Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YOL081W and Homologs


Choose two or more sequences for alignment:
Pick a sequence type:
Best Hits & Orthologs"Other" Hits

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_IRA2/YOL081W   1   MSQPTKNKKKEHGTDSKSSRMTRTLVNHILFERILPILPVESNLSTYSEV   50
MIT_Spar_c317_20004   1   MSQPTKNKKKEHGTDAKSSRMTRTLVNHILFERILPILPVESNLSTYSEV   50
WashU_Sbay_Contig541.4   1   MSHHTKNNKKEHGIDAQSSHMTRTLIKHVLFDRILPILPVESNFSTYLEV   50
WashU_Scas_Contig710.46   1   --------------------MVETLTKHLLFERILPILPIESSHSTYLQV   30
Symbols






*..** :*:**:*******:**. *** :*



SGD_Scer_IRA2/YOL081W   51   EEYSSFISCRSVLINVTVSRDANAMVEGTLELIESLLQGHEIISDKGSSD   100
MIT_Spar_c317_20004   51   EEYSSFISCRSVLINVTVSRDANAMVEGTLELIESLLQGHEIISDKGNSE   100
WashU_Sbay_Contig541.4   51   EEYSPFISCRSVLINVAVFRDLNAIVGCSLELIELLLQGHDIISDKNNDD   100
WashU_Scas_Contig710.46   31   EADRFYRSCRSVVLNVAVSKGLNAITEQILNLIDAIVKDGTIIDSNISDD   80
Symbols






* : *****::**:* :. **:. *:**: :::. **..: ..:



SGD_Scer_IRA2/YOL081W   101   VIESILIILRLLSDALEYNWQNQESLHYNDISTHVEHDQEQKYRPKLNSI   150
MIT_Spar_c317_20004   101   VIESILITLRLLSDALEYNWQNQESLHYNDISAHVEHEQEQKYRPKLNSI   150
WashU_Sbay_Contig541.4   101   VIESILVTLRLLSDALEYNWQKLESLNHSDISTHIEHEQEQ--RPKLPGI   148
WashU_Scas_Contig710.46   81   AIQSVLTILRLLSDTMEYFWDNIETHGN----TKVKQEQDETRYKAYSGS   126
Symbols






.*:*:* ******::** *:: *: ::::::*:: .



SGD_Scer_IRA2/YOL081W   151   LPDYSSTHSNGNKHFFHQSKPQALIPELASKLLESCAKLKFNTRTLQILQ   200
MIT_Spar_c317_20004   151   LPDYSSTHSNGNKHFFHQTKPQALIPELASKLLESCSKLKFNTRTLQILQ   200
WashU_Sbay_Contig541.4   149   FPEFSSAHNNDNKHFFHQMKPYSLMPELASKLIETCSALKFNTRTLKILQ   198
WashU_Scas_Contig710.46   127   VTGFSINRSG-----FHRTPPNLIDTKLATRLISTCTRVKFNSRTLEILE   171
Symbols






.. :* :.. **: * : .:**::*:.:*: :***:***:**:



SGD_Scer_IRA2/YOL081W   201   NMISHVHGNILTTLSSSILPRHKSYLTRHNHPSHCKMIDSTLGHILRFVA   250
MIT_Spar_c317_20004   201   NMISHVHGNILTTLNSSILPRHKSYLNRHNYPYHCKMVDSTLGHILRFVA   250
WashU_Sbay_Contig541.4   199   NMIDHVHGNILTTLSSTILPAHKTYLAKNNHPSHCKLIDSTLGHILRFLA   248
WashU_Scas_Contig710.46   172   NMACYVY-ETDSSFTSTILPDYQTFLKKKNYPESTKMVDVTINHILRFVA   220
Symbols






** :*: : :::.*:*** ::::* ::*:* *::* *:.*****:*



SGD_Scer_IRA2/YOL081W   251   ASNPSEYFEFIRKSVQVPVTQTHTHSHSHSHSLPSSVYNSIVPHFDLFSF   300
MIT_Spar_c317_20004   251   ASNPSEYFEFIRKSVQVPVMQTHTHSHSHSHSLPSSVYNSIVPQFDLFSF   300
WashU_Sbay_Contig541.4   249   ASNPSEYFEFIKKSVQLPVTQAQAHSHSHSHSLSSSVYNNIVPHLDLFSF   298
WashU_Scas_Contig710.46   221   ASNPDEFFQYIYSNIHEPLLTNRTKTEFQ-----------VVQYFEMFGC   259
Symbols






****.*:*::* ..:: *: ::::. : :* :::*.



SGD_Scer_IRA2/YOL081W   301   IYLSKHNFKKYLELIKNLSVTLRKTIYHCLLLHYSAKAIMFWIMARPAEY   350
MIT_Spar_c317_20004   301   IYLSRHNFKKYLELIKNLSVALRKTIYHCLLLHYSAKAIMFWIMARPSEY   350
WashU_Sbay_Contig541.4   299   IYLTKHNLKKYLEIVKNLSMALRKTIYHCLLLHFTAKAIMFWIMARPAEY   348
WashU_Scas_Contig710.46   260   SYITTINLPKYLQLVKVLSTGMKKTIFNCLLLFFASKSLMFWFMARPNEY   309
Symbols






*:: *: ***:::* ** ::***::****.:::*::***:**** **



SGD_Scer_IRA2/YOL081W   351   YELFNLLKDN---NNEHSKSLNTLNHTLFEEIHSTFNVNSMITTNQNAHQ   397
MIT_Spar_c317_20004   351   YELFNLLRDN---NNEYSKSVNTLNHTLFEDIHSTFNVNSMITTSQNAHQ   397
WashU_Sbay_Contig541.4   349   YELFNLLRDN---NDEFAKSINLLIHTLFEEIHSTFNVNSIITAAQNSHP   395
WashU_Scas_Contig710.46   310   VELYRILKKHSEKNEAYVKNLSSSVSDLFEKIYSTFNVTSLLSNIDYDIN   359
Symbols






**:.:*:.: *: . *.:. ***.*:*****.*::: :



SGD_Scer_IRA2/YOL081W   398   GSSSPSSSSPSSPPSSSSSDNNNQNIIAKSLSRQLSHHQSYIQQQSERKL   447
MIT_Spar_c317_20004   398   GSSSPSSSSPSSPPSSSSSDNNNQNIIAKSLSRQLSHHQSYIQQQPERKL   447
WashU_Sbay_Contig541.4   396   GSSSPSPSSPSSPPSSSSSDNN-QSVIAKSLSRQLSHHQSYIQQQPERKL   444
WashU_Scas_Contig710.46   360   DNHLVSSVKKKSRASSFDTGSD----------------------------   381
Symbols






.. *. . .* .** .:..:



SGD_Scer_IRA2/YOL081W   448   HSSWTTNSQSSTSLSSSTSNSTTTDFSTHTQPGEYDPSLPDTPTMSNITI   497
MIT_Spar_c317_20004   448   HSSWTTNSQSSTSLSSSTSTSTTTDFSNHSQSGEYDPSLPDTPTMSNITI   497
WashU_Sbay_Contig541.4   445   HSSWTTNSQSSTSLSSSASSSTTTSLSTHAQSGEYEPSLAETPTMSNITI   494
WashU_Scas_Contig710.46   382   RSSISSLTAPDVAITNRPASISSVSLSATSLLSGSDKDLLDPRQSPRMNF   431
Symbols






:** :: : ...:::. .:. ::..:* : . : .* :. ..:.:



SGD_Scer_IRA2/YOL081W   498   SASSLLSQTPTP---TTQLQQRLN---SAAAAAAAAASPSNSTPTGYTAE   541
MIT_Spar_c317_20004   498   SASSLLSQTPTP---TTQLQQRLNSAAAAAAAAAAAASPSNSTPTGYTE-   543
WashU_Sbay_Contig541.4   495   SASSLLSQTPTP---TTQLQQRLN-AAAAAAAAAATSSSSNSTQTAYTEQ   540
WashU_Scas_Contig710.46   432   QYNNISMGTRSKSRDANEDMP-----------------------------   452
Symbols






. ..: * : :.:



SGD_Scer_IRA2/YOL081W   542   QQSRASYDAHKTGHTGKDYDEHFLSVTRLDNVLELYTHFDDTEVLPHTSV   591
MIT_Spar_c317_20004   544   QQSRASYDAHKTDQTGKNYDEQFLSVARLDNVLELYTHFDDTEVLPHTSV   593
WashU_Sbay_Contig541.4   541   QQSRAAYDSPKPGHTGRDYDENFLSVTRLNNVLELYTHFDDTEVLPHTSV   590
WashU_Scas_Contig710.46   453   ---------------------------HLESILEIYTYFEDTEKLPHTAV   475
Symbols






