Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YMR300C and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_ADE4/YMR300C   1   MCGILGIVLANQTTPVAPELCDGCIFLQHRGQDAAGIATCGSRGRIYQCK   50
MIT_Smik_c470_17554   1   MCGILGIVLANQTTPVAPELCDGCIFLQHRGQDAAGIATCGSRGRIYQCK   50
MIT_Spar_c419_17970   1   MCGILGIVLANQTTPVAPELCDGCIFLQHRGQDAAGIATCGSRGRIYQCK   50
MIT_Suva_c752_19381   1   MCGILGIVLANQSTPVAPELCDGCIFLQHRGQDAAGIATCGSGGRIYQCK   50
WashU_Sbay_Contig671.5   1   MCGILGIVLANQSTPVAPELCDGCIFLQHRGQDAAGIATCGSGGRIYQCK   50
WashU_Scas_Contig574.7   1   MCGILGIALADQSSKVAPELCDGCIFLQHRGQDAAGIATCGSRGRIYQCK   50
WashU_Sklu_Contig1419.1   1   MCGILGIALSDQSSVVAPELFDGSLFLQHRGQDAAGMATCGERGRLYQCK   50
WashU_Smik_Contig2426.2   1   MCGILGIVLANQTTPVAPELCDGCIFLQHRGQDAAGIATCGSRGRIYQCK   50
Symbols






*******.*::*:: ***** **.:***********:****. **:****



SGD_Scer_ADE4/YMR300C   51   GNGMARDVFTQQRVSGLAGSMGIAHLRYPTAGSSANSEAQPFYVNSPYGI   100
MIT_Smik_c470_17554   51   GNGMARDVFTQQRVSGLAGSMGIAHLRYPTAGSSANSEAQPFYVNSPYGI   100
MIT_Spar_c419_17970   51   GNGMARDVFTQQRVSGLAGSMGIAHLRYPTAGSSANSEAQPFYVNSPYGI   100
MIT_Suva_c752_19381   51   GNGMARDVFTQQRVSGLAGSMGIAHLRYPTAGSSANSEAQPFYVNSPYGI   100
WashU_Sbay_Contig671.5   51   GNGMARDVFTQQRVSGLAGSMGIAHLRYPTAGSSANSEAQPFYVNSPYGI   100
WashU_Scas_Contig574.7   51   GNGMARDVFTAPRVHGLVGSMGIAHLRYPTAGSSANSEAQPFYVNSPYGI   100
WashU_Sklu_Contig1419.1   51   GNGMARDVFTQHRMSGLVGSMGIAHLRYPTAGSCANSEAQPFYVNSPYGI   100
WashU_Smik_Contig2426.2   51   GNGMARDVFTQQRVSGLAGSMGIAHLRYPTAGSSANSEAQPFYVNSPYGI   100
Symbols






********** *: **.***************.****************



SGD_Scer_ADE4/YMR300C   101   NLAHNGNLVNTASLKRYMDEDVHRHINTDSDSELLLNIFAAELEKHNKYR   150
MIT_Smik_c470_17554   101   NLAHNGNLVNTASLKRYMDEDVHRHINTDSDSELLLNIFAAELEKHNKYR   150
MIT_Spar_c419_17970   101   NLAHNGNLVNTASLKRYMDEDVHRHINTDSDSELLLNIFAAELEKHNKYR   150
MIT_Suva_c752_19381   101   NMAHNGNLVNTASLKRYMDEDVHRHINTDSDSELLLNIFAAELEKHNKYR   150
WashU_Sbay_Contig671.5   101   NMAHNGNLVNTASLKRYMDEDVHRHINTDSDSELLLNIFAAELEKHNKYR   150
WashU_Scas_Contig574.7   101   NLAHNGNLVNTVSLERYMDEDVHRHINTDSDSELLLNIFAAELEKHNKYR   150
WashU_Sklu_Contig1419.1   101   CLSHNGTLVNTLSLRSYLDEVVHRHINTDSDSELLLNVFAAELERHNKYR   150
WashU_Smik_Contig2426.2   101   NLAHNGNLVNTASLKRYMDEDVHRHINTDSDSELLLNIFAAELEKHNKYR   150
Symbols






