Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YPL011C and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_TAF3/YPL011C   1   MTTNNDFYFALLRISILQLLKAQGFDRARPSLVDVMTDLYAKFLSLLASE   50
MIT_Smik_c688_22242   1   MTTNHDFYFALLRISILQLLKAQGFDRARPSLVDVMTDLYAKFLSLLASE   50
MIT_Spar_c69_23456   1   MTTNHDFYFALLRISILQLLKAQGFDRARPSLVDVMTDLYAKFLSLLASE   50
MIT_Suva_c668_24879   1   MTTNHDFYFALLRISILQLLKAQGFDRARPSLVDVMTDLYTKFLNLLASE   50
WashU_Sbay_Contig515.6   1   MTTNHDFYFALLRISILQLLKAQGFDRARPSLVDVMTDLYTKFLNLLASE   50
WashU_Scas_Contig702.4   1   MTADNEFHFSLLRVSIIQLLKAEGFDTATKTTVNTLTDLYIRYLNKLSSE   50
WashU_Skud_Contig1619.2   1   MTSNHDFYFALLRISILQLLKAQGFDRARPSLVDLMTDLYAKFLGLLASE   50
WashU_Smik_Contig1080.1   1   MTTNHDFYFALLRISILQLLKAQGFDRARPSLVDVMTDLYAKFLSLLASE   50
Symbols






**::::*:*:***:**:*****:*** * : *: :**** ::*. *:**



SGD_Scer_TAF3/YPL011C   51   VSSIAQARCDQDDTIALQDITLALENLGIVKPTNVLDVYDENSE-LSSSR   99
MIT_Smik_c688_22242   51   VSSIAQARCDQDDTVALQDITLALENLGVVKPTNILDVYDENSE-LSSSR   99
MIT_Spar_c69_23456   51   ISSIAQARCDQDDTIALQDITLALENLGIVKPTNVLDVYDENSE-LSSSR   99
MIT_Suva_c668_24879   51   VISIAQSRCDQDDTVALQDITLALENLGIVKPTDVLDVYDENPE-LSSSR   99
WashU_Sbay_Contig515.6   51   VISIAQSRCDQDDTVALQDITLALENLGIVKPTDVLDVYDENPE-LSSSR   99
WashU_Scas_Contig702.4   51   ITSVAQSRG--AASIAIQDISQGFQNLRLFNPINLLDVFDENPANWEMDY   98
WashU_Skud_Contig1619.2   51   ISSIAQARCDQDDTVALQDITVALENLGIVKPTNVLDVYDENSE-LSSSR   99
WashU_Smik_Contig1080.1   51   VSSIAQARCDQDDTVALQDITLALENLGVVKPTNILDVYDENSE-LSSSR   99
Symbols






: *:**:* ::*:***: .::** :.:* ::***:***. . .



SGD_Scer_TAF3/YPL011C   100   GMEKFKDWCIYSTQLTDARITALPTVELLQSE-EKESDPLSAIPDYLNQL   148
MIT_Smik_c688_22242   100   GMEKFKDWCLHSTQLIDTRITTLPTVELLQNE-EKESDPLSTIPDYLNQL   148
MIT_Spar_c69_23456   100   GMEKFKDWCIYSTQLSDTRITALPTVELLQNE-EKESDPLSAIPDYLNQL   148
MIT_Suva_c668_24879   100   GMEKFKEWCG-SAQLRDARITALPTVELLQNE-EKESNPLSAIPDYLNQL   147
WashU_Sbay_Contig515.6   100   GMEKFKEWCG-SAQLRDARITALPTVELLQNE-EKESNPLSAIPDYLNQL   147
WashU_Scas_Contig702.4   99   GFEKWKDIVSSDPHLRNDRLVALPGPEIFQDDSLLKATTTSAVPGYINQY   148
WashU_Skud_Contig1619.2   100   GMEKFKDWCIYSAQLSDARIVALPTVELLQNA-EKESDLLSAIPDYLNQL   148
WashU_Smik_Contig1080.1   100   GMEKFKDWCLHSTQLIDTRITTLPTVELLQNE-EKESDPLSTIPDYLNQL   148
Symbols






