Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YMR227C and Homologs


Choose two or more sequences for alignment:
Pick a sequence type:
Best Hits & Orthologs"Other" Hits

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_TAF7/YMR227C   1   -------------------------MAVIRIKKPRGPGEKDQPLEGEPKL   25
MIT_Smik_c457_17272   1   -------------------------MAVIRIKKPREPKGEDQPLESEPKL   25
MIT_Suva_c941_19162   
   --------------------------------------------------   
WashU_Scas_Contig594.6   1   MEGNKVHPSRQPDIITAKVIYWLVMVTIKLKRPNPPKETAEDSTNKEPKL   50
WashU_Smik_Contig2845.4   1   -------------------------MAVIRIKKPREPKGEDQPLESEPKL   25
Symbols










SGD_Scer_TAF7/YMR227C   26   KRIRIKTKVTD-EDIKPKPKLKINLKKKKESADGKEKKNSLKLKLNLKKN   74
MIT_Smik_c457_17272   26   KRIRIKTKVND-DDVKSKPKLKISLNKKKDNSDNKEKKNSLKLKLNLKKN   74
MIT_Suva_c941_19162   
   --------------------------------------------------   
WashU_Scas_Contig594.6   51   KKIRIKTKNKDNEQIPKKPKLKISLKKRKVTDPLMDKPVGGPLKLKLHRK   100
WashU_Smik_Contig2845.4   26   KRIRIKAKVND-DDVKSKPKLKISLNKKKDNSDNKEKKNSLKLKLNLKKN   74
Symbols










SGD_Scer_TAF7/YMR227C   75   EEP----VKKIHKAPKLRLKPIRIPGEAYDSEASDIEDDPLIESGVILRI   120
MIT_Smik_c457_17272   75   EES----LKKIHRTPKLRLKPIRIPGEAYDSEASDIEDDPLIETGVILRI   120
MIT_Suva_c941_19162   
   --------------------------------------------------   
WashU_Scas_Contig594.6   101   PSASPIVEKKVHKAPRLRLKPIRIPGEGYDSEASDIEDDPLIESGIILRV   150
WashU_Smik_Contig2845.4   75   EES----LKKIHRTPKLRLKPIRIPGEAYDSEASDIEDDPLIETGVILRI   120
Symbols










SGD_Scer_TAF7/YMR227C   121   LPDIQLEFVKNSLESGDYSGISIKWKNERHAVVTINDVMYGAILVDLPTV   170
MIT_Smik_c457_17272   121   LPDIQLEFVKNSLESGDYSGISIKWKNERHAVVTINDVMYGAILVDLPTV   170
MIT_Suva_c941_19162   
   --------------------------------------------------   
WashU_Scas_Contig594.6   151   LPDIQVEFVKNSIESGDYSGLTVKWLGHRHAVVNINGNMYGAILVDLPTV   200
WashU_Smik_Contig2845.4   121   LPDIQLEFVKNSLESGDYSGISIKWKNERHAVVTINDVMYGAILVDLPTV   170
Symbols










SGD_Scer_TAF7/YMR227C   171   IEVNKSVDRKNLLKTFDVSQMLLCIRPIQEEEEVYALEAPDTEDLVVKHF   220
MIT_Smik_c457_17272   171   IEVNKSVDRKNLLKTFDVSQMLLCIRSIQQEEEVYDLEAPDTEDLVVKHF   220
MIT_Suva_c941_19162   
   --------------------------------------------------   
WashU_Scas_Contig594.6   201   IEVNKSVDRKNLLKTFDVSQMLICIKTIQKEDEVFTLKAPNSEDLVTKHY   250
WashU_Smik_Contig2845.4   171   IEVNKSVDRKNLLKTFDVSQMLLCIRSIQQEEEVYDLEAPDTEDLVVKHF   220
Symbols










SGD_Scer_TAF7/YMR227C   221   EGIEDEIWENKETFLKGYNGAPLSDMEAKHLKEIALKGYDYKHGISPPLY   270
MIT_Smik_c457_17272   221   EDIEDEIWENKETFLKGYNGAPLSDAEAKHMKEIALKGYDYKHGISPPLY   270
MIT_Suva_c941_19162   1   -------------------------------------------MGITTSN   7
WashU_Scas_Contig594.6   251   SDIEEEILGNKKVLMKEQNTDLLSELEKQYLDEIATKGYDYKHGLSPPLY   300
WashU_Smik_Contig2845.4   221   EDIEDEIWENKETFLKGYNGAPLSDAEAKHMKEIALKGYDYKHGISPPLY   270
Symbols






..



