRAVNR   786
WashU_Scas_Contig465.3   652   NSLRPRSTSNKHYSSQNVRHSLRGPG-SSTNLHHQRVVNSLQPTTRAVNR   700
Symbols






. * : :.**.*: **** : * ****:************



SGD_Scer_TCO89/YPL180W   785   RMENVGYMHTQPQQR   799
MIT_Smik_c17_21587   788   RMENVGYMHTQQQQR   802
MIT_Spar_c381_22193   786   RMENVGYMHTQPQQR   800
MIT_Suva_c559_24639   787   RMENVGYMHAQSQQR   801
WashU_Sbay_Contig658.45   787   RMENVGYMHAQSQQR   801
WashU_Scas_Contig465.3   701   RMENHQQR-------   708
Symbols






****



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_TCO89/YPL180W:

SGD_Scer_TCO89/YPL180W  Length: 800  Mon Nov  7 16:47:50 2016  Type: P  Check: 7626  ..

       1  MVHRGRTLKS DTDVTSLNAS TVSHQSKPFR QFSTRSRAKS NASFKGLRRV

      51  LTHDGTLDND YFNKHNVSQK CKSSDALFRK RTISGLNMTA LTRVKSNQGK

     101  RSASFHSPVH NTLLSPKNSS HSNTGTAGFG LKPRRSKSTQ SVLSLRDAQE

     151  SKKSESTTDE EVECFSEDNI EDGKVNNDKV IAEHVMPEEK KNVQQLNQNE

     201  LQSPDSIDEQ EEDKSGTDGK ENHRAVSLPL PHLSSNNYFG ESSHSIEHQK

     251  DGETSPSSIE TKLNATSVIN EEGQSKVTKE ADIDDLSSHS QNLRASLVKA

     301  GDNISEAPYD KEKKILDVGN TLAAHKSNQK PSHSDEQFDQ EDHIDAPRSN

     351  SSRKSDSSFM SLRRQSSKQH KLLNEEEDLI KPDDISSAGT KDIEGHSLLE

     401  NYAPNMILSQ STGVERRFEN SSSIQNSLGN EIHDSGEHMA SGDTFNELDD

     451  GKLRKSKKNG GRSQLGQNIP NSQSTFPTIA NIGSKDNNVP QHNFSTSISS

     501  LTNNLRRAAP ESFHGSRMNN IFHKKGNQNL LLRSNDLNKN SAAPASPLSN

     551  EHITSSTNSG SDANRQSNSG AKFNSFAQFL KSDGIDAESR TQRKLWLQRE

     601  NSIMDLSSQN DGSDSIFMAG NIDAKREFER ISHEYSNVKR FYNPLDEALL

     651  RVQPIITGNA NNIRKKSHND AQSIAHSSSD TDHKDEDDLL FTNYDKKFDD

     701  LYPHLASAKI QAVLSGIWKS ESYLFNKDVN PINKNRTTST NHSVGHTASQ

     751  NARNLLRGPM GSSTTLHHQR VINSLQPTTR AVNRRMENVG YMHTQPQQR*


Protein Sequence for MIT_Smik_c17_21587:

MIT_Smik_c17_21587  Length: 803  Mon Nov  7 16:47:50 2016  Type: P  Check: 8079  ..

       1  MVHRGRTLKS DAEIASPIAS TVSHQSKPFR QFSTRSRAKS NASFKGLRRV

      51  LTHDGTLDND YFNKHNISQK CKSTDALFRK RTISGLNMTA LTRVKSNQGK

     101  RSASFHSPVH NTLLSPKSSS HSNSGGGGFS LKPRRSKSTQ SVLSLRDAQA

     151  SNKNESTTDE EVEYFSEDNV EDEKMKNDRI RTEQIMSEQK KNTPHLSHNK

     201  LQSPDTIDEK EERKSSIDRN EKYRAVSLPL PHLSSNDYPR ETSQSVELQH

     251  NGQEAPSLTE TKLIKESIIN EQEQPNSITG SDVGVKSDDS KKFKLSLEKS

     301  GDGISHASSN IQEKILDVGN TLDAHRDNHV PSHSEEQFDQ EDHIDAPRSS

     351  SSRKSDSSFM PLRRQSSKQH KLLNEEEDLI KPGNISSTDG NVKDIEGNSI

     401  LENYVPNMIL SQSTGVERRL ENLPSIQNSL GNEIHSSGER MNLEDTFNGL

     451  DDDKLRNNTK NVRQSQLGQK IPNSQSIFPP ATNNTSKDNN VPQHSFSTSI

     501  SSLTNNLRRA APESFHGSSR INSIFHKKGN QSLLLRSNDT GKNAVALNSP

     551  LSHEHSTSST NVNGNANKQS DSGTKFNSFA QFLKSDGIDA ESRTQRKLWL

     601  QRENSIMDLS SQNDSSDSIF MAGNIDAKRE FERISHEYSN VKRFYNPLDE

     651  ALLRIEPTMP GNAKNIRKKS HNDGQSIAHS NDTTDHKDEN DLLFTDYDKK

     701  FDNLYPHLAN AKIQAVLSSI WKNESYSFNK DVNPINKNRT SSTNHSMSHA

     751  ASQNTRNLLR GPIGSSTTLH HQRVINSLQP TTRAVNRRME NVGYMHTQQQ

     801  QR*

Protein Sequence for MIT_Spar_c381_22193:

MIT_Spar_c381_22193  Length: 801  Mon Nov  7 16:47:50 2016  Type: P  Check: 3266  ..

       1  MVHRGRTLKS DTDITSLNAP TVSHQSKPFR QFSTRSRAKS NASFKGLRRV

      51  LTHDGTLDSD YFNKHSISQK CKSSDALFRK RTISGLNMTA LTRVRSNQGK

     101  RSASFHSPVH NTLLSPKNSS HSNSGSAGFG LKPRRSKSTQ SVLSLRDAQE

     151  SNKSESTTDE EVECFSEDNN ENGKVNNDKI TAEHIVPVEK KIVEHVIQNK

     201  LQSPDPINEQ EEDKSFNGEK ENHRAVSLPL PHLSSDIYFG GSARSMECQN

     251  NGEASSSSTE TKLNEKSIIN EEEQSNSTKE AHIDAISNNS KNLKASSMKA

     301  GDHTSQVPYN KEKKILDIGN TLSAHKSNRK PSNSNEQFDQ EDHIDAPRSN

     351  SSRKSDSSFM SLRRQSSKQR KLLNEEEDFI KPGNISSGDA KDIEGHSLLE

     401  NYAPDMILSQ STGVERRFEN SSSIQNSLRN DIRESGEHIN SGDTFDEVDD

     451  GKLRKSTKNV RRSQLGQNIP NSQSSFPAAT NVSSKDNTVP QHNFSTSISS

     501  LTNNLRRAAP ESFHGSSRMN SIFHKKGNQN LLLRSNDASK NSAVATSPLS

     551  NEYSTSGTNV SGDTNRRSNG GAKFNSFAQF LKSDGIDAES RTQRKLWLQR

     601  ENSIMDLSSQ NDGSDSIFMA GNIDAKREFE RISHEYSNVK RFYNPLDEAL

     651  LRVEPTITGN ANNIRKKSHN DGQSIAHSND TTDHKDEEDL LFNNYDKKFD

     701  DLYPHLASAK IQAVLSGIWK NESYLFNKDV NPINKNRTSS TSHSISHTAS

     751  QNTRNLLRGP MGSSTTLHHQ RVINSLQPTT RAVNRRMENV GYMHTQPQQR

     801  *

Protein Sequence for MIT_Suva_c559_24639:

MIT_Suva_c559_24639  Length: 802  Mon Nov  7 16:47:50 2016  Type: P  Check: 7302  ..

       1  MVHRGRTLKS DTDTTSPNGS AVPHQSKPFR QFSTRSRAKS NASFKGLRRV

      51  LTHDGTLDSD YFNKHNISQK CKSSDALFRK RTISGLNMTA LTRVRSNQGK

     101  RSASFHSPVH NTLLSPKSSS HSNSASSGFG LKPRRSKSTQ SVLSLRDAQE

     151  SDDSGSTTDE EVECFSEDDA ENERIKSDKI RNQPIVPKQK ESNPHLIDSE

     201  LQSSEAIYEK EEEKPLDQQN KNHRAISLPL PHLTSDDYFG EPSHSEERQD

     251  DGNVSSSSTE TKLNVNHIIN EEEQSSTRNN ADAETEHPPK MNSPLMEADD

     301  NISRTPYNAN EREKILDIGN TLAVHKSSEK PRNLDEHFDQ EDRIDAPRSN

     351  SSRKSDASFM SLRRQSSKQR QLLNEEDDLI KPDPENISSN DINGKDIEGA

     401  NPLENYAPDM ILSQSTGVER RFENLSSIQN SLGKEIQNPD DRLNSDGTFD

     451  ELDDEKLPND MKNMRLSKLG QNIPNSQFAL PTATSIDNKD NAISQHNFST

     501  SISSLTNNLR RAVPDSFHGS SRMNNIFHKK SSQNLLLRSN NVGKNPSASN

     551  SPLVNEHSIS NTNANGNANG SSDSGAKFNS FAQFLKSDGI DAESRTQRKL

     601  WLQRENSIMD LSSQNDGSDS IFMAGNIDAK REFERISHEY SNVKRFYNPL

     651  DEALLRVEPT MVGNTNNIRK KSHNDGQSIT PSNSTPDHKN KDDSLFANYE

     701  KKFDDLYPHL GNAKIQAVLS NIWKNESFLF NKDVNPISKN KTSSTSHSMS

     751  NNAPQNARNL LRGPTAALPH QRVINSLQPT TRAVNRRMEN VGYMHAQSQQ

     801  R*

Protein Sequence for WashU_Sbay_Contig658.45:

WashU_Sbay_Contig658.45  Length: 802  Mon Nov  7 16:47:50 2016  Type: P  Check: 7302  ..

