Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YNL293W and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_MSB3/YNL293W   1   MQNDQQRFSLQNRTVLAHPYKRLGGAFTVKSPSVPNFHDKMHSDHSSSDS   50
MIT_Smik_c1148_17794   1   MQNEQQRFSLQNRTALTHPYKRLGGAFTVKSPSVPNFHDKMHSDHSSSDS   50
MIT_Spar_c234_18226   1   MQNDQQRFSLQNRTVLTHPYKRLGGAFTVKSPSVPNFHDRMHSDHSSSDS   50
MIT_Suva_c206_19975   1   MQNDHQRLSLHNRAVLTHPYKRLGGAFPVKSPSVPNFHDRVYPGHSSSDP   50
WashU_Sbay_Contig641.38   1   MQNDHQRLSLHNRAVLTHPYKRLGGAFPVKSPSVPNFHDRVYPGHSSSDP   50
WashU_Scas_Contig598.10   1   -MVATDFTSPLMRTTTGGNHHGFTSKFSIRSPSVPNLRQQLYSETNNYSA   49
WashU_Skud_Contig1783.4   1   --------------MLTHPYKRLGGAFSVKSPSVPNFHDRIYSDHSSSDS   36
Symbols






:: : . *.::******::::::. .. ..



SGD_Scer_MSB3/YNL293W   51   ALVNGSFRANDHRSVEPSCLGQASPSEHDGNLSVIDLYGDEVESQRAEG-   99
MIT_Smik_c1148_17794   51   ALVHGNVMVNDHRSVEPSCLGQVSPSEHDGNLSVIDLYGDEVESQRAGVG   100
MIT_Spar_c234_18226   51   ALVNGNTRGNDHRSVEPSCLGQVSPSEHDGNLSVIDLYGDEVESQRAEV-   99
MIT_Suva_c206_19975   51   ALVNDDAILSDHRTVEPSCLGQASPSEHDGNLSVIDLYGDEVESQRVDDD   100
WashU_Sbay_Contig641.38   51   ALVNDDAILSDHRTVEPSCLGQASPSEHDGNLSVIDLYGDEVESQRVDDD   100
WashU_Scas_Contig598.10   50   PAIEGIPNNKDAINDQRS-----NSEEYGGSLSVIDLY-----------D   83
WashU_Skud_Contig1783.4   37   ALVNENPRVNKHHAVEPSSLGQVSPSEHDGNLSVIDLYGDEVDSQRGEVE   86
Symbols






. :. .. : * ...*:.*.*******



SGD_Scer_MSB3/YNL293W   100   EDDDDNNGDNGNEDLEEVHSDDLDLVPDDDNRQRVELEGAASATSANSNG   149
MIT_Smik_c1148_17794   101   DDDDDDLEEVHSDDLEEVHSDDLDLIPEEGNHQCVELDGVAAAASGNSND   150
MIT_Spar_c234_18226   100   EDDD-NYDNNDNEDLEEVHSDDLDLVPDEGNRQ--RVDGATNATSANSNG   146
MIT_Suva_c206_19975   101   DDDDEDQDGTHSDDLDLVP-------GEGGQHVELDDVTAVTSKSASADG   143
WashU_Sbay_Contig641.38   101   DDDDEDQDGTHSDDLDLVP-------GEGGQHVELDDVTAVTSKSASADG   143
WashU_Scas_Contig598.10   84   DNDSESPQKKSTRSITGLEDFQKDVGELNSMSADHSNDDLRRSNSITIDI   133
WashU_Skud_Contig1783.4   87   DEDDDYNYN-EDQDGAHSEDLDLAFAEGNLQHVELDGVAAATSKSALSDG   135
Symbols






::*. . : * :



