Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YNL039W and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_BDP1/YNL039W   1   MSSIVNKSGTRFAPKVRQRRAATGGTPTPKPRTPQLFIPESKEIEEDNSD   50
MIT_Smik_c403_18717   1   MSSIVNKSGTRFAPKVRQRRVATGGTPTPNSKTPQLFVPESKEIEIDNSD   50
MIT_Spar_c253_19196   1   MSSIVNKSGTRFAPKVRQRRAAAGGTPTPKPRTPQLFIPESKEIEIDNSD   50
MIT_Suva_c786_21020   1   MSSIVNKSGTRFAPKIRQRRIATSGTPTPKPRTPQLFIPESKEIDIDNSD   50
WashU_Sbay_Contig454.5   1   MSSIVNKSGTRFAPKIRQRRIATSGTPTPKPRTPQLFIPESKEIDIDNSD   50
WashU_Sklu_Contig2226.5   1   MSSVVNKSGTRFAPKVRQRRIVS-ATPANTPQQKAKVVSAPPESAIEDED   49
Symbols






***:***********:**** .: .**: ..: .:. . * ::.*



SGD_Scer_BDP1/YNL039W   51   NDKGVDENETAIVEKPSLVGERSLEGFTLTGTNGHDNEIG-DEGPIDAST   99
MIT_Smik_c403_18717   51   NDKSADENETVIVNKVLQIEEHSLEGVTLKATIGPDNEGE-HEGPMDVST   99
MIT_Spar_c253_19196   51   NDKVADENETAVVGKAPLGEEHSLEGFTLTATTGHDNGIE-HEGPIDAST   99
MIT_Suva_c786_21020   51   NDKAADKDEVTDTKKASQVEERSLEGSTLAVTARNDDELEENEGPIDAST   100
WashU_Sbay_Contig454.5   51   NDKAADKDEVTDTKKASQVEERSLEGSTLAVTARNDDELEENEGPIDAST   100
WashU_Sklu_Contig2226.5   50   DEELSKEK--------------------------PKQKSPVDEDDPLSHT   73
Symbols






::: .:. .: .*. *



SGD_Scer_BDP1/YNL039W   100   QNPKADVIEDNVTLKPAPLQTHRDQKVPRSSRLASLSKDNESRPSFKPSF   149
MIT_Smik_c403_18717   100   QNVKSNVIEENETRKMLTLQTQRDLKSSRSSRLASLSMDNENRPSFKPSF   149
MIT_Spar_c253_19196   100   QNPELNVTEDNATLKPAPLRTHLDQKTSRSSRLASLSKDNESRPSFKPSF   149
MIT_Suva_c786_21020   101   QKPTSTTIEESEKLQLAPTQTEREQKRSRSSRLASLSKDSESRPSFKPSF   150
WashU_Sbay_Contig454.5   101   QKPTSTTIEESEKLQLAPTQTEREQKRSRSSRLASLSKDSESRPSFKPSF   150
WashU_Sklu_Contig2226.5   74   QMAKEISISQTSTQLPVPVIIPAGQRR-RSSRLDSLS---NGKPLFKTGF   119
Symbols






* .:. . . : ***** *** :.:* **..*



SGD_Scer_BDP1/YNL039W   150   LDSSSNSNGT-----ARRLSTISNKLPKKIRLGSITENDMNLKTFKRHRV   194
MIT_Smik_c403_18717   150   LDSSSNTNGT-----ARRLSTISNKLPKKVRLGSITETDMNLKTFKRHRV   194
MIT_Spar_c253_19196   150   LDSSSNGNGT-----ARRLSTISNKLPKKIRLGSITENDMNLKTFKRHRV   194
MIT_Suva_c786_21020   151   LDSSSNSNGP-----ARRLSTISSKVPKKIRLGSITENDLNLKTFKRHRV   195
WashU_Sbay_Contig454.5   151   LDSSSNSNGP-----ARRLSTISSKVPKKIRLGSITENDLNLKTFKRHRV   195
WashU_Sklu_Contig2226.5   120   LDPQNAISGAPDQARNRRLSTIFNTSFKKKKMSSISENDTSFQAIKRRRM   169
Symbols