::***.**** **. *:** ****************:******:*****



SGD_Scer_ADE4/YMR300C   151   VNNEDVFHALEGVYRLCRGGYACVGLLAGFALFGFRDPNGIRPLLFGERE   200
MIT_Smik_c470_17554   151   VNNEDVFHALEGVYRLCRGGYACVGLLAGFALFGFRDPNGIRPLLFGERE   200
MIT_Spar_c419_17970   151   VNNEDVFHALEGVYRLCRGGYACVGLLAGFALFGFRDPNGIRPLLFGERE   200
MIT_Suva_c752_19381   151   VNNEDVFHALEGVYRLCRGGYACVGLLAGFALFGFRDPNGIRPLLFGERQ   200
WashU_Sbay_Contig671.5   151   VNNEDVFHALEGVYRLCRGGYACVGLLAGFALFGFRDPNGIRPLLFGERQ   200
WashU_Scas_Contig574.7   151   VNNEDVFLALEGVYRLCRGGYACVGMLAGFALFGFRDPNGIRPLLFGERE   200
WashU_Sklu_Contig1419.1   151   VNNDDIFHALEGVYRQCRGGYACVGMLAGYSLFGFRDPNGIRPLLFGERV   200
WashU_Smik_Contig2426.2   151   VNNEDVFHALEGVYRLCRGGYACVGLLAGFALFGFRDPNGIRPLLFGERE   200
Symbols






***:*:* ******* *********:***::******************



SGD_Scer_ADE4/YMR300C   201   NPDGTKDYMLASESVVFKAHNFTKYRDLKPGEAVIIPKNCSKGEPEFKQV   250
MIT_Smik_c470_17554   201   NPDGTKDYMLASESVVFKAHNFTKYRDLKPGEAVIIPKNCSKGEPEFKQV   250
MIT_Spar_c419_17970   201   NPDGTKDYMLASESVVFKAHNFTKYRDLKPGEAVIIPKNCSKGEPEFKQV   250
MIT_Suva_c752_19381   201   NADGTKDYMLASESVVFKAHNFTKYRDLKPGEAVIIPKNCSKGEPEFKQV   250
WashU_Sbay_Contig671.5   201   NADGTKDYMLASESVVFKAHNFTKYRDLKPGEAVIIPKNCSKGEPEFKQV   250
WashU_Scas_Contig574.7   201   NADGTKDYMLASESVVLKAHNFTKFRDLKPGEAVIIPKDCGTTEPEFRQV   250
WashU_Sklu_Contig1419.1   201   NPDGTKDYMLASESVVLKAHNFNKFRDLKPGEAVIIPKDCNKQEPEFRQV   250
WashU_Smik_Contig2426.2   201   NPDGTKDYMLASESVVFKAHNFTKYRDLKPGEAVIIPKNCSKGKPEFKQV   250
Symbols






*.**************:*****.*:*************:*.. :***:**



SGD_Scer_ADE4/YMR300C   251   VPINSYRPDLFEYVYFARPDSVLDGISVYHTRLAMGSKLAENILKQLKPE   300
MIT_Smik_c470_17554   251   VPINSYRPDLFEYVYFARPDSVLDGISVYHTRLAMGSKLAENILKQLKPE   300
MIT_Spar_c419_17970   251   VPINSYRPDLFEYVYFARPDSVLDGISVYHTRLAMGSKLAENILKQLKPD   300
MIT_Suva_c752_19381   251   VPINSYRPDLFEYVYFARPDSVLDGISVYHTRLAMGSKLAENILKQLKSE   300
WashU_Sbay_Contig671.5   251   VPINSYRPDLFEYVYFARPDSVLDGISVYHTRLAMGSKLAENILKQLKSE   300
WashU_Scas_Contig574.7   251   VPMNSYRPDLFEYVYFARPDSVLDGISVYHTRLAMGVKLAENIKKHLNPD   300
WashU_Sklu_Contig1419.1   251   VPTNSYRPDLFEYVYFARPDSVLDGISVYHTRLQMGIKLAENVKKVVDPD   300
WashU_Smik_Contig2426.2   251   VPINSYRPDLFEYVYFARPDSVLDGISVYHTRLAMGSKLAENIX------   294
Symbols






