Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YPL012W and Homologs


Choose two or more sequences for alignment:
Pick a sequence type:
Best Hits & Orthologs"Other" Hits

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_RRP12/YPL012W   1   MDQDKVAFLLELEDKLAKIRSQVNSKLENQKHIAIILTAVEENIAGQATN   50
MIT_Suva_c668_24883   1   MDQDQVAFLLELEDKLAKIRFQATSKLENQKHVAIILTAVEENIVGQATN   50
WashU_Sbay_Contig515.7   1   MDQDQVAFLLELEDKLAKIRFQATSKLENQKHVAIILTAVEENIVGQATN   50
WashU_Scas_Contig702.5   1   MEAEQVAHLLELEDKLSKIRLQITSKLENQKHIAIILTAVEENIQDQATN   50
Symbols






*: ::**.********:*** * .********:*********** .****



SGD_Scer_RRP12/YPL012W   51   DVSKNIVNYIISFMSLLDQAVDPSTHEIKDIQLASSSTYLLDLIFHYSPK   100
MIT_Suva_c668_24883   51   DISKNIVNYIISFMSLLDQAVDPSTHEIKDLQLASSSTYLLDLIFRYSPK   100
WashU_Sbay_Contig515.7   51   DISKNIVNYIISFMSLLDQAVDPSTHEIKDLQLASSSTYLLDLIFRYSPK   100
WashU_Scas_Contig702.5   51   DTSKNIVNYMISFMSLLDQAMNPQTHAIQDLQLATSATYLLDIIFHYSPK   100
Symbols






* *******:**********::*.** *:*:***:*:*****:**:****



SGD_Scer_RRP12/YPL012W   101   VLLRSKFSEILTKIAPCITAEKANAPLIRAAIGCLESLLIAQDAQAWNNT   150
MIT_Suva_c668_24883   101   PLLRSKFSEILTKIAPCITAEKANAPLIRAAIGCLESLLIAQDAQAWNNT   150
WashU_Sbay_Contig515.7   101   PLLRSKFSEILTKIAPCITAEKANAPLIRAAIGCLESLLIAQDAQAWNNT   150
WashU_Scas_Contig702.5   101   KLLSSKFTEILTKVAPCITDEKAGAPLIRSAIGCLESLLIAQDAQAWNNT   150
Symbols






** ***:*****:***** ***.*****:********************



SGD_Scer_RRP12/YPL012W   151   YDLNVTPKRGLQGILELSLDVRPKVRKRALDAVHAVLLNPPVAPTAEHVA   200
MIT_Suva_c668_24883   151   YDLNVTPKRGLLGILELSLDLRPKVRKRALDAVHAVLSNPPVAPTAEHVA   200
WashU_Sbay_Contig515.7   151   YDLNVTPKRGLLGILELSLDLRPKVRKRALDAVHAVLSNPPVAPTAEHVA   200
WashU_Scas_Contig702.5   151   HNLTVTPKRGLQGLLELSLDPRPKVRKRAQDAVANILKNPPVAPTAEHVA   200
Symbols






::*.******* *:****** ******** *** :* ************



SGD_Scer_RRP12/YPL012W   201   AVFVADFCDKQLAGILNDLSNLSNKQLKAQKTKEDINASVMRSLRLITSV   250
MIT_Suva_c668_24883   201   AVFVADFCDKQLAGVLDELSNLSNKQLKAQNTKEDINASVMRSLRLVTSV   250
WashU_Sbay_Contig515.7   201   AVFVADFCDKQLAGVLDELSNLSNKQLKAQNTKEDINASVMRSLRLVTSV   250
WashU_Scas_Contig702.5   201   ASFIAEFAINSLNDNINELSSLSNKQLKSPGVSEEINSKITRSLRLIAAI   250
Symbols






* *:*:*. :.* . :::**.*******: ..*:**:.: *****::::