SGD_Scer_TAF7/YMR227C   271   NVRNRRFRRKMDPNEIDYVEKVVDMLLKQDKQAEEVSYDLVDKSELQARQ   320
MIT_Smik_c457_17272   271   NVRNRRFRRKMDPNEIDYVEKVVDMLLKQDKQAEEVSYDLVDRSELQTKQ   320
MIT_Suva_c941_19162   8   NVRNRRFRRKMGPNEIDYVEKVIDMLLKQDKQAEEVSYDLVDESELQTKQ   57
WashU_Scas_Contig594.6   301   NVRNRRFRRKMGPSEFEYAEEVVETLLRQDEKAENVTYELVDESEMLGRS   350
WashU_Smik_Contig2845.4   271   NVRNRRFRRKMDPNEIDYVEKVVDMLLKQDKQAEEVSYDLVDRSELQTKQ   320
Symbols






***********.*.*::*.*:*:: **:**::**:*:*:***.**: :.



SGD_Scer_TAF7/YMR227C   321   E--RVSSWENFKEEPGEPLSRPALKKEEIHTIASAVGKQGAEEEGEEGME   368
MIT_Smik_c457_17272   321   E--RVSSWENFKEEPGELSLGYVSKKEETHTIISAAAKQ-----KEEDAE   363
MIT_Suva_c941_19162   58   E--RVSSWENFKEEPGEPSAGPQKKEERPTVPPATAGQQ-----EEGEEE   100
WashU_Scas_Contig594.6   351   NSTPIISEDYFKDADVQEPSAAIESTVPILPIDENIRKEAKIQTNVNLED   400
WashU_Smik_Contig2845.4   321   E--RVSSWENFKEEPGELSLGYVSKKEETHTIISAAAKQ-----KEEDAE   363
Symbols






: : * : **: : . :: :



SGD_Scer_TAF7/YMR227C   369   EEEEEDLDLGAAFESEEE-----GSGAEGDKEQQQEEVGDEVDQDTGGED   413
MIT_Smik_c457_17272   364   EEEELDLGAAFESEEERE-----RSNADGDKDQLQEEVGDEVDQDTEGED   408
MIT_Suva_c941_19162   101   EEEDLDLGAAFESEEEEEEEEE-GNAADGNKRQQQEEVGDEVDQDTEGED   149
WashU_Scas_Contig594.6   401   EDEDLDLAAVFGSDSDKEEFNNNTDLTSGQTPTVDNQRFETVEQESGSEG   450
WashU_Smik_Contig2845.4   364   EEEELDLGAAFESEEERE-----RSNADGDKDQLQEEVGDEVDQDTEGED   408
Symbols






*:*: ** :.:.* . :.*:. ::: : *:*:: .*.



SGD_Scer_TAF7/YMR227C   414   DDDD------DDGDIEAAGGESESDDEKD------ENRQHTELLADELNE   451
MIT_Smik_c457_17272   409   EEED------DEGDNEAAGGESESEDEKD------ENRQHTELLADELNE   446
MIT_Suva_c941_19162   150   DEEEEDEEEEDEGDNEVAGGESESEEEKD------ENRQHTELLVDELNE   193
WashU_Scas_Contig594.6   451   NEEEEEEEEDDDEEDEEEEDDEEEEEGETGELVAKEDRQHVELLADELSE   500
WashU_Smik_Contig2845.4   409   EEED------DEGDNEAAGGESESEDEKD------ENRQHTELLADELNE   446
Symbols






:::: *: : * .:.*.:: : *:***.***.***.*



SGD_Scer_TAF7/YMR227C   452   LETTLAHTKHKLSKATNPLLKSRFIDSIKKLEKEAELKRKQLQQTEDSVQ   501
MIT_Smik_c457_17272   447   LETTLTHTKYKLSKATNPLLKSRFVDSIKKLEKEAELKRKQLQQTEDSVQ   496
MIT_Suva_c941_19162   194   LETTLAHTRHKLGKATNPLLKSRFIDSIKKLEKEAEMKRKQLQLTEESSQ   243
WashU_Scas_Contig594.6   501   LETTLTHTRNKLQKVTNPLLRSRFIDNIKKLEKEVELKRRQFKIREDQLN   550
WashU_Smik_Contig2845.4   447   LETTLTHTKYKLSKATNPLLKSRFVDSIKKLEKEAELKRKQLQQTEDSVQ   496
Symbols