** ****************************** ** *****:



SGD_Scer_ADE4/YMR300C   301   DIDVVIPVPDTARTCALECANVLGKPYREGFVKNRYVGRTFIMPNQRERV   350
MIT_Smik_c470_17554   301   DIDVVIPVPDTARTCALECANVLGKPYREGFVKNRYVGRTFIMPNQRERV   350
MIT_Spar_c419_17970   301   DIDVVIPVPDTARTCALECANVLGKPYREGFVKNRYVGRTFIMPNQRERV   350
MIT_Suva_c752_19381   301   DIDVVIPVPDTARTCALECANVLGKPYREGFVKNRYVGRTFIMPNQRERV   350
WashU_Sbay_Contig671.5   301   DIDVVIPVPDTARTCALECANVLGKPYREGFVKNRYVGRTFIMPNQRERV   350
WashU_Scas_Contig574.7   301   DIDVVIPVPDTARTCALQCANALGKTYREGFVKNRYVGRTFIMPNQKERI   350
WashU_Sklu_Contig1419.1   301   EIDVVVSVPDTARTCALQCANHLNKPYREAFVKNRYVGRTFIMPNQKERV   350
WashU_Smik_Contig2426.2   
   --------------------------------------------------   
Symbols










SGD_Scer_ADE4/YMR300C   351   SSVRRKLNPMESEFKGKKVLIVDDSIVRGTTSKEIVNMAKESGATKVYFA   400
MIT_Smik_c470_17554   351   SSVRRKLNPMESEFKGKKVLIVDDSIVRGTTSKEIVNMAKESGAIKVYFA   400
MIT_Spar_c419_17970   351   SSVRRKLNPMESEFRGKKVLIVDDSIVRGTTSKEIVNMAKESGATKVYFA   400
MIT_Suva_c752_19381   351   SSVRRKLNPMESEFKGKNVLIVDDSIVRGTTSREIVSMAKESGAAKVFFA   400
WashU_Sbay_Contig671.5   351   SSVRRKLNPMESEFKGKNVLIVDDSIVRGTTSREIVSMAKESGAAKVFFA   400
WashU_Scas_Contig574.7   351   SSVRRKLNPMESEFKDKNVLIVDDSIVRGTTSREIVQMARESGATKVYFA   400
WashU_Sklu_Contig1419.1   351   SSVRRKLNPMDFEFKDKRVLIVDDSIVRGTTSKEIINMAKESGATKVYFA   400
WashU_Smik_Contig2426.2   
   --------------------------------------------------   
Symbols










SGD_Scer_ADE4/YMR300C   401   SAAPAIRYNHIYGIDLTDTKNLIAYNRTDEEVAEVIGCERVIYQSLEDLI   450
MIT_Smik_c470_17554   401   SAAPAIRYNHIYGIDLTDTKNLIAYNRTDEEVAEVIGCERVIYQSLEDLI   450
MIT_Spar_c419_17970   401   SAAPAIRYNHIYGIDLTDTKNLIAYNRTDEEVAEVIGCERVIYQSLEDLI   450
MIT_Suva_c752_19381   401   SAAPAIRYNHIYGIDLTDTKNLIAYNRTDVEVAEVIGCEKVIYQSLEDLI   450
WashU_Sbay_Contig671.5   401   SAAPAIRYNHIYGIDLTDTKNLIAYNRTDVEVAEVIGCEKVIYQSLEDLI   450
WashU_Scas_Contig574.7   401   SAAPPIRYNHIYGIDLTDTKNLIAYNRSEEEIAEAIGCDQVIYQTLEDLI   450
WashU_Sklu_Contig1419.1   401   SAAPAIRFNHIYGIDLADTKQLVAYNRTTDEVAQELGCEKVIYQSLEDLV   450
WashU_Smik_Contig2426.2   
   --------------------------------------------------   
Symbols










SGD_Scer_ADE4/YMR300C   451   DCCKTDKITKFEDGVFTGNYVTGVEDGYIQELEEKRE-SIANNSSDMKAE   499
MIT_Smik_c470_17554   451   DCCKTDKITKFEDGVFTGSYVTGVEDGYIQELEEKRE-SIANNSSDMKAE   499
MIT_Spar_c419_17970   451   DCCKTDKITKFEDGVFTGNYVTGVEDGYIQELEEKRE-SIANNSSDMKAE   499
MIT_Suva_c752_19381   451   DCCKTSEISKFEDGVFTGSYVTGVEDGYIQELEEKRE-SIANNSSDMKAE   499
WashU_Sbay_Contig671.5   451   DCCKTSEISKFEDGVFTGSYVTGVEDGYIQELEEKRE-SIANNSSDMKAE   499
WashU_Scas_Contig574.7   451   DCCKTKNVDKFEIGVFTGNYVTGVEDGYLQELEKVRERNRSRGLIDIKAE   500
WashU_Sklu_Contig1419.1   451   DCCKTDKIDKFEVGVFTGNYVTGVEDGYLQELERVRALNKAK-LTTAKAE   499
WashU_Smik_Contig2426.2   
   --------------------------------------------------   
Symbols