       1  MVHRGRTLKS DTDTTSPNGS AVPHQSKPFR QFSTRSRAKS NASFKGLRRV

      51  LTHDGTLDSD YFNKHNISQK CKSSDALFRK RTISGLNMTA LTRVRSNQGK

     101  RSASFHSPVH NTLLSPKSSS HSNSASSGFG LKPRRSKSTQ SVLSLRDAQE

     151  SDDSGSTTDE EVECFSEDDA ENERIKSDKI RNQPIVPKQK ESNPHLIDSE

     201  LQSSEAIYEK EEEKPLDQQN KNHRAISLPL PHLTSDDYFG EPSHSEERQD

     251  DGNVSSSSTE TKLNVNHIIN EEEQSSTRNN ADAETEHPPK MNSPLMEADD

     301  NISRTPYNAN EREKILDIGN TLAVHKSSEK PRNLDEHFDQ EDRIDAPRSN

     351  SSRKSDASFM SLRRQSSKQR QLLNEEDDLI KPDPENISSN DINGKDIEGA

     401  NPLENYAPDM ILSQSTGVER RFENLSSIQN SLGKEIQNPD DRLNSDGTFD

     451  ELDDEKLPND MKNMRLSKLG QNIPNSQFAL PTATSIDNKD NAISQHNFST

     501  SISSLTNNLR RAVPDSFHGS SRMNNIFHKK SSQNLLLRSN NVGKNPSASN

     551  SPLVNEHSIS NTNANGNANG SSDSGAKFNS FAQFLKSDGI DAESRTQRKL

     601  WLQRENSIMD LSSQNDGSDS IFMAGNIDAK REFERISHEY SNVKRFYNPL

     651  DEALLRVEPT MVGNTNNIRK KSHNDGQSIT PSNSTPDHKN KDDSLFANYE

     701  KKFDDLYPHL GNAKIQAVLS NIWKNESFLF NKDVNPISKN KTSSTSHSMS

     751  NNAPQNARNL LRGPTAALPH QRVINSLQPT TRAVNRRMEN VGYMHAQSQQ

     801  R*

Protein Sequence for WashU_Scas_Contig465.3:

WashU_Scas_Contig465.3  Length: 709  Mon Nov  7 16:47:50 2016  Type: P  Check: 2086  ..

       1  MVHRGRSLRS ETEPHTGSSN VKQFRQFTTR SRAKSTASFK GLRRVLTHDG

      51  TFDEGHGRHS SFQKCKSSDA LSRKRVISGL SMTTLTRVKS NPGSVVSPTR

     101  DVIGNFGGIK PTRSKSTHSV LNLQEIAERF NREGGAKDDS SVDEDEDEDE

     151  QEEEVDYFSD DSEKEKPNNH ENAGPISYKP PSKFIKEEDK VDGANIENVS

     201  IRSTDNDTKN VGSQPVIVED DHIDHSNLNE IDVGNVIEPS LHTLTRQGSM

     251  FANLPKKVTD KEKIVLDKID TSNDSSANAG PATRIANFEN DNNNLFDKPP

     301  MDTNKNNNKV SKEKYIPTMI LSQSTGMERT FEGPPSIQNS LANVLDSPID

     351  KTSNEPIDNG DKLNDVNNSN NIQTTIKEEI PRKDFKPTPR INTLNVTNTS

     401  AGQQHTFSSS ISSLTNNLQH AIGNQTLLGN HYTLPNVRMN NANVSNIHKK

     451  PSQNQLLRTD STTQNGITSD LSTSLKGKDS NIPKKFNNFQ QFLKSEDVDD

     501  DSRTQRKLWL QRESSIMDLS LQNDNNNPDA IXMASNVEVK REFERISHEY

     551  INIKRFSNPL NEALSRLENG KKPLGIKQKG TQNNLERRTP PNSMFSNYMS

     601  SSKPTDEVIL PELQNTKIQR ILSSMWREES SLFIKDNNPL NRISHSSNMS

     651  TNSLRPRSTS NKHYSSQNVR HSLRGPGSST NLHHQRVVNS LQPTTRAVNR

     701  RMENHQQR*