Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YOL115W and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_PAP2/YOL115W   1   -MGAKSVTASSSKKIKNRHNGKVKKSKKIKKVRKPQKSISLNDENEVEIL   49
MIT_Smik_c400_19754   1   -MGSKSIAASSLKKSKKQHSGKVKKSKKIKKSRKSKKSKSLSDENGAEVT   49
MIT_Spar_c315_19876   1   -MGAKSIAASSTKKIKKQHNGKVKKSKKIKKVRKSKKPKSLSDENGVEIV   49
MIT_Suva_c57_22082   1   -MGVKSITTSSSKKSKKQHNGKVKKNKKVKKVRKSKKPRSTSDDNEAESS   49
WashU_Sbay_Contig659.39   1   -MGVKSITTSSSKKSKKQHNGKVKKNKKVKKVRKSKKPRSTSDDNEAESS   49
WashU_Scas_Contig637.18   1   -MATKSTTSSIKQKPEKIKSKKIEISK--GKGMKNSSKSKNSKHGKKSMR   47
WashU_Skud_Contig1896.8   1   MGAKSIVASSSSKKSKKQHNGKMKKNKKIKKVRKSKKDTSTSDENEAGNL   50
Symbols






. . ::* :* :: :. *:: .* * * .. . ....



SGD_Scer_PAP2/YOL115W   50   PSRNEQETNKLPKDHVTADGILVLEHKSDDDEGFDVYDGHFDNPTDIPST   99
MIT_Smik_c400_19754   50   SSRSEQDNNKSPDDHVTEDGILVLEHKSDDDEGFDDYDGHFDNPTDIPST   99
MIT_Spar_c315_19876   50   SSRNDQETNTSLKDHVTADGILVLEHKSDDDEGFDVYDGHFDNPTDIPST   99
MIT_Suva_c57_22082   50   VKDNEEESKKASGDHVTADGILVLENKSDDDEGFDDYDGHFDNPTDVPST   99
WashU_Sbay_Contig659.39   50   VKDNEEESKKASGDHVTADGILVLENKSDDDEGFDDYDGHFDNPTDVPST   99
WashU_Scas_Contig637.18   48   RSKNKNQNNKPPTTVRSTDGITFLES-SSESEGYDDYDGHFDNPTESEDK   96
WashU_Skud_Contig1896.8   51   PKLNDQEINKNPDDHVTSDGILVLEKKSDDDEGFDDYDGHFDNPTDVPST   100
Symbols






. ..:: :. : *** .** *.:.**:* *********: ..



SGD_Scer_PAP2/YOL115W   100   TEESKTPSLAVHGDEKDLANNDDFISLSASSEDEQAEQ-EEEREKQELEI   148
MIT_Smik_c400_19754   100   TEGSKTPLLGVHGDEKDLANNDDFISLSASSEDEHAEQ-EEERQKE----   144
MIT_Spar_c315_19876   100   TEESRTPSLAVHGNEKDLANNDDFISLSASSEDEQAEQ-EEERQKEELEV   148
MIT_Suva_c57_22082   100   AEGSKTPLLVVHGNENDLANNDDYIALSASSEDEDAKQKEEEKQKKEEEI   149
WashU_Sbay_Contig659.39   100   AEGSKTPLLVVHGNENDLANNDDYIALSASSEDEDAKQKEEEKQKKEEEI   149
WashU_Scas_Contig637.18   97   DLKMAKVAVEKVPQLQNNKLEDNQDFIAFSASSSDEKDIQEKQALEVDEQ   146
WashU_Skud_Contig1896.8   101   TEENKTPLLTVHGSERDLANNDDFISLSASSEDEDAKKEEEERQKKEAEL   150
Symbols






. : . .: :*: :: *:.... :. :*:: :



SGD_Scer_PAP2/YOL115W   149   KKEKQKEILNTDYPWILNHDHSKQKEISDWLTFEIKDFVAYISPSREEIE   198
MIT_Smik_c400_19754   145   --EKQKEILNTDYPWIVNHDHSRQKEISDWLTFEIKDFVAYISPSREEIE   192
MIT_Spar_c315_19876   149   KKKKQKEILNTDYPWILNHDHSKQKEISDWLTFEIKDFVAYISPSREEIE   198
MIT_Suva_c57_22082   150   LKRKQKEILNTDYPWILNHDHSKQTEISDWLTFEIKDFVAYISPSREEIE   199
WashU_Sbay_Contig659.39   150   LKRKQKEILNTDYPWILNHDHSKQTEISDWLTFEIKDFVAYISPSREEIE   199
WashU_Scas_Contig637.18   147   VTKEPTKILKSDYPWIINHDHSKQKEISDWLTLEIADFVSYISPSREEIE   196
WashU_Skud_Contig1896.8   151   LRIRQKEILNTDYPWILNHDHSRQKEISDWLTFEIKDFVAYISPSREEIE   200
Symbols