SGD_Scer_RRP12/YPL012W   251   VSTGQWPSSQIEPLCDVLLGVTKSSEQYLVSASFECFESMFKTMAETTIS   300
MIT_Suva_c668_24883   251   ISTGQWPSSQIEPLCDVLLGVTRSSEQYLVSAAFECFESMFKAMAETTVS   300
WashU_Sbay_Contig515.7   251   ISTGQWPSSQIEPLCDVLLGVTRSSEQYLVSAAFECFESMFKAMAETTVS   300
WashU_Scas_Contig702.5   251   ISSGQWPATEIENICDMLLKITKSPDQFLVSASFQCFEQLFQSMAETTIS   300
Symbols






:*:****:::** :**:** :*:*.:*:****:*:***.:*::*****:*



SGD_Scer_RRP12/YPL012W   301   SGLAENKYLRVLDTIFALKPSNVDTLLTKSWIAVVIKGMSTYATHQPLKA   350
MIT_Suva_c668_24883   301   SGLAENKYLRVLDTIFSLKPSNVDTLLTKAWIAVVVKGMSTYAVHQPLKA   350
WashU_Sbay_Contig515.7   301   SGLAENKYLRVLDTIFSLKPSNVDTLLTKAWIAVVVKGMSTYAVHQPLKA   350
WashU_Scas_Contig702.5   301   SGLAENKYLKMLDTIFSLKPANTDTHLTGAWIAVVVKGLSTYANAQPLKC   350
Symbols






*********::*****:***:*.** ** :*****:**:**** ****.



SGD_Scer_RRP12/YPL012W   351   LRKIPGVFHIMCTYLASETPEVYQAASQCLISILSESVKDDLLLYTP-SV   399
MIT_Suva_c668_24883   351   LRKIPNVFRVMSTYLASETTEVYQAASQCLISILSDSIQDHLLLFTP-DV   399
WashU_Sbay_Contig515.7   351   LRKIPNVFRVMSTYLASETTEVYQAASQCLISILSDSIQDHLLLFTP-DV   399
WashU_Scas_Contig702.5   351   LLKLPQVFHIMATYLQSEHQEVYTAAAKCLSAILTDSIKDELLLQPNDVM   400
Symbols






* *:* **::*.*** ** *** **::** :**::*::*.*** . :



SGD_Scer_RRP12/YPL012W   400   DEKVFKNVDEIISQIAKTFIDFLSIRYSHCSREILKILVAAFNKFRYRSN   449
MIT_Suva_c668_24883   400   DDKIFKNVDDIICQISKTFIDFLSIKYSHCSREILKILVAAFNKFRYRSN   449
WashU_Sbay_Contig515.7   400   DDKIFKNVDDIICQISKTFIDFLSIKYSHCSREILKILVAAFNKFRYRSN   449
WashU_Scas_Contig702.5   401   DEKTFKTVGDVIEEISNIITDFLSIKYIHCAKDVLTILASAFKKVRYRSN   450
Symbols






*:* **.*.::* :*:: : *****:* **::::*.**.:**:*.*****



SGD_Scer_RRP12/YPL012W   450   PHFLKSLKIVDTWRVNEEQFMDLRNEIELVIGASISAMGPEMILAEAPLN   499
MIT_Suva_c668_24883   450   PHFLKSLKIVDTWRVNEEQFMDLRNEIELVIGASISAMGPEVVLAQAPLN   499
WashU_Sbay_Contig515.7   450   PHFLKSLKIVDTWRVNEEQFMDLRNEIELVIGASISAMGPEVVLAQAPLN   499
WashU_Scas_Contig702.5   451   PALLKPLQIVDQWRNNEDTFLEFRNEVENVIGESISALGPELVLQILPLN   500
Symbols






* :**.*:*** ** **: *:::***:* *** ****:***::* ***



SGD_Scer_RRP12/YPL012W   500   LDNPSSERPGRAWLLPLIRDYTKNANLATFQNELAPYIKSFQSKFDKVPE   549
MIT_Suva_c668_24883   500   LDNPSNERPGRAWMLPLIRDYTKNAKLSTFQNELAPYITSFQSKFDKVPE   549
WashU_Sbay_Contig515.7   500   LDNPSNERPGRAWMLPLIRDYTKNAKLSTFQNELAPYITSFQSKFDKVPE   549
WashU_Scas_Contig702.5   501   LINPSDDQPGRAWLLPLLRDYTKNAKLATFSKELAPLIQNFESRFASLPK   550
Symbols