**... .*. ****** .. ** ::.**:*.* .::::**:*:



SGD_Scer_BDP1/YNL039W   195   LGKPSSAKKPAGAHRISIVSKISPPTAMTDSLDRNE------FSSETSTS   238
MIT_Smik_c403_18717   195   LGKPSSIKKPAGAHRISIVSKISPPTAMTDFSDKNE------SSSKTSTS   238
MIT_Spar_c253_19196   195   LGKPSSAKKPAGAHRISIVSKIPPPTAMTESLDRNE------LSSEVPTS   238
MIT_Suva_c786_21020   196   LGKPSSTKKSASAHRISIVSKIAPPTSMNDSVDKSE------SSPENFLL   239
WashU_Sbay_Contig454.5   196   LGKPSSTKKSASAHRISIVSKIAPPTSMNDSVDKSE------SSPENFLL   239
WashU_Sklu_Contig2226.5   170   SSRSSTSRKSGSAQRISIMSHMNTSDSQIMTATAGPDPNLKRESADELFQ   219
Symbols






.:.*: :*...*:****:*:: .. : . *..



SGD_Scer_BDP1/YNL039W   239   READENENYVISKVKDIPKKVRDGESAKYFIDEENFTMAELCKPNFPIGQ   288
MIT_Smik_c403_18717   239   RTANENENYVISKVKDIPKKVGDGESAKYLIDEENFTMAELCKPNFPIGQ   288
MIT_Spar_c253_19196   239   RAPNENENYVISKVKDIPKKVRDGESAKYFIDEENFTMAELCKPSFPIGQ   288
MIT_Suva_c786_21020   240   KAANENENYVISKVKDIPKKVRDGESAKYLIDEENFTMAELCKPSFPIGQ   289
WashU_Sbay_Contig454.5   240   KAANENENYVISKVKDIPKKVRDGESAKYLIDEENFTMAELCKPSFPIGQ   289
WashU_Sklu_Contig2226.5   220   RTDSLYEKYTISNLKEIPRNIADQDSSRYMVDEDSFTMADLCKPHLPIGE   269
Symbols






: . *:*.**::*:**::: * :*::*::**:.****:**** :***:



SGD_Scer_BDP1/YNL039W   289   ISENFEKSKMAKKAKLEKRRHLRELRMRARQEFKPLHSLTKEEQEEEEEK   338
MIT_Smik_c403_18717   289   ISENFEKSKMAKKAKLEKRRHFRELRMRAREEFKPLHSLTKEEQEEEEEK   338
MIT_Spar_c253_19196   289   ISENFEKSKMAKKAKLEKRRHLRELRMRARQEFKPLHSLTKEEQEQEEEK   338
MIT_Suva_c786_21020   290   ISENFEKSKMAKKAKLEKRKHLRELRMRARQEFKPLQSLTKEEQQEEEEK   339
WashU_Sbay_Contig454.5   290   ISENFEKSKMAKKAKLEKRKHLRELRMRARQEFKPLQSLTKEEQQEEEEK   339
WashU_Sklu_Contig2226.5   270   LSDNFQRAKDATKAKMEKRKKRREMRTRAREQFKPLNILTKEEEEKLKEE   319
Symbols






:*:**:::* *.***:***:: **:* ***::****: *****::: :*:



SGD_Scer_BDP1/YNL039W   339   RKEERDKLLNADIPESDRKAHTAIQLKLNPDGTMAIDEETMVVDRHKNAS   388
MIT_Smik_c403_18717   339   RKEERDKLLNADIPESDRKAHTAIQLKLNPDGTMAIDEDTMVVDRHKNAS   388
MIT_Spar_c253_19196   339   RKEERDKLLNADIPESDRKAHTAIQLKLNPDGTMAIDEETMVVDRHKNAS   388
MIT_Suva_c786_21020   340   RKEERNKVFNADIPESDRKAHTAIQLKLNADGTMAIDEETMVVDRHKNAS   389
WashU_Sbay_Contig454.5   340   RKEERNKVFNADIPESDRKAHTAIQLKLNADGTMAIDEETMVVDRHKNAS   389
WashU_Sklu_Contig2226.5   320   RKKAAENILNVELPEYEQKPHTAIQLKMNQDGSFVVDEESTVVDRHKNAG   369
Symbols






**: ::::*.::** ::*.*******:* **::.:**:: ********.



SGD_Scer_BDP1/YNL039W   389   IENEYKEKVDENPFANLYNYGSYGRGSYTDPWTVEEMIKFYKALSMWGTD   438
MIT_Smik_c403_18717   389   IENDYKEKVDENPFANLYNYGSYGRGSYTDPWTVEEMIKFYKALSMWGTD   438
MIT_Spar_c253_19196   389   IENDYKEKVDENPFANLYNYGSYGRGSYTDPWTVEEMIKFYKALSMWGTD   438
MIT_Suva_c786_21020   390   IENDYKEKVDENPFANLYNYGSYGRNSYTDPWTVEEMIKFYKSLSMWGTD   439
WashU_Sbay_Contig454.5   390   IENDYKEKVDENPFANLYNYGSYGRNSYTDPWTVEEMIKFYKSLSMWGTD   439
WashU_Sklu_Contig2226.5   370   LENVHKERLDENPFENLYNSASYGRQQYTDPWTSDEMIKFYKALSMWGTD   419
Symbols






:** :**::***** **** .**** .****** :*******:*******



SGD_Scer_BDP1/YNL039W   439   FNLISQLYPYRSRKQVKAKFVNEEKKRPILIELALRSKLPPNFDEYCCEI   488
MIT_Smik_c403_18717   439   FNLISQLYPYRSRRQVKAKFVSEEKKRPILIELALRSKLPPNFDEYCCEI   488
MIT_Spar_c253_19196   439   FNLISQLYPYRSRKQVKAKFVNEEKKRPILIELALRSKLPPNFDEYCCEI   488
MIT_Suva_c786_21020   440   FNLISQLYPYRSRRQVKAKFVNEEKKHPILIELALRSKLPPNFDEYCYET   489
WashU_Sbay_Contig454.5   440   FNLISQLYPYRSRRQVKAKFVNEEKKHPILIELALRSKLPPNFDEYCYET   489
WashU_Sklu_Contig2226.5   420   FNLIAQLFPYRSRRQVKAKFVNEERKRPVIIELALRSKLPPNFDHYCDEI   469
Symbols






****:**:*****:*******.**:*:*::**************.** *



SGD_Scer_BDP1/YNL039W   489   KKNIGTVADFNEKLIELQNEHKHHMKEIEEAKNTAKEEDQTAQRLN-DAN   537
MIT_Smik_c403_18717   489   KKNIGTVAEFNEKLIELQNEHEQHMKEIEEAKNTAKEEDQTTQRLN-DVD   537
MIT_Spar_c253_19196   489   KKNIGTVADFNEKLIELQNEHEQHMKEIEEAKNTAKEEDQTAQRLN-DAN   537
MIT_Suva_c786_21020   490   KRDIDTVANFNEKLVELQNEHEQHMKEIEEAKNTAKEEDQTTQRLN-DAN   538
WashU_Sbay_Contig454.5   490   KRDIDTVANFNEKLVELQNEHEQHMKEIEEAKNTAKEEDQTTQRLN-DAN   538
WashU_Sklu_Contig2226.5   470   KKDIGTVDEFNKKLEQLQVEHEEHLKQIEVSKQNAKQEDLQVQKAKEQDN   519
Symbols






*::*.** :**:** :** **:.*:*:** :*:.**:** .*: : : :