SGD_Scer_ADE4/YMR300C   500   VDIGLYNCADY   510
MIT_Smik_c470_17554   500   VDIGLYNCADY   510
MIT_Spar_c419_17970   500   VDIGLYNCADY   510
MIT_Suva_c752_19381   500   VDIGLYNCADY   510
WashU_Sbay_Contig671.5   500   VDIGLYNCADY   510
WashU_Scas_Contig574.7   501   VDIGLYNCADY   511
WashU_Sklu_Contig1419.1   500   VDIGLYNSADY   510
WashU_Smik_Contig2426.2   
   -----------   
Symbols










Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_ADE4/YMR300C:

SGD_Scer_ADE4/YMR300C  Length: 511  Mon Nov  7 16:22:12 2016  Type: P  Check: 856  ..

       1  MCGILGIVLA NQTTPVAPEL CDGCIFLQHR GQDAAGIATC GSRGRIYQCK

      51  GNGMARDVFT QQRVSGLAGS MGIAHLRYPT AGSSANSEAQ PFYVNSPYGI

     101  NLAHNGNLVN TASLKRYMDE DVHRHINTDS DSELLLNIFA AELEKHNKYR

     151  VNNEDVFHAL EGVYRLCRGG YACVGLLAGF ALFGFRDPNG IRPLLFGERE

     201  NPDGTKDYML ASESVVFKAH NFTKYRDLKP GEAVIIPKNC SKGEPEFKQV

     251  VPINSYRPDL FEYVYFARPD SVLDGISVYH TRLAMGSKLA ENILKQLKPE

     301  DIDVVIPVPD TARTCALECA NVLGKPYREG FVKNRYVGRT FIMPNQRERV

     351  SSVRRKLNPM ESEFKGKKVL IVDDSIVRGT TSKEIVNMAK ESGATKVYFA

     401  SAAPAIRYNH IYGIDLTDTK NLIAYNRTDE EVAEVIGCER VIYQSLEDLI

     451  DCCKTDKITK FEDGVFTGNY VTGVEDGYIQ ELEEKRESIA NNSSDMKAEV

     501  DIGLYNCADY *

Protein Sequence for MIT_Smik_c470_17554:

MIT_Smik_c470_17554  Length: 511  Mon Nov  7 16:22:12 2016  Type: P  Check: 338  ..

       1  MCGILGIVLA NQTTPVAPEL CDGCIFLQHR GQDAAGIATC GSRGRIYQCK

      51  GNGMARDVFT QQRVSGLAGS MGIAHLRYPT AGSSANSEAQ PFYVNSPYGI

     101  NLAHNGNLVN TASLKRYMDE DVHRHINTDS DSELLLNIFA AELEKHNKYR

     151  VNNEDVFHAL EGVYRLCRGG YACVGLLAGF ALFGFRDPNG IRPLLFGERE

     201  NPDGTKDYML ASESVVFKAH NFTKYRDLKP GEAVIIPKNC SKGEPEFKQV

     251  VPINSYRPDL FEYVYFARPD SVLDGISVYH TRLAMGSKLA ENILKQLKPE

     301  DIDVVIPVPD TARTCALECA NVLGKPYREG FVKNRYVGRT FIMPNQRERV

     351  SSVRRKLNPM ESEFKGKKVL IVDDSIVRGT TSKEIVNMAK ESGAIKVYFA

     401  SAAPAIRYNH IYGIDLTDTK NLIAYNRTDE EVAEVIGCER VIYQSLEDLI

     451  DCCKTDKITK FEDGVFTGSY VTGVEDGYIQ ELEEKRESIA NNSSDMKAEV

     501  DIGLYNCADY *

Protein Sequence for MIT_Spar_c419_17970:

MIT_Spar_c419_17970  Length: 511  Mon Nov  7 16:22:12 2016  Type: P  Check: 1002  ..