SGD_Scer_MSB3/YNL293W   150   INNTHFDRYGFKKQNNYISEAEYDKWWVEYSQYCVRRKHKWQLLLEKSGL   199
MIT_Smik_c1148_17794   151   INSSRFDRYGFKKQNNYISESDYDRWWVEYSQYCVRRKHKWQLLLEKSGL   200
MIT_Spar_c234_18226   147   VKNTHFDRYGFKKQNNYISEAEYDKWWVEYSQYCVRRKHKWQLLLEKSGL   196
MIT_Suva_c206_19975   144   VNNTHFDRYGFKKQNNYISESEYDSWWGDYSQYCVRRKHKWQLLLEKSGL   193
WashU_Sbay_Contig641.38   144   VNNTHFDRYGFKKQNNYISESEYDSWWGDYSQYCVRRKHKWQLLLEKSGL   193
WashU_Scas_Contig598.10   134   NENEHTDRYGFKKQSTFISEADYNSWWNDYSKYCVRRKFKWKLLLEKGGL   183
WashU_Skud_Contig1783.4   136   VENTHFDRYGFKKQNNHISEAEYDRWWLDYSQYCVRRKHKWQLLLEKSGL   185
Symbols






:. : ********...***::*: ** :**:******.**:*****.**



SGD_Scer_MSB3/YNL293W   200   PVTDDSPSRFPSKSERLKRYVRKGIPAEWRGNAWWHFARGQEKLNKNKGV   249
MIT_Smik_c1148_17794   201   PVTDDSPSRFPPRSERLKRYVRKGIPAEWRGNAWWHFARGQEKLNKNRGV   250
MIT_Spar_c234_18226   197   PVTDDSPSRFPSKSERLKRYVRKGIPAEWRGNAWWHFARGQEKLNKNKGV   246
MIT_Suva_c206_19975   194   PVTDDSPARFPSKSERLKRYVRKGIPAEWRGNAWWHFARGQEKLNKNKGI   243
WashU_Sbay_Contig641.38   194   PVTDDSPARFPSKSERLKRYVRKGIPAEWRGNAWWHFARGQEKLNKNKGI   243
WashU_Scas_Contig598.10   184   PVDNDSPTRFPSKSEKLKRYVRKGIPAEWRGDAWWYFARGQEKLNRHKGV   233
WashU_Skud_Contig1783.4   186   PVTDDSPSRFPSKSERLKRYVRKGIPAEWRGNAWWHFARGQEKLNKNKGV   235
Symbols






** :***:***.:**:***************:***:*********:::*:



SGD_Scer_MSB3/YNL293W   250   YSQLLRKMKQIKKQNPNEKQVQDLDIIERDLNRTFPDNIHFQSSLHNKEG   299
MIT_Smik_c1148_17794   251   YSQLLQKMKQIKRQNPNEKQVQDLDIIERDLNRTFPDNIHFQSGSQNKEG   300
MIT_Spar_c234_18226   247   YSQLLQKMKQIKKQNPNEKQVQDLDIIERDLNRTFPDNLHFQSGSHNKEG   296
MIT_Suva_c206_19975   244   YSQLLQKMKQIKKQNPNEKQVQDLDIIERDLNRTFPDNVHFQSASYNKEE   293
WashU_Sbay_Contig641.38   244   YSQLLQKMKQIKKQNPNEKQVQDLDIIERDLNRTFPDNVHFQSASYNKEE   293
WashU_Scas_Contig598.10   234   YDTLLVKVNKITEQKDHDNVFTDLEIIERDLNRTFPDNIHFQKQSPQDEE   283
WashU_Skud_Contig1783.4   236   YSQLLQKMKQIKEQNPNERQVQDLDIIERDLNRTFPDNIHFQSASYNKEG   285
Symbols






*. ** *:::*..*: ::. . **:*************:***. :.*



SGD_Scer_MSB3/YNL293W   300   PPIIKSLRRVLVAFSLYNPKIGYCQSMNFLAGLLLLFLDEERAFWMLVII   349
MIT_Smik_c1148_17794   301   PPIIKSLRRVLVAFSLYNPKIGYCQSMNFLAGLLLLFLDEERAFWMLVII   350
MIT_Spar_c234_18226   297   PPIIKSLRRVLVAFSLYNPKIGYCQSMNFLAGLLLLFLDEERAFWMLVII   346
MIT_Suva_c206_19975   294   PPIIKSLRRVLVAFSLYNPKIGYCQSMNFLAGLLLLFLDEERAFWMLVII   343
WashU_Sbay_Contig641.38   294   PPIIKSLRRVLVAFSLYNPKIGYCQSMNFLAGLLLLFLDEERAFWMLVII   343
WashU_Scas_Contig598.10   284   PELIKSLRRVLVAFSLYNPKIGYCQSMNFIAGLLLLFLDEERAFWMLVII   333
WashU_Skud_Contig1783.4   286   PPIIKSLRRVLVAFSLYNPKIGYCQSMNFLAGLLLLFLDEERAFWMLVII   335
Symbols