* ***.::*****:***:*******:*:**.:**** * .*:*:* .:*:



SGD_Scer_RRP12/YPL012W   550   ESIQLRVFQTIVDQIWSTLPRFCELPMDLRESFTDEFASELSSLLYSEVE   599
MIT_Suva_c668_24883   550   ESIQLKVFQTIVEQIWSTLPRFCELPMDLRGSFTDEFASELSSLLYSEVE   599
WashU_Sbay_Contig515.7   550   ESIQLKVFQTIVEQIWSTLPRFCELPMDLRGSFTDEFASELSSLLYSEVE   599
WashU_Scas_Contig702.5   551   ESVQLRIFQTVVDQLWSTLPHFCELPIDLPQSFNDEFAAELSSLLYSRVD   600
Symbols






**:**::***:*:*:*****:*****:** **.****:********.*:



SGD_Scer_RRP12/YPL012W   600   LRTTICHALKVLAESNVSYAEESSSHNVLLLQRFPISEAQKNIEYLSTKS   649
MIT_Suva_c668_24883   600   LRTTICHALKVLAESNVLYAEGSLSDDVLLLQHFPISEAQKNIEYLSTKS   649
WashU_Sbay_Contig515.7   600   LRTTICHALKVLAESNVLYAEGSLSDDVLLLQHFPISEAQKNIEYLSTKS   649
WashU_Scas_Contig702.5   601   LRTTLCHALRVLVESNSAYANGALSDDILLQQRFPASEATKNIEYLQTKS   650
Symbols






****:****:**.*** **: : *.::** *:** *** ******.***



SGD_Scer_RRP12/YPL012W   650   TNLLAVLFNVYTQTTPNARSYILETIDQYLKITSKEDLEKTFNNVCGLLK   699
MIT_Suva_c668_24883   650   TNLLAVLFNVYTQTTPNARSYILETIDQYLKITSKEDVEKTFNNICGLLK   699
WashU_Sbay_Contig515.7   650   TNLLAVLFNVYTQTTPNARSYILETIDQYLKITSKEDVEKTFNNICGLLK   699
WashU_Scas_Contig702.5   651   VNLLSVLFNVYTQTTPTSRGYILETIEAYLKITKSTDLETTFNNICGLLK   700
Symbols






.***:***********.:*.******: *****.. *:*.****:*****



SGD_Scer_RRP12/YPL012W   700   NSMNEESSGNVNKE--KKKPQLTATLLDLIICMITYLPVSSYSALFSMFS   747
MIT_Suva_c668_24883   700   NSMNEESKGNGNKE--KKKPQLTATLLDLIICMTTYLPASSYSALFSIFG   747
WashU_Sbay_Contig515.7   700   NSMNEESKGNGNKE--KKKPQLTATLLDLIICMTTYLPASSYSALFSIFG   747
WashU_Scas_Contig702.5   701   NAMESESQTKEESANASSKPQLTATLLDLVVCMTKYLPPSSYAALFNIFG   750
Symbols






*:*:.**. : :. ..***********::** .*** ***:***.:*.



SGD_Scer_RRP12/YPL012W   748   LTVNSADALIQKRAYRIITKLSELKSGSTAVAQFISDIENVMVDSASSVQ   797
MIT_Suva_c668_24883   748   LTVCSSDALIQKRAYRIVTKLSEFESGSTAVAQFISDIENVMVDNTTTVQ   797
WashU_Sbay_Contig515.7   748   LTVCSSDALIQKRAYRIVTKLSEFESGSTAVAQFISDIENVMVDNTTTVQ   797
WashU_Scas_Contig702.5   751   TTVSSNDALIQKRAYRIITRLSELESGYAAVLTYVSDIEKIILDNADNVQ   800
Symbols