:*:.:**:**:*:*** ****:*



SGD_Scer_IRA2/YOL081W   592   LKFLTTLTMFDIDLFNELNATSFKYIPDCTMHRPKERTSSFN-NTAHETG   640
MIT_Spar_c317_20004   594   LKFLTTLTMFDIDLFNELNATSFKYIPDCTMHRPKERTSSFN-NATHEAG   642
WashU_Sbay_Contig541.4   591   LKFLTTLTMFDTDLFNELNALSFKYIPDCVSHRPRERTGSVNNSVLHEVG   640
WashU_Scas_Contig710.46   476   LRFLVMLVMLVPDVFVELNSQSLEKISRPNIISGKEDT------------   513
Symbols






*:**. *.*: *:* ***: *:: *. :* *



SGD_Scer_IRA2/YOL081W   641   SEKTSGIKHITQGLKKLTSLPSSTKKTVKFVKMLLRNLNGNQAVSDVALL   690
MIT_Spar_c317_20004   643   SEKTSGIKHITQGLKKLTSLPTSTKKTVKFIKMLLRNLNGTQAVSDVALL   692
WashU_Sbay_Contig541.4   641   SERTLGIKHITQGLKKLTSLPTSTKKTVKFMKMLLKNLNGTQAVSDVALL   690
WashU_Scas_Contig710.46   514   LEKPSNIRQITSGLKKLTTLQLSKKRTVKFLTILVKNINGTQPVSDGLLL   563
Symbols






*:. .*::**.******:* *.*:****:.:*::*:**.*.*** **



SGD_Scer_IRA2/YOL081W   691   DTMRALLSFFTMTSAVFLVDRNLPSVLFAKRLIPIMGTNLSVGQDWNSKI   740
MIT_Spar_c317_20004   693   DTMRALLSFFTMTSAVFLVDRNLPSALFAKRLIPIMGTNLSVGQDWNSKI   742
WashU_Sbay_Contig541.4   691   DTMRALLSFLTMTSAVFLVDKNLPSVLFAKRLIPIIGTNLSVGQDWSSKM   740
WashU_Scas_Contig710.46   564   DSMRTLLSLVTVTSSVSLIDSEIPPVIFSKRMIDLLGANLKCGSSWKIRP   613
Symbols






*:**:***:.*:**:* *:* ::*..:*:**:* ::*:**. *..*. :



SGD_Scer_IRA2/YOL081W   741   NNSLMVCLKKNSTTFVQLQLIFFSSAIQFDHELLLARLSIDTMANNLNMQ   790
MIT_Spar_c317_20004   743   NNNLMVCLKKNSTTFVQLQLIFFSSAIQFDHELLLARLSIDTMANNLNMQ   792
WashU_Sbay_Contig541.4   741   NYNLMGCLKKNSNAFIQLQLIFFSSAIQFDHELLLARLSIDTMANNLNLQ   790
WashU_Scas_Contig710.46   614   SLTLTNCLKRNPATRDHLRLKYFCAALQFDHIMFLSKLNINKTVESLDLD   663
Symbols






. .* ***:*. : :*:* :*.:*:**** ::*::*.*:. .:.*:::



SGD_Scer_IRA2/YOL081W   791   KLCLYTEGFRIFFDIPSKKELRKAIAVKISKFFKTLFSIIADILLQEFPY   840
MIT_Spar_c317_20004   793   KLCLYTEGFRIFFDIPSKKELRKAIAVKISKFFKTLFSIIADILLQEYPY   842
WashU_Sbay_Contig541.4   791   KLCLYTEGFRIFFDIPSKRELRKSIAIKISKFFKTLFSIIADILLQEFPY   840
WashU_Scas_Contig710.46   664   ERIFYTEGFRVFFHLPSSTQLRKEVADLASDFLKNLFCTASDILMEAFPY   713
Symbols






: :******:**.:**. :*** :* *.*:*.**. :***:: :**



SGD_Scer_IRA2/YOL081W   841   FDEQITDIVASILDGTIINEYGTKKHFKGSSPSLCSTTRSRSGSTSQSSM   890
MIT_Spar_c317_20004   843   FDEQITDIVASILDGTIINEYGTKKHFKGSSPSLCSTTRSRSGSTSQSSM   892
WashU_Sbay_Contig541.4   841   FDEQITDIVASILDGTIINEYGTKKHFKGSSPSLCSTSRSRSGSTSQSSM   890
WashU_Scas_Contig710.46   714   FNDKITDIISSIVDGTILEEFGTKKLFKESSSSLDASISSTSPSHNSSPS   763
Symbols






*:::****::**:****::*:**** ** **.** :: * * * ..*.



SGD_Scer_IRA2/YOL081W   891   TPVSPLGLDTDICPMNTLSLVGSSTSRNSDNVNSLNSSPKNLSSDPYLSH   940
MIT_Spar_c317_20004   893   TPVSPLGLDAEIYPMNTLSLVGSSTSRNSDNVNSLNSSPKNLSSDPYLSH   942
WashU_Sbay_Contig541.4   891   TPVSPLGSEADMYPMNTLSLVGSSTSRNSDNINSLNSSPKNLSTDPYLSH   940
WashU_Scas_Contig710.46   764   LLSPVSTDQEDNTQQPFLTTSLLARLSDSHSSTGNTSSPSSNTTSIGNAT   813
Symbols






. : : *: : :*.. .. .***.. ::. :



SGD_Scer_IRA2/YOL081W   941   LVAPRARHALGGPSSIIRNKIPTTLTSPPGTEKSSPVQRPQTESISATPM   990
MIT_Spar_c317_20004   943   LVAPRARHALGGPSSIIRNKIPTTLTSPPGTEKSSPVQRPQTESISAIPM   992
WashU_Sbay_Contig541.4   941   LVAPRARHALGGPSSILRNKVPTTLTSPPDTEKSSPVQRPQTESISATAM   990
WashU_Scas_Contig710.46   814   STTPSATELPFSQSLSQRVPPISKSSLSRNLSGSSQIIAPSPVNISSSMM   863
Symbols






.:* * . . * * :. : . . . ** : *.. .**: *



SGD_Scer_IRA2/YOL081W   991   AITNSTPLSSAAFGIRSPLQKIRTRRYSDESLGKFMKSTNNYIQEHLIPK   1040
MIT_Spar_c317_20004   993   AITNSTPLSSAALGIRSPLQQIRTRRYSDESLGKFMKSTNNYIQEHLIPK   1042
WashU_Sbay_Contig541.4   991   AITNSTPLSSAAFGIRSPLQKIRTRRYSDESLGKFMKSTNNYIQEHLVPK   1040
WashU_Scas_Contig710.46   864   TLTNSMPAAPGNKTPTPTLTANKLRRYSEESNYNFNG---LDIKPVESSV   910
Symbols






::*** * :.. ..* : ****:** :* *: .



SGD_Scer_IRA2/YOL081W   1041   DLNEATLQDARRIMINIFSIFKRPNSYFIIPHNINSNLQWVSQDFRNIMK   1090
MIT_Spar_c317_20004   1043   DLNEATLQDARRIMINIFSIFKRPNSYFIIPHNLNSNLQWVSQDFRNIMK   1092
WashU_Sbay_Contig541.4   1041   DLNEAALQDARRIMINIFSIFKRPNSYFIIPHNINSNLQWVSQDFRNIMK   1090
WashU_Scas_Contig710.46   911   SLETKESRRARMILINIFSIFKKMINYFILPHARNSDLLWISKDFKNIIK   960
Symbols






.*: : ** *:********: .***:** **:* *:*:**:**:*



SGD_Scer_IRA2/YOL081W   1091   PIFVAIVSPDVDLQNTAQSFMDTLLSNVITYGESDENISIEGYHLLCSYT   1140
MIT_Spar_c317_20004   1093   PIFVAIVSSDVDLQNTAQSFMDTLLSNVITYSGSDENISIEGYHLLCSYT   1142
WashU_Sbay_Contig541.4   1091   PIFVAIVSADLALQKTAQSFMDTLLYNIINYSESDETISIEGYHLLCSYT   1140
WashU_Scas_Contig710.46   961   PIFVSLIDSDESLQNTARSFMDGLLSYIKDLSSDTSTITVSGYFLICSYT   1010
Symbols