. .:**::*****:*****:*.*******:** ***:**********



SGD_Scer_PAP2/YOL115W   199   IRNQTISTIREAVKQLWPDADLHVFGSYSTDLYLPGSDIDCVVTSELGGK   248
MIT_Smik_c400_19754   193   IRNQTISTIREAVRQLWPDADLHVFGSYSTDLYLPGSDIDCVVNSELGGK   242
MIT_Spar_c315_19876   199   IRNQTISSIREAVKQLWPDADLHVFGSYSTDLYLPGSDIDCVVTSELGGK   248
MIT_Suva_c57_22082   200   VRNQTISTIREAVKQLWSDADLHVFGSYSTDLYLPGSDIDCVVNSELGGK   249
WashU_Sbay_Contig659.39   200   VRNQTISTIREAVKQLWSDADLHVFGSYSTDLYLPGSDIDCVVNSELGGK   249
WashU_Scas_Contig637.18   197   SRNQTISKVRNAVKQLWPDADLHVFGSYATDLYLPGSDIDCVINSKAGDK   246
WashU_Skud_Contig1896.8   201   IRNQTISTIREALKQLWPDADLHVFGSYSTDLYLPGSDIDCVVNSELGGK   250
Symbols






******.:*:*::***.**********:*************:.*: *.*



SGD_Scer_PAP2/YOL115W   249   ESRNNLYSLASHLKKKNLATEVEVVAKARVPIIKFVEPHSGIHIDVSFER   298
MIT_Smik_c400_19754   243   ESRTNLYSLASHLKKNNLATEIEVVAKARVPIIKFVEPHSGIHIDVSFER   292
MIT_Spar_c315_19876   249   ESRNNLYSLASHLKKKNLATEVEVVAKARVPIIKFVEPHSGIHIDVSFER   298
MIT_Suva_c57_22082   250   ESRNNLYSLASHLKKNNLATEIEVVAKARVPIIKFVEPHSGIHIDVSFER   299
WashU_Sbay_Contig659.39   250   ESRNNLYSLASHLKKNNLATEIEVVAKARVPIIKFVEPHSGIHIDVSFER   299
WashU_Scas_Contig637.18   247   ENRNSLYSLASFLKQQGLATQIEVIAKTRVPIIKFVEPESNIHIDVSFER   296
WashU_Skud_Contig1896.8   251   ESRNNLYSLASHLKKNNLATEIEVVAKARVPIIKFVEPHSRIHIDVSFER   300
Symbols






*.*..******.**::.***::**:**:**********.* *********



SGD_Scer_PAP2/YOL115W   299   TNGIEAAKLIREWLDDTPGLRELVLIVKQFLHARRLNNVHTGGLGGFSII   348
MIT_Smik_c400_19754   293   TNGLEAAKLIREWLNDTPGLRELVLIVKQFLHARRLNNVHTGGLGGFSII   342
MIT_Spar_c315_19876   299   TNGLEAAKLIREWLNDTPGLRELVLIVKQFLHARRLNNVHTGGLGGFSII   348
MIT_Suva_c57_22082   300   TNGLEAAKLIREWLNDTPGLRELVLIVKQFLHSRRLNNVHTGGLGGFSII   349
WashU_Sbay_Contig659.39   300   TNGLEAAKLIREWLNDTPGLRELVLIVKQFLHSRRLNNVHTGGLGGFSII   349
WashU_Scas_Contig637.18   297   TNGLEAAKLIREWLQDTPGLRELVLIIKQFLHSRRLNNVHTGGLGGFSII   346
WashU_Skud_Contig1896.8   301   TNGLEAAKLIREWLNDTPGLRELVLIVKQFLHARRLNNVHTGGLGGFSII   350
Symbols