* :**************************:********************



SGD_Scer_MSB3/YNL293W   350   TSRYLPGVHNINLEGVNIDQGVLMLCVKEYIPEVWSYIKPSIDHHQKNN-   398
MIT_Smik_c1148_17794   351   TSRYLPGVHNINLEGVNIDQGVLMLCVKEYIPEVWSYIKPSIDHHQKNN-   399
MIT_Spar_c234_18226   347   TSRYLPGVHNINLEGVNIDQGVLMLCVKEYIPEVWSYIKPSIDHHQKNN-   395
MIT_Suva_c206_19975   344   TSRYLPGVHNINLEGVNIDQGVLMLCVKEYIPEVWSYIKPSIDHHQQNN-   392
WashU_Sbay_Contig641.38   344   TSRYLPGVHNINLEGVNIDQGVLMLCVKEYIPEVWSYIKPSIDHHQQNN-   392
WashU_Scas_Contig598.10   334   TSRYLPGVHDVNLEGVNIDQGVLMLCVKEYLPEIWSYIAPITNKKGASNN   383
WashU_Skud_Contig1783.4   336   TSRYLPGVHNINLEGVNIDQGVLMLCVKEYIPEVWSYIKPSIDHHQKNN-   384
Symbols






*********::*******************:**:**** * ::: .*



SGD_Scer_MSB3/YNL293W   399   -KTFSPSNKKVLFNMQKNEFLYRLPPITLCTASWFMSCFVGVVPIETTLR   447
MIT_Smik_c1148_17794   400   -KTFSPSNNKVLFNMQKNEFLYRLPPITLCTASWFMSCFVGVVPIETTLR   448
MIT_Spar_c234_18226   396   -KTFSPSNSKVLFNMQKNEFLYRLPPITLCTASWFMSCFVGVVPIETTLR   444
MIT_Suva_c206_19975   393   -KTFSPSNNKVLFNMQKNEFLYRLPPITLCTASWFMSCFVGIVPIETTLR   441
WashU_Sbay_Contig641.38   393   -KTFSPSNNKVLFNMQKNEFLYRLPPITLCTASWFMSCFVGIVPIETTLR   441
WashU_Scas_Contig598.10   384   RRTTSSTSRKNRSLIIKNEFLYRLPPITLCTASWFMSCFIGILPIETTLR   433
WashU_Skud_Contig1783.4   385   -KTFSPSNNKVLFNMQKNEFLYRLPPITLCTASWFMSCFVGVVPIETTLR   433
Symbols






:* *.:. * : ***********************:*::*******



SGD_Scer_MSB3/YNL293W   448   IWDCLFYEESHFLFKVSLAVLKLSEHDLSKIKPRNN-----SLNYSWGSN   492
MIT_Smik_c1148_17794   449   IWDCLFYEESHFLFKVSLAVLKLSEHELSKIKPHNN-----SLNYSWGSN   493
MIT_Spar_c234_18226   445   IWDCLFYEESHFLFKVSLAVLKMSEHELSKIKPRNN-----SLNYSWGTN   489
MIT_Suva_c206_19975   442   IWDCLFYEESHFLFKTSLAVLKLSEHELSKTKPRSN-----SLNYSWTS-   485
WashU_Sbay_Contig641.38   442   IWDCLFYEESHFLFKTSLAVLKLSEHELSKTKPRSN-----SLNYSWTS-   485
WashU_Scas_Contig598.10   434   VWDCMFYEESHFLFKISLSILKLSENDLLRHKKHRHGGGILSYGIKGGNS   483
WashU_Skud_Contig1783.4   434   IWDCLFYEESHFLFKVSLAVLKLSEHELSKIKPRNN-----SLNYSWGSN   478
Symbols






:***:********** **::**:**::* : * : : * . . .



