Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YOR065W and Homologs


Choose two or more sequences for alignment:
Pick a sequence type:
Best Hits & Orthologs"Other" Hits

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_CYT1/YOR065W   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
MIT_Smik_c812_19957   1   MFSNLSKRWAQRTLSKSFYSTATGAATKQSKLTQKLVTAGVAVAGITAST   50
MIT_Spar_c476_20568   1   MFSNLSKRWAQRTLSKSFYSTATGVASKPGKLTQKLVTAGVAVAGITAST   50
WashU_Sbay_Contig668.59   1   MFSNLSKRWAQRTLSKGFYSTTTGAAKS-SKLTQRLIAGGVAAAGITAST   49
WashU_Scas_Contig698.35   1   -----MFTNIARNASRRAFSWTAATAPLKSSNTQRFLTTGAILTGLTASS   45
WashU_Sklu_Contig2428.10   
   --------------------------------------------------   
WashU_Skud_Contig1854.2   1   MFSNLSKRWAQRTLSKGFYSTATNAATKPGKFTQKLITAGVAAAGITAST   50
WashU_Smik_Contig2585.2   1   MFSNLSKRWAQRTLSKSFYSTATGAATKQSKLTQKLVTAGVAVAGITAST   50
Symbols










SGD_Scer_CYT1/YOR065W   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
MIT_Smik_c812_19957   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
MIT_Spar_c476_20568   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
WashU_Sbay_Contig668.59   50   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   99
WashU_Scas_Contig698.35   46   LLYADSLTADAMTAAEHGLHPPSYAWSHNGPLETFDHASIRRGYQVYREV   95
WashU_Sklu_Contig2428.10   1   -----------MTAAEHGLHPPAYGWSHNGPFDTFDHASIRRGYQVYREV   39
WashU_Skud_Contig1854.2   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
WashU_Smik_Contig2585.2   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
Symbols






*********.*:*.******::*****************



SGD_Scer_CYT1/YOR065W   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
MIT_Smik_c812_19957   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
MIT_Spar_c476_20568   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
WashU_Sbay_Contig668.59   100   CAACHSLDRVAWRTLVGVSHTNEEVRVMAEEFEYDDEPDEQGNPKKRPGK   149
WashU_Scas_Contig698.35   96   CAACHSLDRVAWRTMVGVSHTVDEVKEMAAEFEYDDEPDEQGNPKKRAGK   145
WashU_Sklu_Contig2428.10   40   CAACHSMDRVAWRTMVGVSHTNAEVRAMAEEFEYDDEPDDQGNPKKRAGK   89
WashU_Skud_Contig1854.2   101   CAACHSLDRVAWRTLVGVSHHQRRGSX-----------------------   127
WashU_Smik_Contig2585.2   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
Symbols






******:*******:***** .



SGD_Scer_CYT1/YOR065W   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
MIT_Smik_c812_19957   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
MIT_Spar_c476_20568   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
WashU_Sbay_Contig668.59   150   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   199
WashU_Scas_Contig698.35   146   LADYIPAPYPNEQAARAANQGALPPDLSLIVKARHGGPDYLFALLTGYPE   195
WashU_Sklu_Contig2428.10   90   LADYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGADYIFALLTGYPD   139
WashU_Skud_Contig1854.2   
   --------------------------------------------------   
WashU_Smik_Contig2585.2   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
Symbols










SGD_Scer_CYT1/YOR065W   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
MIT_Smik_c812_19957   201   DPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
MIT_Spar_c476_20568   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
WashU_Sbay_Contig668.59   200   DPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYDDGTPATTSQMAKD   249
WashU_Scas_Contig698.35   196   DPPEGVVLPPGSNYNPYFPGGAIAMARVLFNDLVEYEDGTPATTSQMAKD   245
WashU_Sklu_Contig2428.10   140   EPPAGVVLPPGSNYNPYFPGGSIAMARVLFDDLVEYEDGTPATTSQMAKD   189
WashU_Skud_Contig1854.2   
   --------------------------------------------------   
WashU_Smik_Contig2585.2   201   DPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
Symbols










SGD_Scer_CYT1/YOR065W   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
MIT_Smik_c812_19957   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
MIT_Spar_c476_20568   251   VTTFLNWCAEPEHDDRKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
WashU_Sbay_Contig668.59   250   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYFLSIWVKKFKWAGIKNRKF   299
WashU_Scas_Contig698.35   246   VTTFLQWAAEPEHDERKRLGLKAILILSSLYLLSVWVKKFKWAGIKTRKF   295
WashU_Sklu_Contig2428.10   190   VTTYLNWCSEPEHDERKRLGIKAVIVLSSLYLLSVWVKKFKWASIKSRKF   239
WashU_Skud_Contig1854.2   
   --------------------------------------------------   
WashU_Smik_Contig2585.2   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
Symbols