** * ***********:*:***::** :** ::****::::*.: .**



SGD_Scer_RRP12/YPL012W   798   TSAKAARLTAIKTIVELLPLDHLDFIVRTVAEVILSTKDVNEKSRETAFD   847
MIT_Suva_c668_24883   798   TSAKAARLAAIKTIVDLLPFDHLGFIVRTVAEVILSTKDVNEKSRETAFD   847
WashU_Sbay_Contig515.7   798   TSAKAARLAAIKTIVDLLPFDHLGFIVRTVAEVILSTKDVNEKSRETAFD   847
WashU_Scas_Contig702.5   801   TSAKSTRLSAIKTLVNMLPSDHLGFIVRIVAEIILGTKDVNEKTRELAFE   850
Symbols






****::**:****:*::** ***.**** ***:**.*******:** **:



SGD_Scer_RRP12/YPL012W   848   TLICMGRKMNEPNGIIKLFQIPGYDPTTPDQSSSISEFFKIISAGLIGES   897
MIT_Suva_c668_24883   848   TLINMGKKMNEPNGIIKLSQIPGYDPATPDQPSSVSEFFKIISAGLIGES   897
WashU_Sbay_Contig515.7   848   TLINMGKKMNEPNGIIKLSQIPGYDPATPDQPSSVSEFFKIISAGLIGES   897
WashU_Scas_Contig702.5   851   ALIVMGKKMNEPNGIVKLSQIPGYDPATPDQPSTISEFFKIISAGLIGES   900
Symbols






:** **:********:** *******:****.*::***************



SGD_Scer_RRP12/YPL012W   898   QHMVSSSITGYACLVFEFKNELDSGILMDIYDTIELYLTSNSREIVKSAI   947
MIT_Suva_c668_24883   898   QHMVSSSITGYACLVFEFKNEMDSGILMDIYDTIELYLTSNSREIVKSAI   947
WashU_Sbay_Contig515.7   898   QHMVSSSITGYACLVFEFKNEMDSGILMDIYDTIELYLTSNSREIVKSAI   947
WashU_Scas_Contig702.5   901   QHMVSSTITAYAYLIFEFKDQLDNSVLLDIYDTVELYLTSNSREIVKSAI   950
Symbols






******:**.** *:****:::*..:*:*****:****************



SGD_Scer_RRP12/YPL012W   948   GFTKVCVLGLPEELMRPKVPELLLKLLRWSHEHTGHFKAKVKHIIERLIR   997
MIT_Suva_c668_24883   948   GFTKVCVLGLPEEVMRPKVPELLLKLLRWSHEHTGHFKAKVKHIIERLIR   997
WashU_Sbay_Contig515.7   948   GFTKVCVLGLPEEVMRPKVPELLLKLLRWSHEHTGHFKAKVKHIIERLIR   997
WashU_Scas_Contig702.5   951   GFAKVCILGLPEELMRSKVPELLPKLLRWSHEHTGHFKAKVKHLIERLIR   1000
Symbols






**:***:******:**.****** *******************:******



SGD_Scer_RRP12/YPL012W   998   RFGYDYIEANFPEEDRRLLTNIRKMRNRNKRKDEEVTTGVSDVAATKG--   1045
MIT_Suva_c668_24883   998   RFGYDYIEANFPEEDRKLLTNIRKARNRSKRKDEEVAPAIDANAGTTTKG   1047
WashU_Sbay_Contig515.7   998   RFGYDYIEANFPEEDRKLLTNIRKARNRSKRKDEEVAPAIDANAGTTTKG   1047
WashU_Scas_Contig702.5   1001   RFGYEFIEQHFPEEDKRLLTNIRKARNKSKRKGEENAGSAAQPG--SSKA   1048
Symbols