***:**********:***********:*****:*****************



SGD_Scer_PAP2/YOL115W   349   CLVFSFLHMHPRIITNEIDPKDNLGVLLIEFFELYGKNFGYDDVALGSSD   398
MIT_Smik_c400_19754   343   CLVFSFLHMHPRIITNEIDPKDNLGVLLIEFFELYGKNFGYDDVALGSSD   392
MIT_Spar_c315_19876   349   CLVFSFLHMHPRIITNEIDPKDNLGVLLIEFFELYGKNFGYDDVALGSSD   398
MIT_Suva_c57_22082   350   CLVFSFLHMHPRIITREIDPKDNLGVLLIEFFELYGKNFGYDDVALGSSD   399
WashU_Sbay_Contig659.39   350   CLVFSFLHMHPRIITREIDPKDNLGVLLIEFFELYGKNFGYDDVALGSSD   399
WashU_Scas_Contig637.18   347   CIVFSFLQMHPRIITNEIDPMENLGVLLIEFFELYGKNFGYDDVAISVTD   396
WashU_Skud_Contig1896.8   351   CLVFSFLHMHPRIITKEIDSKDNLGVLLIEFFELYGKNFGYDDVALGSSD   400
Symbols






*:*****:*******.***. :***********************:. :*



SGD_Scer_PAP2/YOL115W   399   GYPVYFPKSTWSAIQPIKNPFSLAIQDPGDESNNISRGSFNIRDIKKAFA   448
MIT_Smik_c400_19754   393   GYPVYFPKLAWSAILPIKNPFSLAIQDPGDESNNISRGSFNIRDIKKAFA   442
MIT_Spar_c315_19876   399   GYPVYFPKSAWSAIQPIKNPFSLAIQDPGDESNNISRGSFNIRDIKKAFA   448
MIT_Suva_c57_22082   400   GYPVYFPKSTWNAIQPIKNPFTLAIQDPGDEANNISRGTFNIRDIKKAFA   449
WashU_Sbay_Contig659.39   400   GYPVYFPKSTWNAIQPIKNPFTLAIQDPGDEANNISRGTFNIRDIKKAFA   449
WashU_Scas_Contig637.18   397   GYPSYLPKSSWKGLQQTRGSFSLAIQDPGDETNNISRGSFNLRDIKKGFA   446
WashU_Skud_Contig1896.8   401   GYPIYFPKSSWSAIQPIKNPFSLAIQDPGDESNNISRGSFNIRDIKKAFA   450
Symbols






*** *:** :*..: :..*:*********:******:**:*****.**



SGD_Scer_PAP2/YOL115W   449   GAFDLLTNRCFELHSATFKDRLGKSILGNVIKYRGKARDFKDERGLVLNK   498
MIT_Smik_c400_19754   443   GAFDLLTNRCFELHSATFKDRLGKSILGNVIKYRGKARDFKDERGLVLNK   492
MIT_Spar_c315_19876   449   GAFDLLTNRCFELHSATFKDRLGKSILGNVIKYRGKARDFKDERGLVLNK   498
MIT_Suva_c57_22082   450   GAFDLLTNRCFELHSATFKDRLGKSILGNVIKYRGKARDFKDERGLVLNK   499
WashU_Sbay_Contig659.39   450   GAFDLLTNRCFELHSATFKDRLGKSILGNVIKYRGKARDFKDERGLVLNK   499
WashU_Scas_Contig637.18   447   GAFDLLTNRCFELDQTSFKQRVGKSILGNVIKYRGKERDFKDERSLVVNK   496
WashU_Skud_Contig1896.8   451   GAFDLLTNRCFELHSATFKDRLGKSILGNVIKYRGKARDFKDERGLVLNK   500
Symbols






*************..::**:*:************** *******.**:**



SGD_Scer_PAP2/YOL115W   499   AIIENENYHKKRSRIIHDEDFAEDTVTSTATATTTDDDYEITNPPAKKAK   548
MIT_Smik_c400_19754   493   AIIENENYHKKRSRIIHDEEFTEDTVTS----TATDDDYEIIRPPAKKAK   538
MIT_Spar_c315_19876   499   AIIENENYHKKRSRIIHDEDFTEETATSTATATTTDDDYEITNPPTKKAK   548
MIT_Suva_c57_22082   500   AIIENENYHKKRSRIIHDEEFAEDIVTSTATASTTEDDYDIIEPPTKKAK   549
WashU_Sbay_Contig659.39   500   AIIENENYHKKRSRIIHDEEFAEDIVTSTATASTTEDDYDIIEPPTKKAK   549
WashU_Scas_Contig637.18   497   AIVENEKYHKKRSRIVHKVNPDEVSQTVEVVADEDDGDDMYIVEEPPSKK   546
WashU_Skud_Contig1896.8   501   AIIENENYHKKRSRIIHDEEFTEDTATS--TATTTEDDYEIIEPPTKRAR   548
Symbols