*:**:*: ..:* : *:.:** *::*. :: *::*.*:**



SGD_Scer_TAF3/YPL011C   149   LQN--------KGAKQKLETKNRKTELIEDLINNNGLDDWIKLVIARQRI   190
MIT_Smik_c688_22242   149   LQN--------KGAKQKLETKNRKTDLIEDLINNNGLDDWIKLVIARQRI   190
MIT_Spar_c69_23456   149   LQN--------KGAKQKLETKNRKTELIEDLINNNGLDDWIKLVVARQRI   190
MIT_Suva_c668_24879   148   QQN--------KGVKQKLETKNKKTELIEDLINNNGLDDWIKLVVARQRI   189
WashU_Sbay_Contig515.6   148   QQN--------KGVKQKLETKNKKTELIEDLINNNGLDDWIKLVVARQRI   189
WashU_Scas_Contig702.4   149   KDNSAMTNKDDQIIKLKDKATQEEEEEIEELINNGVLDNWIDAIIAKQRL   198
WashU_Skud_Contig1619.2   149   LQN--------KGAKQKLETKNRKNELIEDLINNNELDDWIKLVVARQRI   190
WashU_Smik_Contig1080.1   149   LQN--------KGAKQKLETKNRKTDLIEDLINNNGLDDWIKLVIARQRI   190
Symbols






:* : * * ::.:.: : **:****. **:**. ::*:**:



SGD_Scer_TAF3/YPL011C   191   N----MIERASKKESQNVPALPHIAGYKSSILSRHHHTTITNEDRMPSAM   236
MIT_Smik_c688_22242   191   N----MIERASKKESQNVVALPHIGGYKSSILSRHHHTTITDEDRLPSAM   236
MIT_Spar_c69_23456   191   N----MIERASKKESQNVAALPHITGYKSSILSHHHHTTITNEDRMPSAM   236
MIT_Suva_c668_24879   190   N----LIERASKKDSQNVVALPHIGGYKSSLLSHQHHSTINNEDRLPSTM   235
WashU_Sbay_Contig515.6   190   N----LIERASKKDSQNVVALPHIGGYKSSLLSHQHHSTINNEDRLPSTM   235
WashU_Scas_Contig702.4   199   ELKSGLIQMAATKEERIGIPLPDVVGMNESVLGPSINIEEPNTDLIPTLD   248
WashU_Skud_Contig1619.2   191   N----LIGRASKKEPQNVVTLPHIGGYKSSILSHHRNSTITDEDRLPSAM   236
WashU_Smik_Contig1080.1   191   N----MIERASKKESQNVVALPHIGGYKSSILSRHHHTTITDEDRLPSAM   236
Symbols






: :* *:.*: : .**.: * :.*:*. : : * :*:



SGD_Scer_TAF3/YPL011C   237   TPRDEDALTEIQ-----ENPFVTSKLPIMRKENRLENITLSFEDEELESL   281
MIT_Smik_c688_22242   237   TPRDEDASTEIQ-----ENPYVTSKLPIMRTDNRLENITLSFENEKLESL   281
MIT_Spar_c69_23456   237   TPRDEDALTGIQ-----ENPYVTSKLPIMRKENRLENIALSFEDEELESP   281
MIT_Suva_c668_24879   236   TPRDEDALTEIR-----ENPHVTSKLPIMRTENRLENITLSFENEELEPL   280
WashU_Sbay_Contig515.6   236   TPRDEDALTEIR-----ENPHVTSKLPIMRTENRLENITLSFENEELEPL   280
WashU_Scas_Contig702.4   249   QEDNDDDNENIDSKLKHNVQQYIKLLPVSKPENRLENISLSFENEILS--   296
WashU_Skud_Contig1619.2   237   TARDDDASADIQ-----ANPYVTSKLPIMRAENRLENITLSFENEELESS   281
WashU_Smik_Contig1080.1   237   TPRDEDASTEIQ-----ENPYVTSKLPIMRTDNRLENITLSFENEKLESL   281
Symbols






::* * . **: : :******:****:* *.



SGD_Scer_TAF3/YPL011C   282   GEVEGPNQKSQENNNEESFKENNKSLTESPHGDDRDISMFQFDSNVDTKW   331
MIT_Smik_c688_22242   282   DEIKNPDQISQETNNEQSSKENNQSVTESPHDDDRDISMFQFDSNVDTKW   331
MIT_Spar_c69_23456   282   SEVEDPSQISQENNNEESFKESNKSVTESPHGDDRDISMFQFDSNVDTKW   331
MIT_Suva_c668_24879   281   DVTEDPNQTPDDNNDVDDSKADNKSSAGSPHNDDHDISMFQFDPNVDTKW   330
WashU_Sbay_Contig515.6   281   DVTEDPNQTPDDNNDVDDSKADNKSSAGSPHNDDHDISMFQFDPNVDTKW   330
WashU_Scas_Contig702.4   297   ----------ESEDDQQLSPPPPPSTQEKNEEDTHNTGSLAFNSTNEPTF   336
WashU_Skud_Contig1619.2   282   DEMENSDQAPKDNNNDERSKENNQSETVSPHDDDHDVSMFQFDSNVDTKW   331
WashU_Smik_Contig1080.1   282   DEIKNPDQISQETNNEQSSKENNQSVTESPHDDDRDISMFQFDSNVDTKW   331
Symbols






.. :: : * . . * :: . : *:.. :..:



SGD_Scer_TAF3/YPL011C   332   AEQEDMDSTFQRRTSLDYGGYF   353
MIT_Smik_c688_22242   332   AEQEDMDSTFQRRTSLDYGGYF   353
MIT_Spar_c69_23456   332   AEQEDMDSTFQRRTSLDYGGYF   353
MIT_Suva_c668_24879   331   AEQEDMDSTFQRRTSLDYGGYF   352
WashU_Sbay_Contig515.6   331   AEQEDMDSTFQRRTSLDYGGYF   352
WashU_Scas_Contig702.4   337   AEVEDMDNTFQRRESIEY----   354
WashU_Skud_Contig1619.2   332   AEQEDMDSTFQRRTSLDYGGYF   353
WashU_Smik_Contig1080.1   332   AEQEDMDSTFQRRTSLDYGGYF   353
Symbols






** ****.***** *::*



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_TAF3/YPL011C:

SGD_Scer_TAF3/YPL011C  Length: 354  Mon Nov  7 16:44:04 2016  Type: P  Check: 338  ..

       1  MTTNNDFYFA LLRISILQLL KAQGFDRARP SLVDVMTDLY AKFLSLLASE

      51  VSSIAQARCD QDDTIALQDI TLALENLGIV KPTNVLDVYD ENSELSSSRG

     101  MEKFKDWCIY STQLTDARIT ALPTVELLQS EEKESDPLSA IPDYLNQLLQ

     151  NKGAKQKLET KNRKTELIED LINNNGLDDW IKLVIARQRI NMIERASKKE

     201  SQNVPALPHI AGYKSSILSR HHHTTITNED RMPSAMTPRD EDALTEIQEN

     251  PFVTSKLPIM RKENRLENIT LSFEDEELES LGEVEGPNQK SQENNNEESF

     301  KENNKSLTES PHGDDRDISM FQFDSNVDTK WAEQEDMDST FQRRTSLDYG

     351  GYF*

Protein Sequence for MIT_Smik_c688_22242:

MIT_Smik_c688_22242  Length: 354  Mon Nov  7 16:44:04 2016  Type: P  Check: 1683  ..

       1  MTTNHDFYFA LLRISILQLL KAQGFDRARP SLVDVMTDLY AKFLSLLASE

      51  VSSIAQARCD QDDTVALQDI TLALENLGVV KPTNILDVYD ENSELSSSRG

     101  MEKFKDWCLH STQLIDTRIT TLPTVELLQN EEKESDPLST IPDYLNQLLQ

     151  NKGAKQKLET KNRKTDLIED LINNNGLDDW IKLVIARQRI NMIERASKKE

     201  SQNVVALPHI GGYKSSILSR HHHTTITDED RLPSAMTPRD EDASTEIQEN

     251  PYVTSKLPIM RTDNRLENIT LSFENEKLES LDEIKNPDQI SQETNNEQSS

     301  KENNQSVTES PHDDDRDISM FQFDSNVDTK WAEQEDMDST FQRRTSLDYG

     351  GYF*

Protein Sequence for MIT_Spar_c69_23456:

MIT_Spar_c69_23456  Length: 354  Mon Nov  7 16:44:04 2016  Type: P  Check: 429  ..

       1  MTTNHDFYFA LLRISILQLL KAQGFDRARP SLVDVMTDLY AKFLSLLASE

      51  ISSIAQARCD QDDTIALQDI TLALENLGIV KPTNVLDVYD ENSELSSSRG

     101  MEKFKDWCIY STQLSDTRIT ALPTVELLQN EEKESDPLSA IPDYLNQLLQ

     151  NKGAKQKLET KNRKTELIED LINNNGLDDW IKLVVARQRI NMIERASKKE

     201  SQNVAALPHI TGYKSSILSH HHHTTITNED RMPSAMTPRD EDALTGIQEN

     251  PYVTSKLPIM RKENRLENIA LSFEDEELES PSEVEDPSQI SQENNNEESF

     301  KESNKSVTES PHGDDRDISM FQFDSNVDTK WAEQEDMDST FQRRTSLDYG

     351  GYF*

Protein Sequence for MIT_Suva_c668_24879:

MIT_Suva_c668_24879  Length: 353  Mon Nov  7 16:44:04 2016  Type: P  Check: 9875  ..