****::** :*****::******* **:.***.** : . . .



SGD_Scer_RRP12/YPL012W   1046   SRFMSAFDEAVYGSDEENDNGSDQEENVAGGKMKN---GAKQFIVESGDN   1092
MIT_Suva_c668_24883   1048   SRFMSAFDEAVYGSDNENGNESDQEENAAGGRRKN---GQKQFIVESGEN   1094
WashU_Sbay_Contig515.7   1048   SRFMSAFDEAVYGSDNENGNESDQEENAAGGRRKN---GQKQFIVESGEN   1094
WashU_Scas_Contig702.5   1049   SKFMNAFDEAVYGSSDNEDEGSDAENDEGHNDKRGKRRGGKQFIVERGEN   1098
Symbols






*:**.*********.:::.: ** *:: . . :. * ****** *:*



SGD_Scer_RRP12/YPL012W   1093   PLDLLDSQTLAHISSTRPKKFNKNQNRARFNDDAFNFDSEGKLVVKGQPK   1142
MIT_Suva_c668_24883   1095   PLDLLDSQTLAHISSTRPKKFNKNQNKGRFEDDTFNFDSEGKLVVKGQAK   1144
WashU_Sbay_Contig515.7   1095   PLDLLDSQTLAHISSTRPKKFNKNQNKGRFEDDTFNFDSEGKLVVKGQAK   1144
WashU_Scas_Contig702.5   1099   PLDLLDSETLAHISSTRPKKFGKDQRKKRLEDETFDFDSEGKLIMKGQKG   1148
Symbols






*******:*************.*:*.: *::*::*:*******::***



SGD_Scer_RRP12/YPL012W   1143   PSTNVDDPLSAVTSGINAYLEAVKSGPVRGQRNKLKFRKN--GKDSDEFG   1190
MIT_Suva_c668_24883   1145   PSANADDPLSAVTSGINAYLEAVKSGPVRGQRNKLKFKKN--GKDSDEFG   1192
WashU_Sbay_Contig515.7   1145   PSANADDPLSAVTSGINAYLEAVKSGPVRGQRNKLKFKKN--GKDSDEFG   1192
WashU_Scas_Contig702.5   1149   GNNDNDDPLKSVTSGINAYLDAVKSGPVRGQRNKLKFKKNNRGGDDDGFS   1198
Symbols






. : ****.:*********:****************:** * *.* *.



SGD_Scer_RRP12/YPL012W   1191   DDDDGEKDSRLMRGRVNQGNKIGKHNKKGPKFKSRKKL   1228
MIT_Suva_c668_24883   1193   DD--GEKDDRVMRRKVDPKNKIGKGGKRGPKFKSRKKL   1228
WashU_Sbay_Contig515.7   1193   DD--GEKDDRVMRRKVDPKNKIGKGGKRGPKFKSRKKL   1228
WashU_Scas_Contig702.5   1199   DDEGRSKSAGSKRNISSRGNKVGKNFKNNNKFKSRRKL   1236
Symbols






** .*. * . **:** *.. *****:**



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_RRP12/YPL012W:

SGD_Scer_RRP12/YPL012W  Length: 1229  Mon Nov  7 16:44:06 2016  Type: P  Check: 5077  ..