****:::..* **:**:**** ** : . . ..*::.**.*:****



SGD_Scer_IRA2/YOL081W   1141   VTLFAMGLFDLKINNEKRQILLDITVKFMKVRSHLAGIAEASHHMEYISD   1190
MIT_Spar_c317_20004   1143   VTLFAMGLFDLKINNEKRQILLDISVKFMKVRSHLAGIAEASHHMEYISD   1192
WashU_Sbay_Contig541.4   1141   VTLFAMGLFDLKIKNEKRQILLDITIKFLKVRSHLAEIAEASHHMEYIND   1190
WashU_Scas_Contig710.46   1011   AALFSMGLFDLSIENHKRGVLLDIVVKFLQLRSYLGKVSENTQHLERVLE   1060
Symbols






.:**:******.*:*.** :**** :**:::**:*. ::* ::*:* : :



SGD_Scer_IRA2/YOL081W   1191   SEKLTFPLIMGTVGRALFVSLYSSQQKIEKTLKIAYTEYLSAINFHERNI   1240
MIT_Spar_c317_20004   1193   SEKLTFPLIMGTVGRALFVSLYSSQPKIEKTLKIAYTEYLSAINFHERNI   1242
WashU_Sbay_Contig541.4   1191   AEKLTFPLIMGTVGRALFVSLYSSRQEIEKTLKVAYTEYLSAINFHERNI   1240
WashU_Scas_Contig710.46   1061   AERNTFPLILGSVGRATFVSLYVSNPLLQKNLKLAYREYLTAIRFHLKHI   1110
Symbols






:*: *****:*:**** ***** *. ::*.**:** ***:**.** ::*



SGD_Scer_IRA2/YOL081W   1241   DDADKTWVHNIEFVEAMCHDNYTTSGSIAFQRRTRNNILRFATIPNAILL   1290
MIT_Spar_c317_20004   1243   DDADKTWVHNIEFVEAMCHDNYTTSGSIAFQRRTRNNILRFATIPNAILL   1292
WashU_Sbay_Contig541.4   1241   DDSDKTWVHNIEFVEAMCHDNYTTSGSIAFQRRTRNNILRFATIPNAILL   1290
WashU_Scas_Contig710.46   1111   GEFDKTFICNVPFIEMMASDTFASAGSVAFQRRVRNNIQKYISQPDSVLL   1160
Symbols






.: ***:: *: *:* *. *.::::**:*****.**** :: : *:::**



SGD_Scer_IRA2/YOL081W   1291   DSMRMIYKKWHTYTHSKSLEKQERNDFRNFAGILASLSGILFINKKILQE   1340
MIT_Spar_c317_20004   1293   DSMRMIYKKWHTYTHSKNLEKQELNDFRNFAGILASLSGILFINKKILQD   1342
WashU_Sbay_Contig541.4   1291   DSMRMIYKKWYLYAHTKNLDKQELNDFRNFAGILASLSGILFINKKMLED   1340
WashU_Scas_Contig710.46   1161   DSMHTIFR------------------------------------------   1168
Symbols






***: *::



SGD_Scer_IRA2/YOL081W   1341   MYPYLLDTVSELKKNIDSFISKQCQWLNYPDLLTRENSRDILSVELHPLS   1390
MIT_Spar_c317_20004   1343   IYPYLLDTVSELKKNIDSFISKQCQWLNYPDLLTRENSRDILSIELHPLS   1392
WashU_Sbay_Contig541.4   1341   IYPYLLDTVAELKKNISFFISKQCQWLSYSDLLTRENSRDILSVELHPLS   1390
WashU_Scas_Contig710.46   
   --------------------------------------------------   
Symbols










SGD_Scer_IRA2/YOL081W   1391   FNLLFNNLRLKLKELACSDLSIPENESSYVLLEQIIKMLRTILGRDDDNY   1440
MIT_Spar_c317_20004   1393   FNLLFNNLRLKLKELACSDLSIPENESSYVLLEQIIKMLRTILNRDDDNF   1442
WashU_Sbay_Contig541.4   1391   FKLLFSSLRLKLKELACSDLSIPENETSYILLEQIIKMLRTILSREDDNS   1440
WashU_Scas_Contig710.46   
   --------------------------------------------------   
Symbols










SGD_Scer_IRA2/YOL081W   1441   VMMLFSTEIVDLIDLLTDEIKKIPAYCPKYLKAIIQMTKMFSALQHSEVN   1490
MIT_Spar_c317_20004   1443   VMMLFSTEIVDLIDLLTEEIKKIPVYCPKYLKAIIQMAKMFSALQHSEVN   1492
WashU_Sbay_Contig541.4   1441   VMLLFSTEIVDLISSLTEEIKKMPAYCPKHFKAIIQMTKMFSALQHSEVS   1490
WashU_Scas_Contig710.46   
   --------------------------------------------------   
Symbols










SGD_Scer_IRA2/YOL081W   1491   LGVKNHFHVKNKWLRQITDWFQVSIAREYDFENLSKPLKEMDLVKRDMDI   1540
MIT_Spar_c317_20004   1493   LGVKNHFHVKNKWLRQVTDWFQVSIAREYDFENLSKPLKEMDLVKRDMDI   1542
WashU_Sbay_Contig541.4   1491   LGLKNHFHIKNRWLRQVTDWFQVSISREYDFENLSKPLKEMDLIKRDMDI   1540
WashU_Scas_Contig710.46   
   --------------------------------------------------   
Symbols










SGD_Scer_IRA2/YOL081W   1541   LYIDTAIEASTAIAYLTRHTFLEIPPAASDPELSRSRSVIFGFYFNILMK   1590
MIT_Spar_c317_20004   1543   LYIDTAIEASTAIAYLTRHTFLEIPPAASDPELSRSRSVIFGYYFNILMK   1592
WashU_Sbay_Contig541.4   1541   LYIDTAIEASTAIAFLTRHTFLEIPPAASDPELSRSRSVIFGYYFNILMK   1590
WashU_Scas_Contig710.46   
   --------------------------------------------------   
Symbols










SGD_Scer_IRA2/YOL081W   1591   GLEKSSDRDNYPVFLRHKMSVLNDNVILSLTNLSNTNVDASLQFTLPMGY   1640
MIT_Spar_c317_20004   1593   GLEKSSDRDNYPVFLRHKMSVLNDNVILSLTNLSNTNVDASLQFTLPMGY   1642
WashU_Sbay_Contig541.4   1591   GLEKSNDREKFPVFLKHKMSVLNDNVILSLTNLSNTNVDASLQFTLPMGY   1640
WashU_Scas_Contig710.46   
   --------------------------------------------------   
Symbols










SGD_Scer_IRA2/YOL081W   1641   SGNRNIRNAFLEVFINIVTNYRTYTAKTDLGKLEAADKFLRYTIEHPQLS   1690
MIT_Spar_c317_20004   1643   SGNRNIRNAFLEVFINIVTNYRTYTAKTDLGKLEAADKFLQYTIEHPQLS   1692
WashU_Sbay_Contig541.4   1641   SGNRNIRNAFLEVFINIVTNYRTYTAKSDLGKLEAADKFLRFTIEHPQLS   1690
WashU_Scas_Contig710.46   
   --------------------------------------------------   
Symbols










SGD_Scer_IRA2/YOL081W   1691   SFGAAVCPASDIDAYAAGLINAFETRNATHIVVAQLIKNEIEKSSRPTDI   1740
MIT_Spar_c317_20004   1693   TFGAAVCPASDIDAYAAGLINAFETRNATHIVVSQLIKNEIEKSSRPTDI   1742
WashU_Sbay_Contig541.4   1691   SYAAAVCPASDIDAYAAGLINAFETRNATHIAVSQLIENEIEKSSRPTDI   1740
WashU_Scas_Contig710.46   
   --------------------------------------------------   
Symbols










SGD_Scer_IRA2/YOL081W   1741   LRRNSCATRSLSMLARSKGNEYLIRTLQPLLKKIIQNRDFFEIEKLKPED   1790
MIT_Spar_c317_20004   1743   LRRNSCATRSLSMLARSKGNEYLIRTLQPLLKKIIENKDFFEIEKLKPED   1792
WashU_Sbay_Contig541.4   1741   LRRNSCATRSLSMLARSKGSEYLIRTLQPLLKKIIDNKVFFEIEKLKPED   1790
WashU_Scas_Contig710.46   
   --------------------------------------------------   
Symbols