SGD_Scer_MSB3/YNL293W   493   LNQRGGS---MGQEDSDMEIFQVIQTFPKTLLNPNEIFEKIIFKRRFNLN   539
MIT_Smik_c1148_17794   494   LNQKNGS---MGQEDSDMEIFQVIQTFPKTLLNPNEIFEKIIFKRRFNLN   540
MIT_Spar_c234_18226   490   LNQRGGS---MGQEDSDMEIFQVIQTFPKTLLNPNEIFEKIIFKRRFNLN   536
MIT_Suva_c206_19975   486   -NQRNGS---MGQEDSDMEIFQVIQTFPKTLLNPNEIFEKIIFKRRFNLN   531
WashU_Sbay_Contig641.38   486   -NQRNGS---MGQEDSDMEIFQVIQTFPKTLLNPNEIFEKIIFKRRFNLN   531
WashU_Scas_Contig598.10   484   SNTSLGSSNDAASEDGDMEIFQIIQTFPKKLLNPNDIFDKVIFKRKYSFN   533
WashU_Skud_Contig1783.4   479   LNQKNGL---MGQEDNDMEIFQVIQTFPKTLLNPNEIFEKIISKGDLIX-   524
Symbols






* * ..**.******:******.*****:**:*:* *



SGD_Scer_MSB3/YNL293W   540   RLDQDEIDRCRKFVAAQRLKFKTYGELLGNSTSEADLPINDN----TDNK   585
MIT_Smik_c1148_17794   541   RLDQDEIDRCRKFVAAQRLKFKTYGELLGNAASEADLPANNSN---TDNQ   587
MIT_Spar_c234_18226   537   RLDQDEIDRCRKFVAAQRLKFKTYGELLGNSTSESDLPINNNNN--TDNK   584
MIT_Suva_c206_19975   532   RLDQDEIDRCRKFVAAQRVKFKTYGELLGSATSEAELSSANFN---TDAK   578
WashU_Sbay_Contig641.38   532   RLDQDEIDRCRKFVAAQRVKFKTYGELLGSATSEAELSSANFN---TDAK   578
WashU_Scas_Contig598.10   534   RLDQDEVDRCRKYVSSQRTKYKHYIDTVEKQEIRGIDKSTNHIGEKENIL   583
WashU_Skud_Contig1783.4   
   --------------------------------------------------   
Symbols










SGD_Scer_MSB3/YNL293W   586   GIHITSDAVNEALSSEVYGFKKSLAGVHWNNSIKEKVKQMRKKKDKGD   633
MIT_Smik_c1148_17794   588   GVHITSDAVNEALSSEVYGFKKSLAGVHWNNSIKEKVKQMRKKKDRSD   635
MIT_Spar_c234_18226   585   GIHITSDAVNEALSSEVYGFKKSLAGVHWNNSIKEKVKQMRKKKDRND   632
MIT_Suva_c206_19975   579   GTHITSDAVNEALSSEVYGFKKSLAGVHWNNSIKEKVKQMRKKKDRND   626
WashU_Sbay_Contig641.38   579   GTHITSDAVNEALSSEVYGFKKSLAGVHWNNSIKEKVKQMRKKKDRND   626
WashU_Scas_Contig598.10   584   TSEMDEDTINEALSSEVYGFKRNLTGVHWNNSLKAKVRQMKKKIDREV   631
WashU_Skud_Contig1783.4   
   ------------------------------------------------   
Symbols










Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_MSB3/YNL293W:

SGD_Scer_MSB3/YNL293W  Length: 634  Mon Nov  7 16:29:09 2016  Type: P  Check: 8257  ..