       1  MDQDKVAFLL ELEDKLAKIR SQVNSKLENQ KHIAIILTAV EENIAGQATN

      51  DVSKNIVNYI ISFMSLLDQA VDPSTHEIKD IQLASSSTYL LDLIFHYSPK

     101  VLLRSKFSEI LTKIAPCITA EKANAPLIRA AIGCLESLLI AQDAQAWNNT

     151  YDLNVTPKRG LQGILELSLD VRPKVRKRAL DAVHAVLLNP PVAPTAEHVA

     201  AVFVADFCDK QLAGILNDLS NLSNKQLKAQ KTKEDINASV MRSLRLITSV

     251  VSTGQWPSSQ IEPLCDVLLG VTKSSEQYLV SASFECFESM FKTMAETTIS

     301  SGLAENKYLR VLDTIFALKP SNVDTLLTKS WIAVVIKGMS TYATHQPLKA

     351  LRKIPGVFHI MCTYLASETP EVYQAASQCL ISILSESVKD DLLLYTPSVD

     401  EKVFKNVDEI ISQIAKTFID FLSIRYSHCS REILKILVAA FNKFRYRSNP

     451  HFLKSLKIVD TWRVNEEQFM DLRNEIELVI GASISAMGPE MILAEAPLNL

     501  DNPSSERPGR AWLLPLIRDY TKNANLATFQ NELAPYIKSF QSKFDKVPEE

     551  SIQLRVFQTI VDQIWSTLPR FCELPMDLRE SFTDEFASEL SSLLYSEVEL

     601  RTTICHALKV LAESNVSYAE ESSSHNVLLL QRFPISEAQK NIEYLSTKST

     651  NLLAVLFNVY TQTTPNARSY ILETIDQYLK ITSKEDLEKT FNNVCGLLKN

     701  SMNEESSGNV NKEKKKPQLT ATLLDLIICM ITYLPVSSYS ALFSMFSLTV

     751  NSADALIQKR AYRIITKLSE LKSGSTAVAQ FISDIENVMV DSASSVQTSA

     801  KAARLTAIKT IVELLPLDHL DFIVRTVAEV ILSTKDVNEK SRETAFDTLI

     851  CMGRKMNEPN GIIKLFQIPG YDPTTPDQSS SISEFFKIIS AGLIGESQHM

     901  VSSSITGYAC LVFEFKNELD SGILMDIYDT IELYLTSNSR EIVKSAIGFT

     951  KVCVLGLPEE LMRPKVPELL LKLLRWSHEH TGHFKAKVKH IIERLIRRFG

    1001  YDYIEANFPE EDRRLLTNIR KMRNRNKRKD EEVTTGVSDV AATKGSRFMS

    1051  AFDEAVYGSD EENDNGSDQE ENVAGGKMKN GAKQFIVESG DNPLDLLDSQ

    1101  TLAHISSTRP KKFNKNQNRA RFNDDAFNFD SEGKLVVKGQ PKPSTNVDDP

    1151  LSAVTSGINA YLEAVKSGPV RGQRNKLKFR KNGKDSDEFG DDDDGEKDSR

    1201  LMRGRVNQGN KIGKHNKKGP KFKSRKKL*

Protein Sequence for MIT_Suva_c668_24883:

MIT_Suva_c668_24883  Length: 1229  Mon Nov  7 16:44:06 2016  Type: P  Check: 3441  ..

