Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YOR247W and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_SRL1/YOR247W   1   ------MLQSVVFFALLTFAS-SVSAIYSNNTVSTTTTLAPSYSLVPQET   43
MIT_Smik_c489_21031   1   ------MFQSTALFALFALIG-SVSAIYSNHTVSATTTLAPSYSLEPHET   43
MIT_Spar_c264_21233   1   ------MFHSVALFALFALTS-SVSAIYSNNTAFTTTTLAPSYSLEPHET   43
MIT_Suva_c154_23503   1   ------MLQATTLFAIFALFTGSVSAIYSNNTAAVTTTLAPSYSLETHET   44
WashU_Scas_Contig653.7   1   MLSSIILPLFIATSALARQYTNSSIAADTTTSKATTVTLQPTYSVQPVLS   50
WashU_Skud_Contig1958.8   1   ------MLQAATFFALLFLAS-SVSAIYSNKTASTTTTLAPSYSLESHET   43
WashU_Smik_Contig2750.6   1   ------MFQSTALFALFALIG-SVSAIYSNHTVSATTTLAPSYSLEPHET   43
Symbols






: . *: * * :. : .*.** *:**: . :



SGD_Scer_SRL1/YOR247W   44   TISYADDTTTFFVTSTVYSTSWFTSTSATITNAASSSLS-----------   82
MIT_Smik_c489_21031   44   TIKYADDTTTFFVTSTVYSTNWFTSTSATVTNAATT--------------   79
MIT_Spar_c264_21233   44   TISYADDTTTFFVTSTVYSTNWFTSTSATITNAATS--------------   79
MIT_Suva_c154_23503   45   TVSYSDETTTYFSTSTVYSTHWFTLNTASVTNAASSSASGSTATASTQET   94
WashU_Scas_Contig653.7   51   TYTYSDDTTTFFVTSTVYATVWYTPSAAATATARTTTLTPAVSN------   94
WashU_Skud_Contig1958.8   44   TVSYADDITTFFVTSTVYSTHWFAPTSATITSAVSS--------------   79
WashU_Smik_Contig2750.6   44   TIKYADDTTTFFVTSTVYSTNWFTSTSATVTNAATT--------------   79
Symbols






* .*:*: **:* *****:* *:: .:*: :.* ::



SGD_Scer_SRL1/YOR247W   83   ---------TSSASGSVTPESTHEITSTSTITSTLLLTLHDSTTLSPSS-   122
MIT_Smik_c489_21031   80   -----------SVSGPAASESTHEITSTSTITSTLLLTLHDITTLAPSS-   117
MIT_Spar_c264_21233   80   -----------SASGSAAPEYTHEITSTSTITSTLLLTLHDTTTLAPSS-   117
MIT_Suva_c154_23503   95   TSTITKAASSSSASGSAASASTHEVTSTSTITSTLLVTLHDTTVLAPSSS   144
WashU_Scas_Contig653.7   95   -----------EVAQVAETISDSQTTYVTTITSTLRITLSNFYGTEISSI   133
WashU_Skud_Contig1958.8   80   --------------GSAAPKSSHEITSTSTITSTLLLTLPDTTTLSPSS-   114
WashU_Smik_Contig2750.6   80   -----------SVSGPAASEFTHEITSTSTITSTLLLTLHDITTLAPSS-   117
Symbols






. . : * .:****** :** : **



SGD_Scer_SRL1/YOR247W   123   -TAASVSDEDSNNKDAKVKSFEQASTSN-GCVPITKFVTVTNEPVTQYVT   170
MIT_Smik_c489_21031   118   -TAVSVNNGDSNNKDAKVRSLDQALTSN-GCVPITKFVTVTNEPVTQYVT   165
MIT_Spar_c264_21233   118   -TAVSVNDEDSNNKDAKVRSIDQASTSN-GCVPITKFVTVTNEPVTQYVT   165
MIT_Suva_c154_23503   145   -AEASIADDGSNNKNANVRSLDQTSTFSNGCVPITQFVTVTKEPVTQYVT   193
WashU_Scas_Contig653.7   134   PSSTAAANANLENKNAAADDSSNNSGAAAQCTPATQYVTITQDPVTQVVT   183
WashU_Skud_Contig1958.8   115   -TAASIAENGSNNKDAKVRSLDQASTSN-GCVPITKFVTVTNEPVTQYVT   162
WashU_Smik_Contig2750.6   118   -TAVSVNNGDSNNKDTKMRSLDQALTSN-GCVPITKFVTVTNEPVTQYVT   165
Symbols






: .: : . :**:: . .: *.* *::**:*::**** **



SGD_Scer_SRL1/YOR247W   171   VTPNTTTQYVTVTGAPSVTTTSPGNVQWYNTTSITNSTSW   210
MIT_Smik_c489_21031   166   VTANTTTQYVTVTGAPSVATTSTGNVQWYNTTLVTNSTRW   205
MIT_Spar_c264_21233   166   VTPNTTTQYVTVTGAPSVTTTSPGNVQWYNTTSITNSTSW   205
MIT_Suva_c154_23503   194   VTPNMTTQYVTVTGASSAATVSTGNVQWFNTTTITN----   229
WashU_Scas_Contig653.7   184   ETQDPVTQYVTVTASFSGFNSTSSNSTVNGTSTYY-----   218
WashU_Skud_Contig1958.8   163   VTPNTTTQYVTVTGAPSVTTGSTGNVQWFNTTSITNSTRW   202
WashU_Smik_Contig2750.6   166   VTANTTTQYVTVTGAPSVATTSTGNVQWYNTTLVTNSTRW   205
Symbols






* : .*******.: * . :..* .*:



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_SRL1/YOR247W:

SGD_Scer_SRL1/YOR247W  Length: 211  Mon Nov  7 16:40:32 2016  Type: P  Check: 7446  ..