SGD_Scer_IRA2/YOL081W   1791   SDAERQIELFVKYMNELLESISNSVSYFPPPLFYICQNIYKVACEKFPDH   1840
MIT_Spar_c317_20004   1793   SDAERQVELFVKYMNELLDSISNSVSYFPPPLFYICQNIYKVACEKFPDH   1842
WashU_Sbay_Contig541.4   1791   PDAEKQVQLFIKYMNELLDAISNSVSYFPPPLFYICQNIYKVAREKFPDH   1840
WashU_Scas_Contig710.46   
   --------------------------------------------------   
Symbols










SGD_Scer_IRA2/YOL081W   1841   AIIAAGSFVFLRFFCPALVSPDSENIIDISHLSEKRTFISLAKVIQNIAN   1890
MIT_Spar_c317_20004   1843   AIIAAGSFVFLRFFCPALVSPDSENIIDISHLSEKRTFISLAKVIQNIAN   1892
WashU_Sbay_Contig541.4   1841   ALIAAGSFVFLRFFCPALVSPDSENIIDISHPSEKRTFISLAKVIQNIAN   1890
WashU_Scas_Contig710.46   
   --------------------------------------------------   
Symbols










SGD_Scer_IRA2/YOL081W   1891   GSENFSRWPALCSQKDFLKECSDRIFRFLAELCRTDRTIDIQVRTDPTPI   1940
MIT_Spar_c317_20004   1893   GSENFSRWPALCSQKGFLKECSNRIFKFLAELCRTDRTIDIQVRTDPTPI   1942
WashU_Sbay_Contig541.4   1891   GSENFSRWPALSTQNEFLKECSDRIFRFLAELCRADRMIDIQVRTDPTPI   1940
WashU_Scas_Contig710.46   
   --------------------------------------------------   
Symbols










SGD_Scer_IRA2/YOL081W   1941   AFDYQFLHSFVYLYGLEVRRNVLNEAKHDDGDIDGDDFYKTTFLLIDDVL   1990
MIT_Spar_c317_20004   1943   AFDFQFLHSFVYLYGLEMRRNVLNEAKHDDGDIDSDDFYKTTFLLIDDVL   1992
WashU_Sbay_Contig541.4   1941   PFDYQFVHSFVYLYGLEIRKNVLDEAKRDDGDIDDDEFYKSTFLLIDDVL   1990
WashU_Scas_Contig710.46   
   --------------------------------------------------   
Symbols










SGD_Scer_IRA2/YOL081W   1991   GQLGQPKMEFSNEIPIYIREHMDDYPELYEFMNRHAFRNIETSTAYSPSV   2040
MIT_Spar_c317_20004   1993   GQLGQPKMEFSNEIPIYIREHMDDYPELYEFMNRHAFRNIETSTAYNPNV   2042
WashU_Sbay_Contig541.4   1991   GQLGQPKMEFSNEIPIYIREHMDDYPELYEFMNRHAFRNMETSTTYNPNV   2040
WashU_Scas_Contig710.46   
   --------------------------------------------------   
Symbols










SGD_Scer_IRA2/YOL081W   2041   HESTSSEGIPIITLTMSNFSDRHVDIDTVAYKFLQIYARIWTTKHCLIID   2090
MIT_Spar_c317_20004   2043   HESTSSEGIPIITLTMSNFSNKHVDIDTVAYKFLQIYARIWTTKHCLIID   2092
WashU_Sbay_Contig541.4   2041   HESTSSEGVPIITLTMSNFSNKHMDIDTVVYKFLQIYARIWTTKHCLIID   2090
WashU_Scas_Contig710.46   
   --------------------------------------------------   
Symbols










SGD_Scer_IRA2/YOL081W   2091   CTEFDEGGLDMRKFISLVMGLLPEVAPKNCIGCYYFNVNETFMDNYGKCL   2140
MIT_Spar_c317_20004   2093   CTEFDEGGLDMRKFISLVMGLLPEVAPKNCMGCYYFNVNERFMDNYGKCL   2142
WashU_Sbay_Contig541.4   2091   CTEFDEDGLDMRKFISLVMGLLPEVAPKNCLGCYYFNVNEMFMSNYGRCL   2140
WashU_Scas_Contig710.46   
   --------------------------------------------------   
Symbols










SGD_Scer_IRA2/YOL081W   2141   DKDNVYVSSKIPHYFINSNSDEGLMKSVGITGQGLKVLQDIRVSLHDITL   2190
MIT_Spar_c317_20004   2143   DKDNVYVSSKIPHYFINSNSDEELMKSVGITGQGLKVLQDIRVSLHDITL   2192
WashU_Sbay_Contig541.4   2141   DKENVFVSSKIPHFFINSNSDEDLMKSLGITGQGLKVLQDIRVSLHDITL   2190
WashU_Scas_Contig710.46   
   --------------------------------------------------   
Symbols










SGD_Scer_IRA2/YOL081W   2191   YDEKRNRFTPVSLKIGDIYFQVLHETPRQYKIRDMGTLFDVKFNDVYEIS   2240
MIT_Spar_c317_20004   2193   YDERRNRFTPVSLKIGDIYFQVLHETPRQYKIRDMGTLFDVKFNDVYEIS   2242
WashU_Sbay_Contig541.4   2191   YDEKRNRFTPVSLKIGDIYFQVLHETPRQYKIRDMDTLFDVKFNDVYEIS   2240
WashU_Scas_Contig710.46   
   --------------------------------------------------   
Symbols










SGD_Scer_IRA2/YOL081W   2241   RIFEVHVSSITGVAAEFTVTFQDERRLIFSSPKYLEIVKMFYYAQIRLES   2290
MIT_Spar_c317_20004   2243   RIFEVHVSSITGVAAEFTVTFQDGKRLIFSSPKYLEIVKMFYYAQIRLES   2292
WashU_Sbay_Contig541.4   2241   RIFEVHVSSITGVAAEFTVTFQDGKRLIFSSPKYLEIVKMFYYAQIRLEN   2290
WashU_Scas_Contig710.46   
   --------------------------------------------------   
Symbols










SGD_Scer_IRA2/YOL081W   2291   EYEMDNNSSTSSPNSNNKDKQQKERTKLLCHLLLVSLIGLFDESKKMKNS   2340
MIT_Spar_c317_20004   2293   EYEMDNNSSTSS-NSSNKDKQQKERTKLLCHLLLVSLIGLFDENKKMKNS   2341
WashU_Sbay_Contig541.4   2291   EYEMDNNSSASSSNSSAKDKQQKERNKLLCHLLLVSLIGLFDENKKMKNS   2340
WashU_Scas_Contig710.46   
   --------------------------------------------------   
Symbols










SGD_Scer_IRA2/YOL081W   2341   SYNLIAATEASFGLNFGSHFHRSPEVYVPEDTTTFLGVIGKSLAESNPEL   2390
MIT_Spar_c317_20004   2342   SYNLIAATEASFGLNFGSHFHRSPEVYVPEDTTTFLGVIAKSLAESNPEL   2391
WashU_Sbay_Contig541.4   2341   SYNLVAATEISFGLNFGSHFHRSPEVYVPEETTTFLSVIGKSLADSNPEL   2390
WashU_Scas_Contig710.46   
   --------------------------------------------------   
Symbols










SGD_Scer_IRA2/YOL081W   2391   TAYMFIYVLEALKNNVIPHVYIPHTICGLSYWIPNLYQHVYLADDEEGPE   2440
MIT_Spar_c317_20004   2392   TAYMFIYILDALKNNVIPHVYIPHTICGLSYWIPNLYQYVYLADDEEGPE   2441
WashU_Sbay_Contig541.4   2391   TTYMFIYILEALKNDVIPHVYIPHTVCGLSYWIPNLYQYVYLADDEEGPE   2440
WashU_Scas_Contig710.46   
   --------------------------------------------------   
Symbols










SGD_Scer_IRA2/YOL081W   2441   NISHIFRILIRLSVRETDFKAVYMQYVWLLLLDDGRLTDIIVDEVINHAL   2490
MIT_Spar_c317_20004   2442   NISHIFRVLIRLSVRETDFKAVYMQYIWLLLLDDGRLSDIIVDEVINHAL   2491
WashU_Sbay_Contig541.4   2441   NISHIFRVLIRLSVKETDFKAVYMQYVWLLLLDDGRLTSIIVEEVINHAL   2490
WashU_Scas_Contig710.46   
   --------------------------------------------------   
Symbols










SGD_Scer_IRA2/YOL081W   2491   ERDSENRDWKKTISLLTVLPTTEVANNIIQKILAKIRSFLPSLKLEAMTQ   2540
MIT_Spar_c317_20004   2492   ERDSENRDWKKTISLLTVLPTTEVANNIIQKILAKIRSFLPSLKLEAMTQ   2541
WashU_Sbay_Contig541.4   2491   ERDSENRDWKKTISLLTVLPTTEVANNIVQKIMAKIRSFLPSLKQEAMTQ   2540
WashU_Scas_Contig710.46   
   --------------------------------------------------   
Symbols