       1  MDQDQVAFLL ELEDKLAKIR FQATSKLENQ KHVAIILTAV EENIVGQATN

      51  DISKNIVNYI ISFMSLLDQA VDPSTHEIKD LQLASSSTYL LDLIFRYSPK

     101  PLLRSKFSEI LTKIAPCITA EKANAPLIRA AIGCLESLLI AQDAQAWNNT

     151  YDLNVTPKRG LLGILELSLD LRPKVRKRAL DAVHAVLSNP PVAPTAEHVA

     201  AVFVADFCDK QLAGVLDELS NLSNKQLKAQ NTKEDINASV MRSLRLVTSV

     251  ISTGQWPSSQ IEPLCDVLLG VTRSSEQYLV SAAFECFESM FKAMAETTVS

     301  SGLAENKYLR VLDTIFSLKP SNVDTLLTKA WIAVVVKGMS TYAVHQPLKA

     351  LRKIPNVFRV MSTYLASETT EVYQAASQCL ISILSDSIQD HLLLFTPDVD

     401  DKIFKNVDDI ICQISKTFID FLSIKYSHCS REILKILVAA FNKFRYRSNP

     451  HFLKSLKIVD TWRVNEEQFM DLRNEIELVI GASISAMGPE VVLAQAPLNL

     501  DNPSNERPGR AWMLPLIRDY TKNAKLSTFQ NELAPYITSF QSKFDKVPEE

     551  SIQLKVFQTI VEQIWSTLPR FCELPMDLRG SFTDEFASEL SSLLYSEVEL

     601  RTTICHALKV LAESNVLYAE GSLSDDVLLL QHFPISEAQK NIEYLSTKST

     651  NLLAVLFNVY TQTTPNARSY ILETIDQYLK ITSKEDVEKT FNNICGLLKN

     701  SMNEESKGNG NKEKKKPQLT ATLLDLIICM TTYLPASSYS ALFSIFGLTV

     751  CSSDALIQKR AYRIVTKLSE FESGSTAVAQ FISDIENVMV DNTTTVQTSA

     801  KAARLAAIKT IVDLLPFDHL GFIVRTVAEV ILSTKDVNEK SRETAFDTLI

     851  NMGKKMNEPN GIIKLSQIPG YDPATPDQPS SVSEFFKIIS AGLIGESQHM

     901  VSSSITGYAC LVFEFKNEMD SGILMDIYDT IELYLTSNSR EIVKSAIGFT

     951  KVCVLGLPEE VMRPKVPELL LKLLRWSHEH TGHFKAKVKH IIERLIRRFG

    1001  YDYIEANFPE EDRKLLTNIR KARNRSKRKD EEVAPAIDAN AGTTTKGSRF

    1051  MSAFDEAVYG SDNENGNESD QEENAAGGRR KNGQKQFIVE SGENPLDLLD

    1101  SQTLAHISST RPKKFNKNQN KGRFEDDTFN FDSEGKLVVK GQAKPSANAD

    1151  DPLSAVTSGI NAYLEAVKSG PVRGQRNKLK FKKNGKDSDE FGDDGEKDDR

    1201  VMRRKVDPKN KIGKGGKRGP KFKSRKKL*

Protein Sequence for WashU_Sbay_Contig515.7:

WashU_Sbay_Contig515.7  Length: 1229  Mon Nov  7 16:44:06 2016  Type: P  Check: 3441  ..