       1  MQNDQQRFSL QNRTVLAHPY KRLGGAFTVK SPSVPNFHDK MHSDHSSSDS

      51  ALVNGSFRAN DHRSVEPSCL GQASPSEHDG NLSVIDLYGD EVESQRAEGE

     101  DDDDNNGDNG NEDLEEVHSD DLDLVPDDDN RQRVELEGAA SATSANSNGI

     151  NNTHFDRYGF KKQNNYISEA EYDKWWVEYS QYCVRRKHKW QLLLEKSGLP

     201  VTDDSPSRFP SKSERLKRYV RKGIPAEWRG NAWWHFARGQ EKLNKNKGVY

     251  SQLLRKMKQI KKQNPNEKQV QDLDIIERDL NRTFPDNIHF QSSLHNKEGP

     301  PIIKSLRRVL VAFSLYNPKI GYCQSMNFLA GLLLLFLDEE RAFWMLVIIT

     351  SRYLPGVHNI NLEGVNIDQG VLMLCVKEYI PEVWSYIKPS IDHHQKNNKT

     401  FSPSNKKVLF NMQKNEFLYR LPPITLCTAS WFMSCFVGVV PIETTLRIWD

     451  CLFYEESHFL FKVSLAVLKL SEHDLSKIKP RNNSLNYSWG SNLNQRGGSM

     501  GQEDSDMEIF QVIQTFPKTL LNPNEIFEKI IFKRRFNLNR LDQDEIDRCR

     551  KFVAAQRLKF KTYGELLGNS TSEADLPIND NTDNKGIHIT SDAVNEALSS

     601  EVYGFKKSLA GVHWNNSIKE KVKQMRKKKD KGD*

Protein Sequence for MIT_Smik_c1148_17794:

MIT_Smik_c1148_17794  Length: 636  Mon Nov  7 16:29:09 2016  Type: P  Check: 2530  ..

       1  MQNEQQRFSL QNRTALTHPY KRLGGAFTVK SPSVPNFHDK MHSDHSSSDS

      51  ALVHGNVMVN DHRSVEPSCL GQVSPSEHDG NLSVIDLYGD EVESQRAGVG

     101  DDDDDDLEEV HSDDLEEVHS DDLDLIPEEG NHQCVELDGV AAAASGNSND

     151  INSSRFDRYG FKKQNNYISE SDYDRWWVEY SQYCVRRKHK WQLLLEKSGL

     201  PVTDDSPSRF PPRSERLKRY VRKGIPAEWR GNAWWHFARG QEKLNKNRGV

     251  YSQLLQKMKQ IKRQNPNEKQ VQDLDIIERD LNRTFPDNIH FQSGSQNKEG

     301  PPIIKSLRRV LVAFSLYNPK IGYCQSMNFL AGLLLLFLDE ERAFWMLVII

     351  TSRYLPGVHN INLEGVNIDQ GVLMLCVKEY IPEVWSYIKP SIDHHQKNNK

     401  TFSPSNNKVL FNMQKNEFLY RLPPITLCTA SWFMSCFVGV VPIETTLRIW

     451  DCLFYEESHF LFKVSLAVLK LSEHELSKIK PHNNSLNYSW GSNLNQKNGS

     501  MGQEDSDMEI FQVIQTFPKT LLNPNEIFEK IIFKRRFNLN RLDQDEIDRC

     551  RKFVAAQRLK FKTYGELLGN AASEADLPAN NSNTDNQGVH ITSDAVNEAL

     601  SSEVYGFKKS LAGVHWNNSI KEKVKQMRKK KDRSD*

Protein Sequence for MIT_Spar_c234_18226:

MIT_Spar_c234_18226  Length: 633  Mon Nov  7 16:29:09 2016  Type: P  Check: 2271  ..