SGD_Scer_BDP1/YNL039W   538   LNKKGSGGIMTNDLKVYRKTEVVLGTIDDLKRKKLKERNNDDNEDNEGSE   587
MIT_Smik_c403_18717   538   LNKKGSGGIMTNDLKVYRKTEVVLGTIDDLKRKKRQEKNVNDDGDDEGDD   587
MIT_Spar_c253_19196   538   LNKKGSGGIMTNDLKVYRKTEVVLGTIDDLKRKKLKERNSNDNEDNEESG   587
MIT_Suva_c786_21020   539   LNKKGSGGIMTNDLKVYRKTEVVLGTIDDLKRKKRQEKDANGNEDDEGSG   588
WashU_Sbay_Contig454.5   539   LNKKGSGGIMTNDLKVYRKTEVVLGTIDDLKRKKRQEKDANGNEDDEGSG   588
WashU_Sklu_Contig2226.5   520   THKKTSGGLRHDQLKAYRKTEIVLGTIDDLKKKKAEELETGVE-------   562
Symbols






:** ***: ::**.*****:*********:** :* : . :



SGD_Scer_BDP1/YNL039W   588   EEPEIDQ   594
MIT_Smik_c403_18717   588   EEPGTNQ   594
MIT_Spar_c253_19196   588   GESEIDQ   594
MIT_Suva_c786_21020   589   AESEVDQ   595
WashU_Sbay_Contig454.5   589   AESEVDQ   595
WashU_Sklu_Contig2226.5   
   -------   
Symbols










Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_BDP1/YNL039W:

SGD_Scer_BDP1/YNL039W  Length: 595  Mon Nov  7 16:23:34 2016  Type: P  Check: 7062  ..

       1  MSSIVNKSGT RFAPKVRQRR AATGGTPTPK PRTPQLFIPE SKEIEEDNSD

      51  NDKGVDENET AIVEKPSLVG ERSLEGFTLT GTNGHDNEIG DEGPIDASTQ

     101  NPKADVIEDN VTLKPAPLQT HRDQKVPRSS RLASLSKDNE SRPSFKPSFL

     151  DSSSNSNGTA RRLSTISNKL PKKIRLGSIT ENDMNLKTFK RHRVLGKPSS

     201  AKKPAGAHRI SIVSKISPPT AMTDSLDRNE FSSETSTSRE ADENENYVIS

     251  KVKDIPKKVR DGESAKYFID EENFTMAELC KPNFPIGQIS ENFEKSKMAK

     301  KAKLEKRRHL RELRMRARQE FKPLHSLTKE EQEEEEEKRK EERDKLLNAD

     351  IPESDRKAHT AIQLKLNPDG TMAIDEETMV VDRHKNASIE NEYKEKVDEN

     401  PFANLYNYGS YGRGSYTDPW TVEEMIKFYK ALSMWGTDFN LISQLYPYRS

     451  RKQVKAKFVN EEKKRPILIE LALRSKLPPN FDEYCCEIKK NIGTVADFNE

     501  KLIELQNEHK HHMKEIEEAK NTAKEEDQTA QRLNDANLNK KGSGGIMTND

     551  LKVYRKTEVV LGTIDDLKRK KLKERNNDDN EDNEGSEEEP EIDQ*


Protein Sequence for MIT_Smik_c403_18717:

MIT_Smik_c403_18717  Length: 595  Mon Nov  7 16:23:34 2016  Type: P  Check: 232  ..