SGD_Scer_IRA2/YOL081W   2541   SWSELTILVKISIHVFFETSLLVQMYLPEILFIVSLLIDVGPRELRSSLH   2590
MIT_Spar_c317_20004   2542   SWSELTILVRISIHVFFETSLLVQMYLPEILFIVSLLIDVGPRELRSSLH   2591
WashU_Sbay_Contig541.4   2541   SWSELTILVKISIHVFFETSLLVQMYLPEILFIVSLLIDVGPRELRSSLH   2590
WashU_Scas_Contig710.46   
   --------------------------------------------------   
Symbols










SGD_Scer_IRA2/YOL081W   2591   QLLMNVCHSLAINSALPQDHRNNLDEISDIFAHQKVKFMFGFSEDKGRIL   2640
MIT_Spar_c317_20004   2592   QLLMNVCHSLAINSALPQNHRKNLDEISDIFAHQKVKFMFGFSEDKGRIL   2641
WashU_Sbay_Contig541.4   2591   QLLMNVCHSLAINSALPQDHRDNLDEISDIFAHQKVKFMFGFSEDKGRIL   2640
WashU_Scas_Contig710.46   
   --------------------------------------------------   
Symbols










SGD_Scer_IRA2/YOL081W   2641   QIFSASSFASKFNILDFFINNILLLMEYSSTYEANVWKTRYKKYVLESVF   2690
MIT_Spar_c317_20004   2642   QIFSASSFASKFNILDFFINNILLLMEYSSTYEANVWKTRYKKYVLESVF   2691
WashU_Sbay_Contig541.4   2641   QIFSATSFASKFNILDFFINNILLLMEYSSTYEANVWKTRYKKYILESVF   2690
WashU_Scas_Contig710.46   
   --------------------------------------------------   
Symbols










SGD_Scer_IRA2/YOL081W   2691   TSNSFLSARSIMIVGIMGKSYITEGLCKAMLIETMKVIAEPKITDEHLFL   2740
MIT_Spar_c317_20004   2692   TSNSFLSARSIMIVGIMGKSYITEGLCKAMLIETMKVVAEPRITDEHLFL   2741
WashU_Sbay_Contig541.4   2691   TSNSFLSARSIMIVGIMGKSYITESLCKAMIIETMKVIAEPRVTDEHIFL   2740
WashU_Scas_Contig710.46   
   --------------------------------------------------   
Symbols










SGD_Scer_IRA2/YOL081W   2741   AISHIFTYSKIVEGLDPNLDLMKHLFWFSTLFLESRHPIIFEGALLFVSN   2790
MIT_Spar_c317_20004   2742   AISHIFTYSKIVEGLDPNLDLMKHLFWLSTLFVESRHPIIFEGALLFLSN   2791
WashU_Sbay_Contig541.4   2741   AISHIFTYSKIVEGLDPNLDLMKHLFWFSTICLESRHPIIFEGALLFVSS   2790
WashU_Scas_Contig710.46   
   --------------------------------------------------   
Symbols










SGD_Scer_IRA2/YOL081W   2791   CIRRLYMAQFENESETSLISTLLKGRKFAHTFLSKIENLSGIVWNEDNFT   2840
MIT_Spar_c317_20004   2792   CIRRLYMSQFENESEVSLITTLLKERKFADTFLRKMEHLSDIVWNEDNFT   2841
WashU_Sbay_Contig541.4   2791   CMRRLYMSQFENESETSLIRSLLKERKFASTLLCEIESIDGIVWNGDNFT   2840
WashU_Scas_Contig710.46   
   --------------------------------------------------   
Symbols










SGD_Scer_IRA2/YOL081W   2841   HILIFIINKGLSNPFIKSTAFDFLKMMFRNSYFEHQINQKSDHYLCYMFL   2890
MIT_Spar_c317_20004   2842   HILVSIINKGLSNPFIKSTAFDFLKMMFRNSYFEHQIDPKSDHYLCYMFL   2891
WashU_Sbay_Contig541.4   2841   HIIVFIVNKGLCNPFIRSTAFDFLKMVFKNSYFEHQIDRTSDHYLCYMFL   2890
WashU_Scas_Contig710.46   
   --------------------------------------------------   
Symbols










SGD_Scer_IRA2/YOL081W   2891   LYFVLNCNQFEELLGDVDFEGEMVNIENKNTIPKILLEWLSSDNENANIT   2940
MIT_Spar_c317_20004   2892   LYFVLSSSQFEELLGDIDFEGEMVNIENKNIIPKILLEWLSSDNENANIT   2941
WashU_Sbay_Contig541.4   2891   LYFLLSSTQFEEVLGDVDFEGEMVPIENENTIPKVLLEWLSSDNEDPNIS   2940
WashU_Scas_Contig710.46   
   --------------------------------------------------   
Symbols










SGD_Scer_IRA2/YOL081W   2941   LYQGAILFKCSVTDEPSRFRFALIIRHLLTKKPICALRFYSVIRNEIRKI   2990
MIT_Spar_c317_20004   2942   LYQGAILFKGSVTDEPSRFRFALIIRHLLMVKPICALRFYSVIRNEIRKI   2991
WashU_Sbay_Contig541.4   2941   LYQCAVLFKSSVTDEPSKFRFALIVRHLLNVNPVCAFRFYKVIRNEIRKI   2990
WashU_Scas_Contig710.46   
   --------------------------------------------------   
Symbols










SGD_Scer_IRA2/YOL081W   2991   SAFEQNSDCVPLAFDILNLLVTHSESNSLEKLHEESIERLTKRGLSIVTS   3040
MIT_Spar_c317_20004   2992   SAFEQTSDCVPLAFDILNLLVTHSESNSLEKLHEKSIERLTKRGLLIVTS   3041
WashU_Sbay_Contig541.4   2991   SAFEQTSDCVPLAFDILNLLVTHSESYSLDELNEKSIELLTKRGLLTTTK   3040
WashU_Scas_Contig710.46   
   --------------------------------------------------   
Symbols










SGD_Scer_IRA2/YOL081W   3041   SGIFAKNSDMMIPLDVKPEDIYERKRIMTMILSRMSCSA   3079
MIT_Spar_c317_20004   3042   ASVFAKNSDMMIPLDVEPEDIYERKRIMTMILSRMSCSV   3080
WashU_Sbay_Contig541.4   3041   VNKFAKNSDMTLPLNIEPRVLYERKRILTMILSRMSCST   3079
WashU_Scas_Contig710.46   
   ---------------------------------------   
Symbols










Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_IRA2/YOL081W:

SGD_Scer_IRA2/YOL081W  Length: 3080  Mon Nov  7 16:33:35 2016  Type: P  Check: 555  ..