       1  MQNDQQRFSL QNRTVLTHPY KRLGGAFTVK SPSVPNFHDR MHSDHSSSDS

      51  ALVNGNTRGN DHRSVEPSCL GQVSPSEHDG NLSVIDLYGD EVESQRAEVE

     101  DDDNYDNNDN EDLEEVHSDD LDLVPDEGNR QRVDGATNAT SANSNGVKNT

     151  HFDRYGFKKQ NNYISEAEYD KWWVEYSQYC VRRKHKWQLL LEKSGLPVTD

     201  DSPSRFPSKS ERLKRYVRKG IPAEWRGNAW WHFARGQEKL NKNKGVYSQL

     251  LQKMKQIKKQ NPNEKQVQDL DIIERDLNRT FPDNLHFQSG SHNKEGPPII

     301  KSLRRVLVAF SLYNPKIGYC QSMNFLAGLL LLFLDEERAF WMLVIITSRY

     351  LPGVHNINLE GVNIDQGVLM LCVKEYIPEV WSYIKPSIDH HQKNNKTFSP

     401  SNSKVLFNMQ KNEFLYRLPP ITLCTASWFM SCFVGVVPIE TTLRIWDCLF

     451  YEESHFLFKV SLAVLKMSEH ELSKIKPRNN SLNYSWGTNL NQRGGSMGQE

     501  DSDMEIFQVI QTFPKTLLNP NEIFEKIIFK RRFNLNRLDQ DEIDRCRKFV

     551  AAQRLKFKTY GELLGNSTSE SDLPINNNNN TDNKGIHITS DAVNEALSSE

     601  VYGFKKSLAG VHWNNSIKEK VKQMRKKKDR ND*

Protein Sequence for MIT_Suva_c206_19975:

MIT_Suva_c206_19975  Length: 627  Mon Nov  7 16:29:09 2016  Type: P  Check: 8554  ..

       1  MQNDHQRLSL HNRAVLTHPY KRLGGAFPVK SPSVPNFHDR VYPGHSSSDP

      51  ALVNDDAILS DHRTVEPSCL GQASPSEHDG NLSVIDLYGD EVESQRVDDD

     101  DDDDEDQDGT HSDDLDLVPG EGGQHVELDD VTAVTSKSAS ADGVNNTHFD

     151  RYGFKKQNNY ISESEYDSWW GDYSQYCVRR KHKWQLLLEK SGLPVTDDSP

     201  ARFPSKSERL KRYVRKGIPA EWRGNAWWHF ARGQEKLNKN KGIYSQLLQK

     251  MKQIKKQNPN EKQVQDLDII ERDLNRTFPD NVHFQSASYN KEEPPIIKSL

     301  RRVLVAFSLY NPKIGYCQSM NFLAGLLLLF LDEERAFWML VIITSRYLPG

     351  VHNINLEGVN IDQGVLMLCV KEYIPEVWSY IKPSIDHHQQ NNKTFSPSNN

     401  KVLFNMQKNE FLYRLPPITL CTASWFMSCF VGIVPIETTL RIWDCLFYEE

     451  SHFLFKTSLA VLKLSEHELS KTKPRSNSLN YSWTSNQRNG SMGQEDSDME

     501  IFQVIQTFPK TLLNPNEIFE KIIFKRRFNL NRLDQDEIDR CRKFVAAQRV

     551  KFKTYGELLG SATSEAELSS ANFNTDAKGT HITSDAVNEA LSSEVYGFKK

     601  SLAGVHWNNS IKEKVKQMRK KKDRND*

Protein Sequence for WashU_Sbay_Contig641.38:

WashU_Sbay_Contig641.38  Length: 627  Mon Nov  7 16:29:09 2016  Type: P  Check: 8554  ..