**:***:********:*. : * * :.* . :



SGD_Scer_PAP2/YOL115W   549   IEEKPE---SEPAKRNSGETYITVSSE-DDD----EDGYNPYTL-   584
MIT_Smik_c400_19754   539   MEVLEPGFISEPSKEKSGETHITISSENDDDD---EDGYNPYTL-   579
MIT_Spar_c315_19876   549   IEAEPK---IEPAKEESGETHIIISSE-DDDD---EDGYNPYTL-   585
MIT_Suva_c57_22082   550   TKFSEPEAKKEPLKEKSEETYITISSGDDDD----EDGYNPYSL-   589
WashU_Sbay_Contig659.39   550   TKFSEPEAKKEPLKEKSEETYITISSGDDDD----EDGYNPYSL-   589
WashU_Scas_Contig637.18   547   RK-KSSNKAEKIKKKKTVDSYMGLPSEEKED----EDDYNPTLLR   586
WashU_Skud_Contig1896.8   549   TETVKPQPKSEPSEKKSEESHITISSDDDDDDDEDEDGYNPYSL-   592
Symbols






: : :.:: :::: :.* .:* **.*** *



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_PAP2/YOL115W:

SGD_Scer_PAP2/YOL115W  Length: 585  Mon Nov  7 16:34:18 2016  Type: P  Check: 2420  ..

       1  MGAKSVTASS SKKIKNRHNG KVKKSKKIKK VRKPQKSISL NDENEVEILP

      51  SRNEQETNKL PKDHVTADGI LVLEHKSDDD EGFDVYDGHF DNPTDIPSTT

     101  EESKTPSLAV HGDEKDLANN DDFISLSASS EDEQAEQEEE REKQELEIKK

     151  EKQKEILNTD YPWILNHDHS KQKEISDWLT FEIKDFVAYI SPSREEIEIR

     201  NQTISTIREA VKQLWPDADL HVFGSYSTDL YLPGSDIDCV VTSELGGKES

     251  RNNLYSLASH LKKKNLATEV EVVAKARVPI IKFVEPHSGI HIDVSFERTN

     301  GIEAAKLIRE WLDDTPGLRE LVLIVKQFLH ARRLNNVHTG GLGGFSIICL

     351  VFSFLHMHPR IITNEIDPKD NLGVLLIEFF ELYGKNFGYD DVALGSSDGY

     401  PVYFPKSTWS AIQPIKNPFS LAIQDPGDES NNISRGSFNI RDIKKAFAGA

     451  FDLLTNRCFE LHSATFKDRL GKSILGNVIK YRGKARDFKD ERGLVLNKAI

     501  IENENYHKKR SRIIHDEDFA EDTVTSTATA TTTDDDYEIT NPPAKKAKIE

     551  EKPESEPAKR NSGETYITVS SEDDDEDGYN PYTL*

Protein Sequence for MIT_Smik_c400_19754:

MIT_Smik_c400_19754  Length: 580  Mon Nov  7 16:34:18 2016  Type: P  Check: 3898  ..

       1  MGSKSIAASS LKKSKKQHSG KVKKSKKIKK SRKSKKSKSL SDENGAEVTS

      51  SRSEQDNNKS PDDHVTEDGI LVLEHKSDDD EGFDDYDGHF DNPTDIPSTT

     101  EGSKTPLLGV HGDEKDLANN DDFISLSASS EDEHAEQEEE RQKEEKQKEI

     151  LNTDYPWIVN HDHSRQKEIS DWLTFEIKDF VAYISPSREE IEIRNQTIST

     201  IREAVRQLWP DADLHVFGSY STDLYLPGSD IDCVVNSELG GKESRTNLYS

     251  LASHLKKNNL ATEIEVVAKA RVPIIKFVEP HSGIHIDVSF ERTNGLEAAK

     301  LIREWLNDTP GLRELVLIVK QFLHARRLNN VHTGGLGGFS IICLVFSFLH

     351  MHPRIITNEI DPKDNLGVLL IEFFELYGKN FGYDDVALGS SDGYPVYFPK

     401  LAWSAILPIK NPFSLAIQDP GDESNNISRG SFNIRDIKKA FAGAFDLLTN

     451  RCFELHSATF KDRLGKSILG NVIKYRGKAR DFKDERGLVL NKAIIENENY

     501  HKKRSRIIHD EEFTEDTVTS TATDDDYEII RPPAKKAKME VLEPGFISEP

     551  SKEKSGETHI TISSENDDDD EDGYNPYTL*

Protein Sequence for MIT_Spar_c315_19876:

MIT_Spar_c315_19876  Length: 586  Mon Nov  7 16:34:18 2016  Type: P  Check: 2387  ..