       1  MSQPTKNKKK EHGTDSKSSR MTRTLVNHIL FERILPILPV ESNLSTYSEV

      51  EEYSSFISCR SVLINVTVSR DANAMVEGTL ELIESLLQGH EIISDKGSSD

     101  VIESILIILR LLSDALEYNW QNQESLHYND ISTHVEHDQE QKYRPKLNSI

     151  LPDYSSTHSN GNKHFFHQSK PQALIPELAS KLLESCAKLK FNTRTLQILQ

     201  NMISHVHGNI LTTLSSSILP RHKSYLTRHN HPSHCKMIDS TLGHILRFVA

     251  ASNPSEYFEF IRKSVQVPVT QTHTHSHSHS HSLPSSVYNS IVPHFDLFSF

     301  IYLSKHNFKK YLELIKNLSV TLRKTIYHCL LLHYSAKAIM FWIMARPAEY

     351  YELFNLLKDN NNEHSKSLNT LNHTLFEEIH STFNVNSMIT TNQNAHQGSS

     401  SPSSSSPSSP PSSSSSDNNN QNIIAKSLSR QLSHHQSYIQ QQSERKLHSS

     451  WTTNSQSSTS LSSSTSNSTT TDFSTHTQPG EYDPSLPDTP TMSNITISAS

     501  SLLSQTPTPT TQLQQRLNSA AAAAAAAASP SNSTPTGYTA EQQSRASYDA

     551  HKTGHTGKDY DEHFLSVTRL DNVLELYTHF DDTEVLPHTS VLKFLTTLTM

     601  FDIDLFNELN ATSFKYIPDC TMHRPKERTS SFNNTAHETG SEKTSGIKHI

     651  TQGLKKLTSL PSSTKKTVKF VKMLLRNLNG NQAVSDVALL DTMRALLSFF

     701  TMTSAVFLVD RNLPSVLFAK RLIPIMGTNL SVGQDWNSKI NNSLMVCLKK

     751  NSTTFVQLQL IFFSSAIQFD HELLLARLSI DTMANNLNMQ KLCLYTEGFR

     801  IFFDIPSKKE LRKAIAVKIS KFFKTLFSII ADILLQEFPY FDEQITDIVA

     851  SILDGTIINE YGTKKHFKGS SPSLCSTTRS RSGSTSQSSM TPVSPLGLDT

     901  DICPMNTLSL VGSSTSRNSD NVNSLNSSPK NLSSDPYLSH LVAPRARHAL

     951  GGPSSIIRNK IPTTLTSPPG TEKSSPVQRP QTESISATPM AITNSTPLSS

    1001  AAFGIRSPLQ KIRTRRYSDE SLGKFMKSTN NYIQEHLIPK DLNEATLQDA

    1051  RRIMINIFSI FKRPNSYFII PHNINSNLQW VSQDFRNIMK PIFVAIVSPD

    1101  VDLQNTAQSF MDTLLSNVIT YGESDENISI EGYHLLCSYT VTLFAMGLFD

    1151  LKINNEKRQI LLDITVKFMK VRSHLAGIAE ASHHMEYISD SEKLTFPLIM

    1201  GTVGRALFVS LYSSQQKIEK TLKIAYTEYL SAINFHERNI DDADKTWVHN

    1251  IEFVEAMCHD NYTTSGSIAF QRRTRNNILR FATIPNAILL DSMRMIYKKW

    1301  HTYTHSKSLE KQERNDFRNF AGILASLSGI LFINKKILQE MYPYLLDTVS

    1351  ELKKNIDSFI SKQCQWLNYP DLLTRENSRD ILSVELHPLS FNLLFNNLRL

    1401  KLKELACSDL SIPENESSYV LLEQIIKMLR TILGRDDDNY VMMLFSTEIV

    1451  DLIDLLTDEI KKIPAYCPKY LKAIIQMTKM FSALQHSEVN LGVKNHFHVK

    1501  NKWLRQITDW FQVSIAREYD FENLSKPLKE MDLVKRDMDI LYIDTAIEAS

    1551  TAIAYLTRHT FLEIPPAASD PELSRSRSVI FGFYFNILMK GLEKSSDRDN

    1601  YPVFLRHKMS VLNDNVILSL TNLSNTNVDA SLQFTLPMGY SGNRNIRNAF

    1651  LEVFINIVTN YRTYTAKTDL GKLEAADKFL RYTIEHPQLS SFGAAVCPAS

    1701  DIDAYAAGLI NAFETRNATH IVVAQLIKNE IEKSSRPTDI LRRNSCATRS

    1751  LSMLARSKGN EYLIRTLQPL LKKIIQNRDF FEIEKLKPED SDAERQIELF

    1801  VKYMNELLES ISNSVSYFPP PLFYICQNIY KVACEKFPDH AIIAAGSFVF

    1851  LRFFCPALVS PDSENIIDIS HLSEKRTFIS LAKVIQNIAN GSENFSRWPA

    1901  LCSQKDFLKE CSDRIFRFLA ELCRTDRTID IQVRTDPTPI AFDYQFLHSF

    1951  VYLYGLEVRR NVLNEAKHDD GDIDGDDFYK TTFLLIDDVL GQLGQPKMEF

    2001  SNEIPIYIRE HMDDYPELYE FMNRHAFRNI ETSTAYSPSV HESTSSEGIP

    2051  IITLTMSNFS DRHVDIDTVA YKFLQIYARI WTTKHCLIID CTEFDEGGLD

    2101  MRKFISLVMG LLPEVAPKNC IGCYYFNVNE TFMDNYGKCL DKDNVYVSSK

    2151  IPHYFINSNS DEGLMKSVGI TGQGLKVLQD IRVSLHDITL YDEKRNRFTP

    2201  VSLKIGDIYF QVLHETPRQY KIRDMGTLFD VKFNDVYEIS RIFEVHVSSI

    2251  TGVAAEFTVT FQDERRLIFS SPKYLEIVKM FYYAQIRLES EYEMDNNSST

    2301  SSPNSNNKDK QQKERTKLLC HLLLVSLIGL FDESKKMKNS SYNLIAATEA

    2351  SFGLNFGSHF HRSPEVYVPE DTTTFLGVIG KSLAESNPEL TAYMFIYVLE

    2401  ALKNNVIPHV YIPHTICGLS YWIPNLYQHV YLADDEEGPE NISHIFRILI

    2451  RLSVRETDFK AVYMQYVWLL LLDDGRLTDI IVDEVINHAL ERDSENRDWK

    2501  KTISLLTVLP TTEVANNIIQ KILAKIRSFL PSLKLEAMTQ SWSELTILVK

    2551  ISIHVFFETS LLVQMYLPEI LFIVSLLIDV GPRELRSSLH QLLMNVCHSL

    2601  AINSALPQDH RNNLDEISDI FAHQKVKFMF GFSEDKGRIL QIFSASSFAS

    2651  KFNILDFFIN NILLLMEYSS TYEANVWKTR YKKYVLESVF TSNSFLSARS

    2701  IMIVGIMGKS YITEGLCKAM LIETMKVIAE PKITDEHLFL AISHIFTYSK

    2751  IVEGLDPNLD LMKHLFWFST LFLESRHPII FEGALLFVSN CIRRLYMAQF

    2801  ENESETSLIS TLLKGRKFAH TFLSKIENLS GIVWNEDNFT HILIFIINKG

    2851  LSNPFIKSTA FDFLKMMFRN SYFEHQINQK SDHYLCYMFL LYFVLNCNQF

    2901  EELLGDVDFE GEMVNIENKN TIPKILLEWL SSDNENANIT LYQGAILFKC

    2951  SVTDEPSRFR FALIIRHLLT KKPICALRFY SVIRNEIRKI SAFEQNSDCV

    3001  PLAFDILNLL VTHSESNSLE KLHEESIERL TKRGLSIVTS SGIFAKNSDM

    3051  MIPLDVKPED IYERKRIMTM ILSRMSCSA*

Protein Sequence for MIT_Spar_c317_20004:

MIT_Spar_c317_20004  Length: 3081  Mon Nov  7 16:33:35 2016  Type: P  Check: 3471  ..