       1  MCGILGIVLA NQTTPVAPEL CDGCIFLQHR GQDAAGIATC GSRGRIYQCK

      51  GNGMARDVFT QQRVSGLAGS MGIAHLRYPT AGSSANSEAQ PFYVNSPYGI

     101  NLAHNGNLVN TASLKRYMDE DVHRHINTDS DSELLLNIFA AELEKHNKYR

     151  VNNEDVFHAL EGVYRLCRGG YACVGLLAGF ALFGFRDPNG IRPLLFGERE

     201  NPDGTKDYML ASESVVFKAH NFTKYRDLKP GEAVIIPKNC SKGEPEFKQV

     251  VPINSYRPDL FEYVYFARPD SVLDGISVYH TRLAMGSKLA ENILKQLKPD

     301  DIDVVIPVPD TARTCALECA NVLGKPYREG FVKNRYVGRT FIMPNQRERV

     351  SSVRRKLNPM ESEFRGKKVL IVDDSIVRGT TSKEIVNMAK ESGATKVYFA

     401  SAAPAIRYNH IYGIDLTDTK NLIAYNRTDE EVAEVIGCER VIYQSLEDLI

     451  DCCKTDKITK FEDGVFTGNY VTGVEDGYIQ ELEEKRESIA NNSSDMKAEV

     501  DIGLYNCADY *

Protein Sequence for MIT_Suva_c752_19381:

MIT_Suva_c752_19381  Length: 511  Mon Nov  7 16:22:12 2016  Type: P  Check: 10  ..

       1  MCGILGIVLA NQSTPVAPEL CDGCIFLQHR GQDAAGIATC GSGGRIYQCK

      51  GNGMARDVFT QQRVSGLAGS MGIAHLRYPT AGSSANSEAQ PFYVNSPYGI

     101  NMAHNGNLVN TASLKRYMDE DVHRHINTDS DSELLLNIFA AELEKHNKYR

     151  VNNEDVFHAL EGVYRLCRGG YACVGLLAGF ALFGFRDPNG IRPLLFGERQ

     201  NADGTKDYML ASESVVFKAH NFTKYRDLKP GEAVIIPKNC SKGEPEFKQV

     251  VPINSYRPDL FEYVYFARPD SVLDGISVYH TRLAMGSKLA ENILKQLKSE

     301  DIDVVIPVPD TARTCALECA NVLGKPYREG FVKNRYVGRT FIMPNQRERV

     351  SSVRRKLNPM ESEFKGKNVL IVDDSIVRGT TSREIVSMAK ESGAAKVFFA

     401  SAAPAIRYNH IYGIDLTDTK NLIAYNRTDV EVAEVIGCEK VIYQSLEDLI

     451  DCCKTSEISK FEDGVFTGSY VTGVEDGYIQ ELEEKRESIA NNSSDMKAEV

     501  DIGLYNCADY *

Protein Sequence for WashU_Sbay_Contig671.5:

WashU_Sbay_Contig671.5  Length: 511  Mon Nov  7 16:22:12 2016  Type: P  Check: 10  ..

       1  MCGILGIVLA NQSTPVAPEL CDGCIFLQHR GQDAAGIATC GSGGRIYQCK

      51  GNGMARDVFT QQRVSGLAGS MGIAHLRYPT AGSSANSEAQ PFYVNSPYGI

     101  NMAHNGNLVN TASLKRYMDE DVHRHINTDS DSELLLNIFA AELEKHNKYR

     151  VNNEDVFHAL EGVYRLCRGG YACVGLLAGF ALFGFRDPNG IRPLLFGERQ

     201  NADGTKDYML ASESVVFKAH NFTKYRDLKP GEAVIIPKNC SKGEPEFKQV

     251  VPINSYRPDL FEYVYFARPD SVLDGISVYH TRLAMGSKLA ENILKQLKSE

     301  DIDVVIPVPD TARTCALECA NVLGKPYREG FVKNRYVGRT FIMPNQRERV

     351  SSVRRKLNPM ESEFKGKNVL IVDDSIVRGT TSREIVSMAK ESGAAKVFFA

     401  SAAPAIRYNH IYGIDLTDTK NLIAYNRTDV EVAEVIGCEK VIYQSLEDLI

     451  DCCKTSEISK FEDGVFTGSY VTGVEDGYIQ ELEEKRESIA NNSSDMKAEV

     501  DIGLYNCADY *

Protein Sequence for WashU_Scas_Contig574.7:

WashU_Scas_Contig574.7  Length: 512  Mon Nov  7 16:22:12 2016  Type: P  Check: 5361  ..