       1  MGAKSIAASS TKKIKKQHNG KVKKSKKIKK VRKSKKPKSL SDENGVEIVS

      51  SRNDQETNTS LKDHVTADGI LVLEHKSDDD EGFDVYDGHF DNPTDIPSTT

     101  EESRTPSLAV HGNEKDLANN DDFISLSASS EDEQAEQEEE RQKEELEVKK

     151  KKQKEILNTD YPWILNHDHS KQKEISDWLT FEIKDFVAYI SPSREEIEIR

     201  NQTISSIREA VKQLWPDADL HVFGSYSTDL YLPGSDIDCV VTSELGGKES

     251  RNNLYSLASH LKKKNLATEV EVVAKARVPI IKFVEPHSGI HIDVSFERTN

     301  GLEAAKLIRE WLNDTPGLRE LVLIVKQFLH ARRLNNVHTG GLGGFSIICL

     351  VFSFLHMHPR IITNEIDPKD NLGVLLIEFF ELYGKNFGYD DVALGSSDGY

     401  PVYFPKSAWS AIQPIKNPFS LAIQDPGDES NNISRGSFNI RDIKKAFAGA

     451  FDLLTNRCFE LHSATFKDRL GKSILGNVIK YRGKARDFKD ERGLVLNKAI

     501  IENENYHKKR SRIIHDEDFT EETATSTATA TTTDDDYEIT NPPTKKAKIE

     551  AEPKIEPAKE ESGETHIIIS SEDDDDEDGY NPYTL*

Protein Sequence for MIT_Suva_c57_22082:

MIT_Suva_c57_22082  Length: 590  Mon Nov  7 16:34:18 2016  Type: P  Check: 8171  ..

       1  MGVKSITTSS SKKSKKQHNG KVKKNKKVKK VRKSKKPRST SDDNEAESSV

      51  KDNEEESKKA SGDHVTADGI LVLENKSDDD EGFDDYDGHF DNPTDVPSTA

     101  EGSKTPLLVV HGNENDLANN DDYIALSASS EDEDAKQKEE EKQKKEEEIL

     151  KRKQKEILNT DYPWILNHDH SKQTEISDWL TFEIKDFVAY ISPSREEIEV

     201  RNQTISTIRE AVKQLWSDAD LHVFGSYSTD LYLPGSDIDC VVNSELGGKE

     251  SRNNLYSLAS HLKKNNLATE IEVVAKARVP IIKFVEPHSG IHIDVSFERT

     301  NGLEAAKLIR EWLNDTPGLR ELVLIVKQFL HSRRLNNVHT GGLGGFSIIC

     351  LVFSFLHMHP RIITREIDPK DNLGVLLIEF FELYGKNFGY DDVALGSSDG

     401  YPVYFPKSTW NAIQPIKNPF TLAIQDPGDE ANNISRGTFN IRDIKKAFAG

     451  AFDLLTNRCF ELHSATFKDR LGKSILGNVI KYRGKARDFK DERGLVLNKA

     501  IIENENYHKK RSRIIHDEEF AEDIVTSTAT ASTTEDDYDI IEPPTKKAKT

     551  KFSEPEAKKE PLKEKSEETY ITISSGDDDD EDGYNPYSL*

Protein Sequence for WashU_Sbay_Contig659.39:

WashU_Sbay_Contig659.39  Length: 590  Mon Nov  7 16:34:18 2016  Type: P  Check: 8171  ..