       1  MSQPTKNKKK EHGTDAKSSR MTRTLVNHIL FERILPILPV ESNLSTYSEV

      51  EEYSSFISCR SVLINVTVSR DANAMVEGTL ELIESLLQGH EIISDKGNSE

     101  VIESILITLR LLSDALEYNW QNQESLHYND ISAHVEHEQE QKYRPKLNSI

     151  LPDYSSTHSN GNKHFFHQTK PQALIPELAS KLLESCSKLK FNTRTLQILQ

     201  NMISHVHGNI LTTLNSSILP RHKSYLNRHN YPYHCKMVDS TLGHILRFVA

     251  ASNPSEYFEF IRKSVQVPVM QTHTHSHSHS HSLPSSVYNS IVPQFDLFSF

     301  IYLSRHNFKK YLELIKNLSV ALRKTIYHCL LLHYSAKAIM FWIMARPSEY

     351  YELFNLLRDN NNEYSKSVNT LNHTLFEDIH STFNVNSMIT TSQNAHQGSS

     401  SPSSSSPSSP PSSSSSDNNN QNIIAKSLSR QLSHHQSYIQ QQPERKLHSS

     451  WTTNSQSSTS LSSSTSTSTT TDFSNHSQSG EYDPSLPDTP TMSNITISAS

     501  SLLSQTPTPT TQLQQRLNSA AAAAAAAAAA ASPSNSTPTG YTEQQSRASY

     551  DAHKTDQTGK NYDEQFLSVA RLDNVLELYT HFDDTEVLPH TSVLKFLTTL

     601  TMFDIDLFNE LNATSFKYIP DCTMHRPKER TSSFNNATHE AGSEKTSGIK

     651  HITQGLKKLT SLPTSTKKTV KFIKMLLRNL NGTQAVSDVA LLDTMRALLS

     701  FFTMTSAVFL VDRNLPSALF AKRLIPIMGT NLSVGQDWNS KINNNLMVCL

     751  KKNSTTFVQL QLIFFSSAIQ FDHELLLARL SIDTMANNLN MQKLCLYTEG

     801  FRIFFDIPSK KELRKAIAVK ISKFFKTLFS IIADILLQEY PYFDEQITDI

     851  VASILDGTII NEYGTKKHFK GSSPSLCSTT RSRSGSTSQS SMTPVSPLGL

     901  DAEIYPMNTL SLVGSSTSRN SDNVNSLNSS PKNLSSDPYL SHLVAPRARH

     951  ALGGPSSIIR NKIPTTLTSP PGTEKSSPVQ RPQTESISAI PMAITNSTPL

    1001  SSAALGIRSP LQQIRTRRYS DESLGKFMKS TNNYIQEHLI PKDLNEATLQ

    1051  DARRIMINIF SIFKRPNSYF IIPHNLNSNL QWVSQDFRNI MKPIFVAIVS

    1101  SDVDLQNTAQ SFMDTLLSNV ITYSGSDENI SIEGYHLLCS YTVTLFAMGL

    1151  FDLKINNEKR QILLDISVKF MKVRSHLAGI AEASHHMEYI SDSEKLTFPL

    1201  IMGTVGRALF VSLYSSQPKI EKTLKIAYTE YLSAINFHER NIDDADKTWV

    1251  HNIEFVEAMC HDNYTTSGSI AFQRRTRNNI LRFATIPNAI LLDSMRMIYK

    1301  KWHTYTHSKN LEKQELNDFR NFAGILASLS GILFINKKIL QDIYPYLLDT

    1351  VSELKKNIDS FISKQCQWLN YPDLLTRENS RDILSIELHP LSFNLLFNNL

    1401  RLKLKELACS DLSIPENESS YVLLEQIIKM LRTILNRDDD NFVMMLFSTE

    1451  IVDLIDLLTE EIKKIPVYCP KYLKAIIQMA KMFSALQHSE VNLGVKNHFH

    1501  VKNKWLRQVT DWFQVSIARE YDFENLSKPL KEMDLVKRDM DILYIDTAIE

    1551  ASTAIAYLTR HTFLEIPPAA SDPELSRSRS VIFGYYFNIL MKGLEKSSDR

    1601  DNYPVFLRHK MSVLNDNVIL SLTNLSNTNV DASLQFTLPM GYSGNRNIRN

    1651  AFLEVFINIV TNYRTYTAKT DLGKLEAADK FLQYTIEHPQ LSTFGAAVCP

    1701  ASDIDAYAAG LINAFETRNA THIVVSQLIK NEIEKSSRPT DILRRNSCAT

    1751  RSLSMLARSK GNEYLIRTLQ PLLKKIIENK DFFEIEKLKP EDSDAERQVE

    1801  LFVKYMNELL DSISNSVSYF PPPLFYICQN IYKVACEKFP DHAIIAAGSF

    1851  VFLRFFCPAL VSPDSENIID ISHLSEKRTF ISLAKVIQNI ANGSENFSRW

    1901  PALCSQKGFL KECSNRIFKF LAELCRTDRT IDIQVRTDPT PIAFDFQFLH

    1951  SFVYLYGLEM RRNVLNEAKH DDGDIDSDDF YKTTFLLIDD VLGQLGQPKM

    2001  EFSNEIPIYI REHMDDYPEL YEFMNRHAFR NIETSTAYNP NVHESTSSEG

    2051  IPIITLTMSN FSNKHVDIDT VAYKFLQIYA RIWTTKHCLI IDCTEFDEGG

    2101  LDMRKFISLV MGLLPEVAPK NCMGCYYFNV NERFMDNYGK CLDKDNVYVS

    2151  SKIPHYFINS NSDEELMKSV GITGQGLKVL QDIRVSLHDI TLYDERRNRF

    2201  TPVSLKIGDI YFQVLHETPR QYKIRDMGTL FDVKFNDVYE ISRIFEVHVS

    2251  SITGVAAEFT VTFQDGKRLI FSSPKYLEIV KMFYYAQIRL ESEYEMDNNS

    2301  STSSNSSNKD KQQKERTKLL CHLLLVSLIG LFDENKKMKN SSYNLIAATE

    2351  ASFGLNFGSH FHRSPEVYVP EDTTTFLGVI AKSLAESNPE LTAYMFIYIL

    2401  DALKNNVIPH VYIPHTICGL SYWIPNLYQY VYLADDEEGP ENISHIFRVL

    2451  IRLSVRETDF KAVYMQYIWL LLLDDGRLSD IIVDEVINHA LERDSENRDW

    2501  KKTISLLTVL PTTEVANNII QKILAKIRSF LPSLKLEAMT QSWSELTILV

    2551  RISIHVFFET SLLVQMYLPE ILFIVSLLID VGPRELRSSL HQLLMNVCHS

    2601  LAINSALPQN HRKNLDEISD IFAHQKVKFM FGFSEDKGRI LQIFSASSFA

    2651  SKFNILDFFI NNILLLMEYS STYEANVWKT RYKKYVLESV FTSNSFLSAR

    2701  SIMIVGIMGK SYITEGLCKA MLIETMKVVA EPRITDEHLF LAISHIFTYS

    2751  KIVEGLDPNL DLMKHLFWLS TLFVESRHPI IFEGALLFLS NCIRRLYMSQ

    2801  FENESEVSLI TTLLKERKFA DTFLRKMEHL SDIVWNEDNF THILVSIINK

    2851  GLSNPFIKST AFDFLKMMFR NSYFEHQIDP KSDHYLCYMF LLYFVLSSSQ

    2901  FEELLGDIDF EGEMVNIENK NIIPKILLEW LSSDNENANI TLYQGAILFK

    2951  GSVTDEPSRF RFALIIRHLL MVKPICALRF YSVIRNEIRK ISAFEQTSDC

    3001  VPLAFDILNL LVTHSESNSL EKLHEKSIER LTKRGLLIVT SASVFAKNSD

    3051  MMIPLDVEPE DIYERKRIMT MILSRMSCSV *

Protein Sequence for WashU_Sbay_Contig541.4:

WashU_Sbay_Contig541.4  Length: 3080  Mon Nov  7 16:33:35 2016  Type: P  Check: 8916  ..