       1  MTTNHDFYFA LLRISILQLL KAQGFDRARP SLVDVMTDLY TKFLNLLASE

      51  VISIAQSRCD QDDTVALQDI TLALENLGIV KPTDVLDVYD ENPELSSSRG

     101  MEKFKEWCGS AQLRDARITA LPTVELLQNE EKESNPLSAI PDYLNQLQQN

     151  KGVKQKLETK NKKTELIEDL INNNGLDDWI KLVVARQRIN LIERASKKDS

     201  QNVVALPHIG GYKSSLLSHQ HHSTINNEDR LPSTMTPRDE DALTEIRENP

     251  HVTSKLPIMR TENRLENITL SFENEELEPL DVTEDPNQTP DDNNDVDDSK

     301  ADNKSSAGSP HNDDHDISMF QFDPNVDTKW AEQEDMDSTF QRRTSLDYGG

     351  YF*

Protein Sequence for WashU_Sbay_Contig515.6:

WashU_Sbay_Contig515.6  Length: 353  Mon Nov  7 16:44:04 2016  Type: P  Check: 9875  ..

       1  MTTNHDFYFA LLRISILQLL KAQGFDRARP SLVDVMTDLY TKFLNLLASE

      51  VISIAQSRCD QDDTVALQDI TLALENLGIV KPTDVLDVYD ENPELSSSRG

     101  MEKFKEWCGS AQLRDARITA LPTVELLQNE EKESNPLSAI PDYLNQLQQN

     151  KGVKQKLETK NKKTELIEDL INNNGLDDWI KLVVARQRIN LIERASKKDS

     201  QNVVALPHIG GYKSSLLSHQ HHSTINNEDR LPSTMTPRDE DALTEIRENP

     251  HVTSKLPIMR TENRLENITL SFENEELEPL DVTEDPNQTP DDNNDVDDSK

     301  ADNKSSAGSP HNDDHDISMF QFDPNVDTKW AEQEDMDSTF QRRTSLDYGG

     351  YF*

Protein Sequence for WashU_Scas_Contig702.4:

WashU_Scas_Contig702.4  Length: 355  Mon Nov  7 16:44:04 2016  Type: P  Check: 2672  ..

       1  MTADNEFHFS LLRVSIIQLL KAEGFDTATK TTVNTLTDLY IRYLNKLSSE

      51  ITSVAQSRGA ASIAIQDISQ GFQNLRLFNP INLLDVFDEN PANWEMDYGF

     101  EKWKDIVSSD PHLRNDRLVA LPGPEIFQDD SLLKATTTSA VPGYINQYKD

     151  NSAMTNKDDQ IIKLKDKATQ EEEEEIEELI NNGVLDNWID AIIAKQRLEL

     201  KSGLIQMAAT KEERIGIPLP DVVGMNESVL GPSINIEEPN TDLIPTLDQE

     251  DNDDDNENID SKLKHNVQQY IKLLPVSKPE NRLENISLSF ENEILSESED

     301  DQQLSPPPPP STQEKNEEDT HNTGSLAFNS TNEPTFAEVE DMDNTFQRRE

     351  SIEY*

Protein Sequence for WashU_Skud_Contig1619.2:

WashU_Skud_Contig1619.2  Length: 354  Mon Nov  7 16:44:04 2016  Type: P  Check: 8605  ..

       1  MTSNHDFYFA LLRISILQLL KAQGFDRARP SLVDLMTDLY AKFLGLLASE

      51  ISSIAQARCD QDDTVALQDI TVALENLGIV KPTNVLDVYD ENSELSSSRG

     101  MEKFKDWCIY SAQLSDARIV ALPTVELLQN AEKESDLLSA IPDYLNQLLQ

     151  NKGAKQKLET KNRKNELIED LINNNELDDW IKLVVARQRI NLIGRASKKE

     201  PQNVVTLPHI GGYKSSILSH HRNSTITDED RLPSAMTARD DDASADIQAN

     251  PYVTSKLPIM RAENRLENIT LSFENEELES SDEMENSDQA PKDNNNDERS

     301  KENNQSETVS PHDDDHDVSM FQFDSNVDTK WAEQEDMDST FQRRTSLDYG

     351  GYF*

Protein Sequence for WashU_Smik_Contig1080.1:

WashU_Smik_Contig1080.1  Length: 354  Mon Nov  7 16:44:04 2016  Type: P  Check: 1683  ..

       1  MTTNHDFYFA LLRISILQLL KAQGFDRARP SLVDVMTDLY AKFLSLLASE

      51  VSSIAQARCD QDDTVALQDI TLALENLGVV KPTNILDVYD ENSELSSSRG

     101  MEKFKDWCLH STQLIDTRIT TLPTVELLQN EEKESDPLST IPDYLNQLLQ

     151  NKGAKQKLET KNRKTDLIED LINNNGLDDW IKLVIARQRI NMIERASKKE

     201  SQNVVALPHI GGYKSSILSR HHHTTITDED RLPSAMTPRD EDASTEIQEN

     251  PYVTSKLPIM RTDNRLENIT LSFENEKLES LDEIKNPDQI SQETNNEQSS

     301  KENNQSVTES PHDDDRDISM FQFDSNVDTK WAEQEDMDST FQRRTSLDYG

     351  GYF*