       1  MSSIVNKSGT RFAPKVRQRR VATGGTPTPN SKTPQLFVPE SKEIEIDNSD

      51  NDKSADENET VIVNKVLQIE EHSLEGVTLK ATIGPDNEGE HEGPMDVSTQ

     101  NVKSNVIEEN ETRKMLTLQT QRDLKSSRSS RLASLSMDNE NRPSFKPSFL

     151  DSSSNTNGTA RRLSTISNKL PKKVRLGSIT ETDMNLKTFK RHRVLGKPSS

     201  IKKPAGAHRI SIVSKISPPT AMTDFSDKNE SSSKTSTSRT ANENENYVIS

     251  KVKDIPKKVG DGESAKYLID EENFTMAELC KPNFPIGQIS ENFEKSKMAK

     301  KAKLEKRRHF RELRMRAREE FKPLHSLTKE EQEEEEEKRK EERDKLLNAD

     351  IPESDRKAHT AIQLKLNPDG TMAIDEDTMV VDRHKNASIE NDYKEKVDEN

     401  PFANLYNYGS YGRGSYTDPW TVEEMIKFYK ALSMWGTDFN LISQLYPYRS

     451  RRQVKAKFVS EEKKRPILIE LALRSKLPPN FDEYCCEIKK NIGTVAEFNE

     501  KLIELQNEHE QHMKEIEEAK NTAKEEDQTT QRLNDVDLNK KGSGGIMTND

     551  LKVYRKTEVV LGTIDDLKRK KRQEKNVNDD GDDEGDDEEP GTNQ*


Protein Sequence for MIT_Spar_c253_19196:

MIT_Spar_c253_19196  Length: 595  Mon Nov  7 16:23:34 2016  Type: P  Check: 7180  ..

       1  MSSIVNKSGT RFAPKVRQRR AAAGGTPTPK PRTPQLFIPE SKEIEIDNSD

      51  NDKVADENET AVVGKAPLGE EHSLEGFTLT ATTGHDNGIE HEGPIDASTQ

     101  NPELNVTEDN ATLKPAPLRT HLDQKTSRSS RLASLSKDNE SRPSFKPSFL

     151  DSSSNGNGTA RRLSTISNKL PKKIRLGSIT ENDMNLKTFK RHRVLGKPSS

     201  AKKPAGAHRI SIVSKIPPPT AMTESLDRNE LSSEVPTSRA PNENENYVIS

     251  KVKDIPKKVR DGESAKYFID EENFTMAELC KPSFPIGQIS ENFEKSKMAK

     301  KAKLEKRRHL RELRMRARQE FKPLHSLTKE EQEQEEEKRK EERDKLLNAD

     351  IPESDRKAHT AIQLKLNPDG TMAIDEETMV VDRHKNASIE NDYKEKVDEN

     401  PFANLYNYGS YGRGSYTDPW TVEEMIKFYK ALSMWGTDFN LISQLYPYRS

     451  RKQVKAKFVN EEKKRPILIE LALRSKLPPN FDEYCCEIKK NIGTVADFNE

     501  KLIELQNEHE QHMKEIEEAK NTAKEEDQTA QRLNDANLNK KGSGGIMTND

     551  LKVYRKTEVV LGTIDDLKRK KLKERNSNDN EDNEESGGES EIDQ*


Protein Sequence for MIT_Suva_c786_21020:

MIT_Suva_c786_21020  Length: 596  Mon Nov  7 16:23:34 2016  Type: P  Check: 6027  ..