       1  MSHHTKNNKK EHGIDAQSSH MTRTLIKHVL FDRILPILPV ESNFSTYLEV

      51  EEYSPFISCR SVLINVAVFR DLNAIVGCSL ELIELLLQGH DIISDKNNDD

     101  VIESILVTLR LLSDALEYNW QKLESLNHSD ISTHIEHEQE QRPKLPGIFP

     151  EFSSAHNNDN KHFFHQMKPY SLMPELASKL IETCSALKFN TRTLKILQNM

     201  IDHVHGNILT TLSSTILPAH KTYLAKNNHP SHCKLIDSTL GHILRFLAAS

     251  NPSEYFEFIK KSVQLPVTQA QAHSHSHSHS LSSSVYNNIV PHLDLFSFIY

     301  LTKHNLKKYL EIVKNLSMAL RKTIYHCLLL HFTAKAIMFW IMARPAEYYE

     351  LFNLLRDNND EFAKSINLLI HTLFEEIHST FNVNSIITAA QNSHPGSSSP

     401  SPSSPSSPPS SSSSDNNQSV IAKSLSRQLS HHQSYIQQQP ERKLHSSWTT

     451  NSQSSTSLSS SASSSTTTSL STHAQSGEYE PSLAETPTMS NITISASSLL

     501  SQTPTPTTQL QQRLNAAAAA AAAAATSSSS NSTQTAYTEQ QQSRAAYDSP

     551  KPGHTGRDYD ENFLSVTRLN NVLELYTHFD DTEVLPHTSV LKFLTTLTMF

     601  DTDLFNELNA LSFKYIPDCV SHRPRERTGS VNNSVLHEVG SERTLGIKHI

     651  TQGLKKLTSL PTSTKKTVKF MKMLLKNLNG TQAVSDVALL DTMRALLSFL

     701  TMTSAVFLVD KNLPSVLFAK RLIPIIGTNL SVGQDWSSKM NYNLMGCLKK

     751  NSNAFIQLQL IFFSSAIQFD HELLLARLSI DTMANNLNLQ KLCLYTEGFR

     801  IFFDIPSKRE LRKSIAIKIS KFFKTLFSII ADILLQEFPY FDEQITDIVA

     851  SILDGTIINE YGTKKHFKGS SPSLCSTSRS RSGSTSQSSM TPVSPLGSEA

     901  DMYPMNTLSL VGSSTSRNSD NINSLNSSPK NLSTDPYLSH LVAPRARHAL

     951  GGPSSILRNK VPTTLTSPPD TEKSSPVQRP QTESISATAM AITNSTPLSS

    1001  AAFGIRSPLQ KIRTRRYSDE SLGKFMKSTN NYIQEHLVPK DLNEAALQDA

    1051  RRIMINIFSI FKRPNSYFII PHNINSNLQW VSQDFRNIMK PIFVAIVSAD

    1101  LALQKTAQSF MDTLLYNIIN YSESDETISI EGYHLLCSYT VTLFAMGLFD

    1151  LKIKNEKRQI LLDITIKFLK VRSHLAEIAE ASHHMEYIND AEKLTFPLIM

    1201  GTVGRALFVS LYSSRQEIEK TLKVAYTEYL SAINFHERNI DDSDKTWVHN

    1251  IEFVEAMCHD NYTTSGSIAF QRRTRNNILR FATIPNAILL DSMRMIYKKW

    1301  YLYAHTKNLD KQELNDFRNF AGILASLSGI LFINKKMLED IYPYLLDTVA

    1351  ELKKNISFFI SKQCQWLSYS DLLTRENSRD ILSVELHPLS FKLLFSSLRL

    1401  KLKELACSDL SIPENETSYI LLEQIIKMLR TILSREDDNS VMLLFSTEIV

    1451  DLISSLTEEI KKMPAYCPKH FKAIIQMTKM FSALQHSEVS LGLKNHFHIK

    1501  NRWLRQVTDW FQVSISREYD FENLSKPLKE MDLIKRDMDI LYIDTAIEAS

    1551  TAIAFLTRHT FLEIPPAASD PELSRSRSVI FGYYFNILMK GLEKSNDREK

    1601  FPVFLKHKMS VLNDNVILSL TNLSNTNVDA SLQFTLPMGY SGNRNIRNAF

    1651  LEVFINIVTN YRTYTAKSDL GKLEAADKFL RFTIEHPQLS SYAAAVCPAS

    1701  DIDAYAAGLI NAFETRNATH IAVSQLIENE IEKSSRPTDI LRRNSCATRS

    1751  LSMLARSKGS EYLIRTLQPL LKKIIDNKVF FEIEKLKPED PDAEKQVQLF

    1801  IKYMNELLDA ISNSVSYFPP PLFYICQNIY KVAREKFPDH ALIAAGSFVF

    1851  LRFFCPALVS PDSENIIDIS HPSEKRTFIS LAKVIQNIAN GSENFSRWPA

    1901  LSTQNEFLKE CSDRIFRFLA ELCRADRMID IQVRTDPTPI PFDYQFVHSF

    1951  VYLYGLEIRK NVLDEAKRDD GDIDDDEFYK STFLLIDDVL GQLGQPKMEF

    2001  SNEIPIYIRE HMDDYPELYE FMNRHAFRNM ETSTTYNPNV HESTSSEGVP

    2051  IITLTMSNFS NKHMDIDTVV YKFLQIYARI WTTKHCLIID CTEFDEDGLD

    2101  MRKFISLVMG LLPEVAPKNC LGCYYFNVNE MFMSNYGRCL DKENVFVSSK

    2151  IPHFFINSNS DEDLMKSLGI TGQGLKVLQD IRVSLHDITL YDEKRNRFTP

    2201  VSLKIGDIYF QVLHETPRQY KIRDMDTLFD VKFNDVYEIS RIFEVHVSSI

    2251  TGVAAEFTVT FQDGKRLIFS SPKYLEIVKM FYYAQIRLEN EYEMDNNSSA

    2301  SSSNSSAKDK QQKERNKLLC HLLLVSLIGL FDENKKMKNS SYNLVAATEI

    2351  SFGLNFGSHF HRSPEVYVPE ETTTFLSVIG KSLADSNPEL TTYMFIYILE

    2401  ALKNDVIPHV YIPHTVCGLS YWIPNLYQYV YLADDEEGPE NISHIFRVLI

    2451  RLSVKETDFK AVYMQYVWLL LLDDGRLTSI IVEEVINHAL ERDSENRDWK

    2501  KTISLLTVLP TTEVANNIVQ KIMAKIRSFL PSLKQEAMTQ SWSELTILVK

    2551  ISIHVFFETS LLVQMYLPEI LFIVSLLIDV GPRELRSSLH QLLMNVCHSL

    2601  AINSALPQDH RDNLDEISDI FAHQKVKFMF GFSEDKGRIL QIFSATSFAS

    2651  KFNILDFFIN NILLLMEYSS TYEANVWKTR YKKYILESVF TSNSFLSARS

    2701  IMIVGIMGKS YITESLCKAM IIETMKVIAE PRVTDEHIFL AISHIFTYSK

    2751  IVEGLDPNLD LMKHLFWFST ICLESRHPII FEGALLFVSS CMRRLYMSQF

    2801  ENESETSLIR SLLKERKFAS TLLCEIESID GIVWNGDNFT HIIVFIVNKG

    2851  LCNPFIRSTA FDFLKMVFKN SYFEHQIDRT SDHYLCYMFL LYFLLSSTQF

    2901  EEVLGDVDFE GEMVPIENEN TIPKVLLEWL SSDNEDPNIS LYQCAVLFKS

    2951  SVTDEPSKFR FALIVRHLLN VNPVCAFRFY KVIRNEIRKI SAFEQTSDCV

    3001  PLAFDILNLL VTHSESYSLD ELNEKSIELL TKRGLLTTTK VNKFAKNSDM

    3051  TLPLNIEPRV LYERKRILTM ILSRMSCST*

Protein Sequence for WashU_Scas_Contig710.46:

WashU_Scas_Contig710.46  Length: 1169  Mon Nov  7 16:33:35 2016  Type: P  Check: 8275  ..

       1  MVETLTKHLL FERILPILPI ESSHSTYLQV EADRFYRSCR SVVLNVAVSK

      51  GLNAITEQIL NLIDAIVKDG TIIDSNISDD AIQSVLTILR LLSDTMEYFW

     101  DNIETHGNTK VKQEQDETRY KAYSGSVTGF SINRSGFHRT PPNLIDTKLA

     151  TRLISTCTRV KFNSRTLEIL ENMACYVYET DSSFTSTILP DYQTFLKKKN

     201  YPESTKMVDV TINHILRFVA ASNPDEFFQY IYSNIHEPLL TNRTKTEFQV

     251  VQYFEMFGCS YITTINLPKY LQLVKVLSTG MKKTIFNCLL LFFASKSLMF

     301  WFMARPNEYV ELYRILKKHS EKNEAYVKNL SSSVSDLFEK IYSTFNVTSL

     351  LSNIDYDIND NHLVSSVKKK SRASSFDTGS DRSSISSLTA PDVAITNRPA

     401  SISSVSLSAT SLLSGSDKDL LDPRQSPRMN FQYNNISMGT RSKSRDANED

     451  MPHLESILEI YTYFEDTEKL PHTAVLRFLV MLVMLVPDVF VELNSQSLEK

     501  ISRPNIISGK EDTLEKPSNI RQITSGLKKL TTLQLSKKRT VKFLTILVKN

     551  INGTQPVSDG LLLDSMRTLL SLVTVTSSVS LIDSEIPPVI FSKRMIDLLG

     601  ANLKCGSSWK IRPSLTLTNC LKRNPATRDH LRLKYFCAAL QFDHIMFLSK

     651  LNINKTVESL DLDERIFYTE GFRVFFHLPS STQLRKEVAD LASDFLKNLF

     701  CTASDILMEA FPYFNDKITD IISSIVDGTI LEEFGTKKLF KESSSSLDAS

     751  ISSTSPSHNS SPSLLSPVST DQEDNTQQPF LTTSLLARLS DSHSSTGNTS

     801  SPSSNTTSIG NATSTTPSAT ELPFSQSLSQ RVPPISKSSL SRNLSGSSQI

     851  IAPSPVNISS SMMTLTNSMP AAPGNKTPTP TLTANKLRRY SEESNYNFNG

     901  LDIKPVESSV SLETKESRRA RMILINIFSI FKKMINYFIL PHARNSDLLW

     951  ISKDFKNIIK PIFVSLIDSD ESLQNTARSF MDGLLSYIKD LSSDTSTITV

    1001  SGYFLICSYT AALFSMGLFD LSIENHKRGV LLDIVVKFLQ LRSYLGKVSE

    1051  NTQHLERVLE AERNTFPLIL GSVGRATFVS LYVSNPLLQK NLKLAYREYL

    1101  TAIRFHLKHI GEFDKTFICN VPFIEMMASD TFASAGSVAF QRRVRNNIQK

    1151  YISQPDSVLL DSMHTIFR*