       1  MCGILGIALA DQSSKVAPEL CDGCIFLQHR GQDAAGIATC GSRGRIYQCK

      51  GNGMARDVFT APRVHGLVGS MGIAHLRYPT AGSSANSEAQ PFYVNSPYGI

     101  NLAHNGNLVN TVSLERYMDE DVHRHINTDS DSELLLNIFA AELEKHNKYR

     151  VNNEDVFLAL EGVYRLCRGG YACVGMLAGF ALFGFRDPNG IRPLLFGERE

     201  NADGTKDYML ASESVVLKAH NFTKFRDLKP GEAVIIPKDC GTTEPEFRQV

     251  VPMNSYRPDL FEYVYFARPD SVLDGISVYH TRLAMGVKLA ENIKKHLNPD

     301  DIDVVIPVPD TARTCALQCA NALGKTYREG FVKNRYVGRT FIMPNQKERI

     351  SSVRRKLNPM ESEFKDKNVL IVDDSIVRGT TSREIVQMAR ESGATKVYFA

     401  SAAPPIRYNH IYGIDLTDTK NLIAYNRSEE EIAEAIGCDQ VIYQTLEDLI

     451  DCCKTKNVDK FEIGVFTGNY VTGVEDGYLQ ELEKVRERNR SRGLIDIKAE

     501  VDIGLYNCAD Y*

Protein Sequence for WashU_Sklu_Contig1419.1:

WashU_Sklu_Contig1419.1  Length: 511  Mon Nov  7 16:22:12 2016  Type: P  Check: 4764  ..

       1  MCGILGIALS DQSSVVAPEL FDGSLFLQHR GQDAAGMATC GERGRLYQCK

      51  GNGMARDVFT QHRMSGLVGS MGIAHLRYPT AGSCANSEAQ PFYVNSPYGI

     101  CLSHNGTLVN TLSLRSYLDE VVHRHINTDS DSELLLNVFA AELERHNKYR

     151  VNNDDIFHAL EGVYRQCRGG YACVGMLAGY SLFGFRDPNG IRPLLFGERV

     201  NPDGTKDYML ASESVVLKAH NFNKFRDLKP GEAVIIPKDC NKQEPEFRQV

     251  VPTNSYRPDL FEYVYFARPD SVLDGISVYH TRLQMGIKLA ENVKKVVDPD

     301  EIDVVVSVPD TARTCALQCA NHLNKPYREA FVKNRYVGRT FIMPNQKERV

     351  SSVRRKLNPM DFEFKDKRVL IVDDSIVRGT TSKEIINMAK ESGATKVYFA

     401  SAAPAIRFNH IYGIDLADTK QLVAYNRTTD EVAQELGCEK VIYQSLEDLV

     451  DCCKTDKIDK FEVGVFTGNY VTGVEDGYLQ ELERVRALNK AKLTTAKAEV

     501  DIGLYNSADY *

Protein Sequence for WashU_Smik_Contig2426.2:

WashU_Smik_Contig2426.2  Length: 294  Mon Nov  7 16:22:12 2016  Type: P  Check: 2361  ..

       1  MCGILGIVLA NQTTPVAPEL CDGCIFLQHR GQDAAGIATC GSRGRIYQCK

      51  GNGMARDVFT QQRVSGLAGS MGIAHLRYPT AGSSANSEAQ PFYVNSPYGI

     101  NLAHNGNLVN TASLKRYMDE DVHRHINTDS DSELLLNIFA AELEKHNKYR

     151  VNNEDVFHAL EGVYRLCRGG YACVGLLAGF ALFGFRDPNG IRPLLFGERE

     201  NPDGTKDYML ASESVVFKAH NFTKYRDLKP GEAVIIPKNC SKGKPEFKQV

     251  VPINSYRPDL FEYVYFARPD SVLDGISVYH TRLAMGSKLA ENIX