       1  MSSIVNKSGT RFAPKIRQRR IATSGTPTPK PRTPQLFIPE SKEIDIDNSD

      51  NDKAADKDEV TDTKKASQVE ERSLEGSTLA VTARNDDELE ENEGPIDAST

     101  QKPTSTTIEE SEKLQLAPTQ TEREQKRSRS SRLASLSKDS ESRPSFKPSF

     151  LDSSSNSNGP ARRLSTISSK VPKKIRLGSI TENDLNLKTF KRHRVLGKPS

     201  STKKSASAHR ISIVSKIAPP TSMNDSVDKS ESSPENFLLK AANENENYVI

     251  SKVKDIPKKV RDGESAKYLI DEENFTMAEL CKPSFPIGQI SENFEKSKMA

     301  KKAKLEKRKH LRELRMRARQ EFKPLQSLTK EEQQEEEEKR KEERNKVFNA

     351  DIPESDRKAH TAIQLKLNAD GTMAIDEETM VVDRHKNASI ENDYKEKVDE

     401  NPFANLYNYG SYGRNSYTDP WTVEEMIKFY KSLSMWGTDF NLISQLYPYR

     451  SRRQVKAKFV NEEKKHPILI ELALRSKLPP NFDEYCYETK RDIDTVANFN

     501  EKLVELQNEH EQHMKEIEEA KNTAKEEDQT TQRLNDANLN KKGSGGIMTN

     551  DLKVYRKTEV VLGTIDDLKR KKRQEKDANG NEDDEGSGAE SEVDQ*


Protein Sequence for WashU_Sbay_Contig454.5:

WashU_Sbay_Contig454.5  Length: 596  Mon Nov  7 16:23:34 2016  Type: P  Check: 6027  ..

       1  MSSIVNKSGT RFAPKIRQRR IATSGTPTPK PRTPQLFIPE SKEIDIDNSD

      51  NDKAADKDEV TDTKKASQVE ERSLEGSTLA VTARNDDELE ENEGPIDAST

     101  QKPTSTTIEE SEKLQLAPTQ TEREQKRSRS SRLASLSKDS ESRPSFKPSF

     151  LDSSSNSNGP ARRLSTISSK VPKKIRLGSI TENDLNLKTF KRHRVLGKPS

     201  STKKSASAHR ISIVSKIAPP TSMNDSVDKS ESSPENFLLK AANENENYVI

     251  SKVKDIPKKV RDGESAKYLI DEENFTMAEL CKPSFPIGQI SENFEKSKMA

     301  KKAKLEKRKH LRELRMRARQ EFKPLQSLTK EEQQEEEEKR KEERNKVFNA

     351  DIPESDRKAH TAIQLKLNAD GTMAIDEETM VVDRHKNASI ENDYKEKVDE

     401  NPFANLYNYG SYGRNSYTDP WTVEEMIKFY KSLSMWGTDF NLISQLYPYR

     451  SRRQVKAKFV NEEKKHPILI ELALRSKLPP NFDEYCYETK RDIDTVANFN

     501  EKLVELQNEH EQHMKEIEEA KNTAKEEDQT TQRLNDANLN KKGSGGIMTN

     551  DLKVYRKTEV VLGTIDDLKR KKRQEKDANG NEDDEGSGAE SEVDQ*


Protein Sequence for WashU_Sklu_Contig2226.5:

WashU_Sklu_Contig2226.5  Length: 563  Mon Nov  7 16:23:34 2016  Type: P  Check: 8209  ..

       1  MSSVVNKSGT RFAPKVRQRR IVSATPANTP QQKAKVVSAP PESAIEDEDD

      51  EELSKEKPKQ KSPVDEDDPL SHTQMAKEIS ISQTSTQLPV PVIIPAGQRR

     101  RSSRLDSLSN GKPLFKTGFL DPQNAISGAP DQARNRRLST IFNTSFKKKK

     151  MSSISENDTS FQAIKRRRMS SRSSTSRKSG SAQRISIMSH MNTSDSQIMT

     201  ATAGPDPNLK RESADELFQR TDSLYEKYTI SNLKEIPRNI ADQDSSRYMV

     251  DEDSFTMADL CKPHLPIGEL SDNFQRAKDA TKAKMEKRKK RREMRTRARE

     301  QFKPLNILTK EEEEKLKEER KKAAENILNV ELPEYEQKPH TAIQLKMNQD

     351  GSFVVDEEST VVDRHKNAGL ENVHKERLDE NPFENLYNSA SYGRQQYTDP

     401  WTSDEMIKFY KALSMWGTDF NLIAQLFPYR SRRQVKAKFV NEERKRPVII

     451  ELALRSKLPP NFDHYCDEIK KDIGTVDEFN KKLEQLQVEH EEHLKQIEVS

     501  KQNAKQEDLQ VQKAKEQDNT HKKTSGGLRH DQLKAYRKTE IVLGTIDDLK

     551  KKKAEELETG VE*