       1  MLQSVVFFAL LTFASSVSAI YSNNTVSTTT TLAPSYSLVP QETTISYADD

      51  TTTFFVTSTV YSTSWFTSTS ATITNAASSS LSTSSASGSV TPESTHEITS

     101  TSTITSTLLL TLHDSTTLSP SSTAASVSDE DSNNKDAKVK SFEQASTSNG

     151  CVPITKFVTV TNEPVTQYVT VTPNTTTQYV TVTGAPSVTT TSPGNVQWYN

     201  TTSITNSTSW *

Protein Sequence for MIT_Smik_c489_21031:

MIT_Smik_c489_21031  Length: 206  Mon Nov  7 16:40:32 2016  Type: P  Check: 8604  ..

       1  MFQSTALFAL FALIGSVSAI YSNHTVSATT TLAPSYSLEP HETTIKYADD

      51  TTTFFVTSTV YSTNWFTSTS ATVTNAATTS VSGPAASEST HEITSTSTIT

     101  STLLLTLHDI TTLAPSSTAV SVNNGDSNNK DAKVRSLDQA LTSNGCVPIT

     151  KFVTVTNEPV TQYVTVTANT TTQYVTVTGA PSVATTSTGN VQWYNTTLVT

     201  NSTRW*

Protein Sequence for MIT_Spar_c264_21233:

MIT_Spar_c264_21233  Length: 206  Mon Nov  7 16:40:32 2016  Type: P  Check: 9945  ..

       1  MFHSVALFAL FALTSSVSAI YSNNTAFTTT TLAPSYSLEP HETTISYADD

      51  TTTFFVTSTV YSTNWFTSTS ATITNAATSS ASGSAAPEYT HEITSTSTIT

     101  STLLLTLHDT TTLAPSSTAV SVNDEDSNNK DAKVRSIDQA STSNGCVPIT

     151  KFVTVTNEPV TQYVTVTPNT TTQYVTVTGA PSVTTTSPGN VQWYNTTSIT

     201  NSTSW*

Protein Sequence for MIT_Suva_c154_23503:

MIT_Suva_c154_23503  Length: 229  Mon Nov  7 16:40:32 2016  Type: P  Check: 8221  ..

       1  MLQATTLFAI FALFTGSVSA IYSNNTAAVT TTLAPSYSLE THETTVSYSD

      51  ETTTYFSTST VYSTHWFTLN TASVTNAASS SASGSTATAS TQETTSTITK

     101  AASSSSASGS AASASTHEVT STSTITSTLL VTLHDTTVLA PSSSAEASIA

     151  DDGSNNKNAN VRSLDQTSTF SNGCVPITQF VTVTKEPVTQ YVTVTPNMTT

     201  QYVTVTGASS AATVSTGNVQ WFNTTTITN

Protein Sequence for WashU_Scas_Contig653.7:

WashU_Scas_Contig653.7  Length: 219  Mon Nov  7 16:40:32 2016  Type: P  Check: 1217  ..

       1  MLSSIILPLF IATSALARQY TNSSIAADTT TSKATTVTLQ PTYSVQPVLS

      51  TYTYSDDTTT FFVTSTVYAT VWYTPSAAAT ATARTTTLTP AVSNEVAQVA

     101  ETISDSQTTY VTTITSTLRI TLSNFYGTEI SSIPSSTAAA NANLENKNAA

     151  ADDSSNNSGA AAQCTPATQY VTITQDPVTQ VVTETQDPVT QYVTVTASFS

     201  GFNSTSSNST VNGTSTYY*

Protein Sequence for WashU_Skud_Contig1958.8:

WashU_Skud_Contig1958.8  Length: 203  Mon Nov  7 16:40:32 2016  Type: P  Check: 4676  ..

       1  MLQAATFFAL LFLASSVSAI YSNKTASTTT TLAPSYSLES HETTVSYADD

      51  ITTFFVTSTV YSTHWFAPTS ATITSAVSSG SAAPKSSHEI TSTSTITSTL

     101  LLTLPDTTTL SPSSTAASIA ENGSNNKDAK VRSLDQASTS NGCVPITKFV

     151  TVTNEPVTQY VTVTPNTTTQ YVTVTGAPSV TTGSTGNVQW FNTTSITNST

     201  RW*

Protein Sequence for WashU_Smik_Contig2750.6:

WashU_Smik_Contig2750.6  Length: 206  Mon Nov  7 16:40:32 2016  Type: P  Check: 8350  ..

       1  MFQSTALFAL FALIGSVSAI YSNHTVSATT TLAPSYSLEP HETTIKYADD

      51  TTTFFVTSTV YSTNWFTSTS ATVTNAATTS VSGPAASEFT HEITSTSTIT

     101  STLLLTLHDI TTLAPSSTAV SVNNGDSNNK DTKMRSLDQA LTSNGCVPIT

     151  KFVTVTNEPV TQYVTVTANT TTQYVTVTGA PSVATTSTGN VQWYNTTLVT

     201  NSTRW*