       1  MGVKSITTSS SKKSKKQHNG KVKKNKKVKK VRKSKKPRST SDDNEAESSV

      51  KDNEEESKKA SGDHVTADGI LVLENKSDDD EGFDDYDGHF DNPTDVPSTA

     101  EGSKTPLLVV HGNENDLANN DDYIALSASS EDEDAKQKEE EKQKKEEEIL

     151  KRKQKEILNT DYPWILNHDH SKQTEISDWL TFEIKDFVAY ISPSREEIEV

     201  RNQTISTIRE AVKQLWSDAD LHVFGSYSTD LYLPGSDIDC VVNSELGGKE

     251  SRNNLYSLAS HLKKNNLATE IEVVAKARVP IIKFVEPHSG IHIDVSFERT

     301  NGLEAAKLIR EWLNDTPGLR ELVLIVKQFL HSRRLNNVHT GGLGGFSIIC

     351  LVFSFLHMHP RIITREIDPK DNLGVLLIEF FELYGKNFGY DDVALGSSDG

     401  YPVYFPKSTW NAIQPIKNPF TLAIQDPGDE ANNISRGTFN IRDIKKAFAG

     451  AFDLLTNRCF ELHSATFKDR LGKSILGNVI KYRGKARDFK DERGLVLNKA

     501  IIENENYHKK RSRIIHDEEF AEDIVTSTAT ASTTEDDYDI IEPPTKKAKT

     551  KFSEPEAKKE PLKEKSEETY ITISSGDDDD EDGYNPYSL*

Protein Sequence for WashU_Scas_Contig637.18:

WashU_Scas_Contig637.18  Length: 587  Mon Nov  7 16:34:18 2016  Type: P  Check: 2274  ..

       1  MATKSTTSSI KQKPEKIKSK KIEISKGKGM KNSSKSKNSK HGKKSMRRSK

      51  NKNQNNKPPT TVRSTDGITF LESSSESEGY DDYDGHFDNP TESEDKDLKM

     101  AKVAVEKVPQ LQNNKLEDNQ DFIAFSASSS DEKDIQEKQA LEVDEQVTKE

     151  PTKILKSDYP WIINHDHSKQ KEISDWLTLE IADFVSYISP SREEIESRNQ

     201  TISKVRNAVK QLWPDADLHV FGSYATDLYL PGSDIDCVIN SKAGDKENRN

     251  SLYSLASFLK QQGLATQIEV IAKTRVPIIK FVEPESNIHI DVSFERTNGL

     301  EAAKLIREWL QDTPGLRELV LIIKQFLHSR RLNNVHTGGL GGFSIICIVF

     351  SFLQMHPRII TNEIDPMENL GVLLIEFFEL YGKNFGYDDV AISVTDGYPS

     401  YLPKSSWKGL QQTRGSFSLA IQDPGDETNN ISRGSFNLRD IKKGFAGAFD

     451  LLTNRCFELD QTSFKQRVGK SILGNVIKYR GKERDFKDER SLVVNKAIVE

     501  NEKYHKKRSR IVHKVNPDEV SQTVEVVADE DDGDDMYIVE EPPSKKRKKS

     551  SNKAEKIKKK KTVDSYMGLP SEEKEDEDDY NPTLLR*

Protein Sequence for WashU_Skud_Contig1896.8:

WashU_Skud_Contig1896.8  Length: 593  Mon Nov  7 16:34:18 2016  Type: P  Check: 1957  ..

       1  MGAKSIVASS SSKKSKKQHN GKMKKNKKIK KVRKSKKDTS TSDENEAGNL

      51  PKLNDQEINK NPDDHVTSDG ILVLEKKSDD DEGFDDYDGH FDNPTDVPST

     101  TEENKTPLLT VHGSERDLAN NDDFISLSAS SEDEDAKKEE EERQKKEAEL

     151  LRIRQKEILN TDYPWILNHD HSRQKEISDW LTFEIKDFVA YISPSREEIE

     201  IRNQTISTIR EALKQLWPDA DLHVFGSYST DLYLPGSDID CVVNSELGGK

     251  ESRNNLYSLA SHLKKNNLAT EIEVVAKARV PIIKFVEPHS RIHIDVSFER

     301  TNGLEAAKLI REWLNDTPGL RELVLIVKQF LHARRLNNVH TGGLGGFSII

     351  CLVFSFLHMH PRIITKEIDS KDNLGVLLIE FFELYGKNFG YDDVALGSSD

     401  GYPIYFPKSS WSAIQPIKNP FSLAIQDPGD ESNNISRGSF NIRDIKKAFA

     451  GAFDLLTNRC FELHSATFKD RLGKSILGNV IKYRGKARDF KDERGLVLNK

     501  AIIENENYHK KRSRIIHDEE FTEDTATSTA TTTEDDYEII EPPTKRARTE

     551  TVKPQPKSEP SEKKSEESHI TISSDDDDDD DEDEDGYNPY SL*