       1  MQNDHQRLSL HNRAVLTHPY KRLGGAFPVK SPSVPNFHDR VYPGHSSSDP

      51  ALVNDDAILS DHRTVEPSCL GQASPSEHDG NLSVIDLYGD EVESQRVDDD

     101  DDDDEDQDGT HSDDLDLVPG EGGQHVELDD VTAVTSKSAS ADGVNNTHFD

     151  RYGFKKQNNY ISESEYDSWW GDYSQYCVRR KHKWQLLLEK SGLPVTDDSP

     201  ARFPSKSERL KRYVRKGIPA EWRGNAWWHF ARGQEKLNKN KGIYSQLLQK

     251  MKQIKKQNPN EKQVQDLDII ERDLNRTFPD NVHFQSASYN KEEPPIIKSL

     301  RRVLVAFSLY NPKIGYCQSM NFLAGLLLLF LDEERAFWML VIITSRYLPG

     351  VHNINLEGVN IDQGVLMLCV KEYIPEVWSY IKPSIDHHQQ NNKTFSPSNN

     401  KVLFNMQKNE FLYRLPPITL CTASWFMSCF VGIVPIETTL RIWDCLFYEE

     451  SHFLFKTSLA VLKLSEHELS KTKPRSNSLN YSWTSNQRNG SMGQEDSDME

     501  IFQVIQTFPK TLLNPNEIFE KIIFKRRFNL NRLDQDEIDR CRKFVAAQRV

     551  KFKTYGELLG SATSEAELSS ANFNTDAKGT HITSDAVNEA LSSEVYGFKK

     601  SLAGVHWNNS IKEKVKQMRK KKDRND*

Protein Sequence for WashU_Scas_Contig598.10:

WashU_Scas_Contig598.10  Length: 632  Mon Nov  7 16:29:09 2016  Type: P  Check: 6704  ..

       1  MVATDFTSPL MRTTTGGNHH GFTSKFSIRS PSVPNLRQQL YSETNNYSAP

      51  AIEGIPNNKD AINDQRSNSE EYGGSLSVID LYDDNDSESP QKKSTRSITG

     101  LEDFQKDVGE LNSMSADHSN DDLRRSNSIT IDINENEHTD RYGFKKQSTF

     151  ISEADYNSWW NDYSKYCVRR KFKWKLLLEK GGLPVDNDSP TRFPSKSEKL

     201  KRYVRKGIPA EWRGDAWWYF ARGQEKLNRH KGVYDTLLVK VNKITEQKDH

     251  DNVFTDLEII ERDLNRTFPD NIHFQKQSPQ DEEPELIKSL RRVLVAFSLY

     301  NPKIGYCQSM NFIAGLLLLF LDEERAFWML VIITSRYLPG VHDVNLEGVN

     351  IDQGVLMLCV KEYLPEIWSY IAPITNKKGA SNNRRTTSST SRKNRSLIIK

     401  NEFLYRLPPI TLCTASWFMS CFIGILPIET TLRVWDCMFY EESHFLFKIS

     451  LSILKLSEND LLRHKKHRHG GGILSYGIKG GNSSNTSLGS SNDAASEDGD

     501  MEIFQIIQTF PKKLLNPNDI FDKVIFKRKY SFNRLDQDEV DRCRKYVSSQ

     551  RTKYKHYIDT VEKQEIRGID KSTNHIGEKE NILTSEMDED TINEALSSEV

     601  YGFKRNLTGV HWNNSLKAKV RQMKKKIDRE V*

Protein Sequence for WashU_Skud_Contig1783.4:

WashU_Skud_Contig1783.4  Length: 524  Mon Nov  7 16:29:09 2016  Type: P  Check: 1866  ..

       1  MLTHPYKRLG GAFSVKSPSV PNFHDRIYSD HSSSDSALVN ENPRVNKHHA

      51  VEPSSLGQVS PSEHDGNLSV IDLYGDEVDS QRGEVEDEDD DYNYNEDQDG

     101  AHSEDLDLAF AEGNLQHVEL DGVAAATSKS ALSDGVENTH FDRYGFKKQN

     151  NHISEAEYDR WWLDYSQYCV RRKHKWQLLL EKSGLPVTDD SPSRFPSKSE

     201  RLKRYVRKGI PAEWRGNAWW HFARGQEKLN KNKGVYSQLL QKMKQIKEQN

     251  PNERQVQDLD IIERDLNRTF PDNIHFQSAS YNKEGPPIIK SLRRVLVAFS

     301  LYNPKIGYCQ SMNFLAGLLL LFLDEERAFW MLVIITSRYL PGVHNINLEG

     351  VNIDQGVLML CVKEYIPEVW SYIKPSIDHH QKNNKTFSPS NNKVLFNMQK

     401  NEFLYRLPPI TLCTASWFMS CFVGVVPIET TLRIWDCLFY EESHFLFKVS

     451  LAVLKLSEHE LSKIKPRNNS LNYSWGSNLN QKNGLMGQED NDMEIFQVIQ

     501  TFPKTLLNPN EIFEKIISKG DLIX