SGD_Scer_CYT1/YOR065W   301   VFNPPKPRK------------   309
MIT_Smik_c812_19957   301   VFNPPKPRK------------   309
MIT_Spar_c476_20568   301   VFNPPKPRK------------   309
WashU_Sbay_Contig668.59   300   VFNPPKPRK------------   308
WashU_Scas_Contig698.35   296   VYNPPTKKPQFKTPTFPPKKN   316
WashU_Sklu_Contig2428.10   240   VFNPPKK--------------   246
WashU_Skud_Contig1854.2   
   ---------------------   
WashU_Smik_Contig2585.2   301   VFNPPKPRK------------   309
Symbols










Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_CYT1/YOR065W:

SGD_Scer_CYT1/YOR065W  Length: 310  Mon Nov  7 16:36:40 2016  Type: P  Check: 3974  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*

Protein Sequence for MIT_Smik_c812_19957:

MIT_Smik_c812_19957  Length: 310  Mon Nov  7 16:36:40 2016  Type: P  Check: 5176  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAATKQS KLTQKLVTAG VAVAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  DPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*

Protein Sequence for MIT_Spar_c476_20568:

MIT_Spar_c476_20568  Length: 310  Mon Nov  7 16:36:40 2016  Type: P  Check: 5278  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGVASKPG KLTQKLVTAG VAVAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDDRKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*

Protein Sequence for WashU_Sbay_Contig668.59:

WashU_Sbay_Contig668.59  Length: 309  Mon Nov  7 16:36:40 2016  Type: P  Check: 1926  ..

       1  MFSNLSKRWA QRTLSKGFYS TTTGAAKSSK LTQRLIAGGV AAAGITASTL

      51  LYADSLTAEA MTAAEHGLHA PAYAWSHNGP FETFDHASIR RGYQVYREVC

     101  AACHSLDRVA WRTLVGVSHT NEEVRVMAEE FEYDDEPDEQ GNPKKRPGKL

     151  SDYIPGPYPN EQAARAANQG ALPPDLSLIV KARHGGCDYI FSLLTGYPDD

     201  PPAGVALPPG SNYNPYFPGG SIAMARVLFD DMVEYDDGTP ATTSQMAKDV

     251  TTFLNWCAEP EHDERKRLGL KTVIILSSLY FLSIWVKKFK WAGIKNRKFV

     301  FNPPKPRK*

Protein Sequence for WashU_Scas_Contig698.35:

WashU_Scas_Contig698.35  Length: 317  Mon Nov  7 16:36:40 2016  Type: P  Check: 8945  ..

       1  MFTNIARNAS RRAFSWTAAT APLKSSNTQR FLTTGAILTG LTASSLLYAD

      51  SLTADAMTAA EHGLHPPSYA WSHNGPLETF DHASIRRGYQ VYREVCAACH

     101  SLDRVAWRTM VGVSHTVDEV KEMAAEFEYD DEPDEQGNPK KRAGKLADYI

     151  PAPYPNEQAA RAANQGALPP DLSLIVKARH GGPDYLFALL TGYPEDPPEG

     201  VVLPPGSNYN PYFPGGAIAM ARVLFNDLVE YEDGTPATTS QMAKDVTTFL

     251  QWAAEPEHDE RKRLGLKAIL ILSSLYLLSV WVKKFKWAGI KTRKFVYNPP

     301  TKKPQFKTPT FPPKKN*

Protein Sequence for WashU_Sklu_Contig2428.10:

WashU_Sklu_Contig2428.10  Length: 247  Mon Nov  7 16:36:40 2016  Type: P  Check: 9277  ..

       1  MTAAEHGLHP PAYGWSHNGP FDTFDHASIR RGYQVYREVC AACHSMDRVA

      51  WRTMVGVSHT NAEVRAMAEE FEYDDEPDDQ GNPKKRAGKL ADYIPGPYPN

     101  EQAARAANQG ALPPDLSLIV KARHGGADYI FALLTGYPDE PPAGVVLPPG

     151  SNYNPYFPGG SIAMARVLFD DLVEYEDGTP ATTSQMAKDV TTYLNWCSEP

     201  EHDERKRLGI KAVIVLSSLY LLSVWVKKFK WASIKSRKFV FNPPKK*


Protein Sequence for WashU_Skud_Contig1854.2:

WashU_Skud_Contig1854.2  Length: 127  Mon Nov  7 16:36:40 2016  Type: P  Check: 8455  ..

       1  MFSNLSKRWA QRTLSKGFYS TATNAATKPG KFTQKLITAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH HQRRGSX

Protein Sequence for WashU_Smik_Contig2585.2:

WashU_Smik_Contig2585.2  Length: 310  Mon Nov  7 16:36:40 2016  Type: P  Check: 5176  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAATKQS KLTQKLVTAG VAVAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  DPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*