       1  MDQDQVAFLL ELEDKLAKIR FQATSKLENQ KHVAIILTAV EENIVGQATN

      51  DISKNIVNYI ISFMSLLDQA VDPSTHEIKD LQLASSSTYL LDLIFRYSPK

     101  PLLRSKFSEI LTKIAPCITA EKANAPLIRA AIGCLESLLI AQDAQAWNNT

     151  YDLNVTPKRG LLGILELSLD LRPKVRKRAL DAVHAVLSNP PVAPTAEHVA

     201  AVFVADFCDK QLAGVLDELS NLSNKQLKAQ NTKEDINASV MRSLRLVTSV

     251  ISTGQWPSSQ IEPLCDVLLG VTRSSEQYLV SAAFECFESM FKAMAETTVS

     301  SGLAENKYLR VLDTIFSLKP SNVDTLLTKA WIAVVVKGMS TYAVHQPLKA

     351  LRKIPNVFRV MSTYLASETT EVYQAASQCL ISILSDSIQD HLLLFTPDVD

     401  DKIFKNVDDI ICQISKTFID FLSIKYSHCS REILKILVAA FNKFRYRSNP

     451  HFLKSLKIVD TWRVNEEQFM DLRNEIELVI GASISAMGPE VVLAQAPLNL

     501  DNPSNERPGR AWMLPLIRDY TKNAKLSTFQ NELAPYITSF QSKFDKVPEE

     551  SIQLKVFQTI VEQIWSTLPR FCELPMDLRG SFTDEFASEL SSLLYSEVEL

     601  RTTICHALKV LAESNVLYAE GSLSDDVLLL QHFPISEAQK NIEYLSTKST

     651  NLLAVLFNVY TQTTPNARSY ILETIDQYLK ITSKEDVEKT FNNICGLLKN

     701  SMNEESKGNG NKEKKKPQLT ATLLDLIICM TTYLPASSYS ALFSIFGLTV

     751  CSSDALIQKR AYRIVTKLSE FESGSTAVAQ FISDIENVMV DNTTTVQTSA

     801  KAARLAAIKT IVDLLPFDHL GFIVRTVAEV ILSTKDVNEK SRETAFDTLI

     851  NMGKKMNEPN GIIKLSQIPG YDPATPDQPS SVSEFFKIIS AGLIGESQHM

     901  VSSSITGYAC LVFEFKNEMD SGILMDIYDT IELYLTSNSR EIVKSAIGFT

     951  KVCVLGLPEE VMRPKVPELL LKLLRWSHEH TGHFKAKVKH IIERLIRRFG

    1001  YDYIEANFPE EDRKLLTNIR KARNRSKRKD EEVAPAIDAN AGTTTKGSRF

    1051  MSAFDEAVYG SDNENGNESD QEENAAGGRR KNGQKQFIVE SGENPLDLLD

    1101  SQTLAHISST RPKKFNKNQN KGRFEDDTFN FDSEGKLVVK GQAKPSANAD

    1151  DPLSAVTSGI NAYLEAVKSG PVRGQRNKLK FKKNGKDSDE FGDDGEKDDR

    1201  VMRRKVDPKN KIGKGGKRGP KFKSRKKL*

Protein Sequence for WashU_Scas_Contig702.5:

WashU_Scas_Contig702.5  Length: 1237  Mon Nov  7 16:44:06 2016  Type: P  Check: 3475  ..

       1  MEAEQVAHLL ELEDKLSKIR LQITSKLENQ KHIAIILTAV EENIQDQATN

      51  DTSKNIVNYM ISFMSLLDQA MNPQTHAIQD LQLATSATYL LDIIFHYSPK

     101  KLLSSKFTEI LTKVAPCITD EKAGAPLIRS AIGCLESLLI AQDAQAWNNT

     151  HNLTVTPKRG LQGLLELSLD PRPKVRKRAQ DAVANILKNP PVAPTAEHVA

     201  ASFIAEFAIN SLNDNINELS SLSNKQLKSP GVSEEINSKI TRSLRLIAAI

     251  ISSGQWPATE IENICDMLLK ITKSPDQFLV SASFQCFEQL FQSMAETTIS

     301  SGLAENKYLK MLDTIFSLKP ANTDTHLTGA WIAVVVKGLS TYANAQPLKC

     351  LLKLPQVFHI MATYLQSEHQ EVYTAAAKCL SAILTDSIKD ELLLQPNDVM

     401  DEKTFKTVGD VIEEISNIIT DFLSIKYIHC AKDVLTILAS AFKKVRYRSN

     451  PALLKPLQIV DQWRNNEDTF LEFRNEVENV IGESISALGP ELVLQILPLN

     501  LINPSDDQPG RAWLLPLLRD YTKNAKLATF SKELAPLIQN FESRFASLPK

     551  ESVQLRIFQT VVDQLWSTLP HFCELPIDLP QSFNDEFAAE LSSLLYSRVD

     601  LRTTLCHALR VLVESNSAYA NGALSDDILL QQRFPASEAT KNIEYLQTKS

     651  VNLLSVLFNV YTQTTPTSRG YILETIEAYL KITKSTDLET TFNNICGLLK

     701  NAMESESQTK EESANASSKP QLTATLLDLV VCMTKYLPPS SYAALFNIFG

     751  TTVSSNDALI QKRAYRIITR LSELESGYAA VLTYVSDIEK IILDNADNVQ

     801  TSAKSTRLSA IKTLVNMLPS DHLGFIVRIV AEIILGTKDV NEKTRELAFE

     851  ALIVMGKKMN EPNGIVKLSQ IPGYDPATPD QPSTISEFFK IISAGLIGES

     901  QHMVSSTITA YAYLIFEFKD QLDNSVLLDI YDTVELYLTS NSREIVKSAI

     951  GFAKVCILGL PEELMRSKVP ELLPKLLRWS HEHTGHFKAK VKHLIERLIR

    1001  RFGYEFIEQH FPEEDKRLLT NIRKARNKSK RKGEENAGSA AQPGSSKASK

    1051  FMNAFDEAVY GSSDNEDEGS DAENDEGHND KRGKRRGGKQ FIVERGENPL

    1101  DLLDSETLAH ISSTRPKKFG KDQRKKRLED ETFDFDSEGK LIMKGQKGGN

    1151  NDNDDPLKSV TSGINAYLDA VKSGPVRGQR NKLKFKKNNR GGDDDGFSDD

    1201  EGRSKSAGSK RNISSRGNKV GKNFKNNNKF KSRRKL*