*****:**: ** *.*****:***:*.*******.*:**:*:: *:. :



SGD_Scer_TAF7/YMR227C   502   KQHQHRS-DAETANNVEEEEEEEEEEEEEDEVDEDEEDDEENDEDED---   547
MIT_Smik_c457_17272   497   KQHKHRS-DTETANNEDEEEEEEDEEEEEEEEEEEEEEEEEQEEEEEEVE   545
MIT_Suva_c941_19162   244   KQHQQPS-DTEVPHNEEEDEEEDEEEEEEDEAEEEEDEEDENENEEED--   290
WashU_Scas_Contig594.6   551   NVNPHDSNDLHKSPSTKTSALDMDDEEEEEDDMEDEEEEDDEDEEEEEEE   600
WashU_Smik_Contig2845.4   497   KQHKHRS-DTETANNEDEEEEEEDEEEEEEEEEEEEEEEEEQEEEEEEVE   545
Symbols






: : : * * . . . . . : ::****:: *:*:::::::::*:



SGD_Scer_TAF7/YMR227C   548   ----------NVHEREHIQENKVVRELDEAPAEETLDQ--NDLDMMMLFG   585
MIT_Smik_c457_17272   546   EVEEIEENGENEDEGEHTQENKVVREADDAPAEEALDQ--NDLDMMMLFG   593
MIT_Suva_c941_19162   291   ----------ENDEGEHAQEGKITGDVGEAPAEETHELDQNDLDMMMLFG   330
WashU_Scas_Contig594.6   601   EEERNIEADEIVPEQSNSNTEAISMTNTDGITNLQENLDQNDLDMMMLFG   650
WashU_Smik_Contig2845.4   546   EVEEIEENGENEDEGEHTQENKVVREADDAPAEEALDQ--NDLDMMMLFG   593
Symbols






* .: : : :. :: : **********



SGD_Scer_TAF7/YMR227C   586   AEGDE   590
MIT_Smik_c457_17272   594   AEGDE   598
MIT_Suva_c941_19162   331   AEGDE   335
WashU_Scas_Contig594.6   651   AEGDE   655
WashU_Smik_Contig2845.4   594   AEGDE   598
Symbols






*****



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_TAF7/YMR227C:

SGD_Scer_TAF7/YMR227C  Length: 591  Mon Nov  7 16:20:25 2016  Type: P  Check: 2485  ..

       1  MAVIRIKKPR GPGEKDQPLE GEPKLKRIRI KTKVTDEDIK PKPKLKINLK

      51  KKKESADGKE KKNSLKLKLN LKKNEEPVKK IHKAPKLRLK PIRIPGEAYD

     101  SEASDIEDDP LIESGVILRI LPDIQLEFVK NSLESGDYSG ISIKWKNERH

     151  AVVTINDVMY GAILVDLPTV IEVNKSVDRK NLLKTFDVSQ MLLCIRPIQE

     201  EEEVYALEAP DTEDLVVKHF EGIEDEIWEN KETFLKGYNG APLSDMEAKH

     251  LKEIALKGYD YKHGISPPLY NVRNRRFRRK MDPNEIDYVE KVVDMLLKQD

     301  KQAEEVSYDL VDKSELQARQ ERVSSWENFK EEPGEPLSRP ALKKEEIHTI

     351  ASAVGKQGAE EEGEEGMEEE EEEDLDLGAA FESEEEGSGA EGDKEQQQEE

     401  VGDEVDQDTG GEDDDDDDDG DIEAAGGESE SDDEKDENRQ HTELLADELN

     451  ELETTLAHTK HKLSKATNPL LKSRFIDSIK KLEKEAELKR KQLQQTEDSV

     501  QKQHQHRSDA ETANNVEEEE EEEEEEEEED EVDEDEEDDE ENDEDEDNVH

     551  EREHIQENKV VRELDEAPAE ETLDQNDLDM MMLFGAEGDE *


Protein Sequence for MIT_Smik_c457_17272:

MIT_Smik_c457_17272  Length: 599  Mon Nov  7 16:20:25 2016  Type: P  Check: 5553  ..

       1  MAVIRIKKPR EPKGEDQPLE SEPKLKRIRI KTKVNDDDVK SKPKLKISLN

      51  KKKDNSDNKE KKNSLKLKLN LKKNEESLKK IHRTPKLRLK PIRIPGEAYD

     101  SEASDIEDDP LIETGVILRI LPDIQLEFVK NSLESGDYSG ISIKWKNERH

     151  AVVTINDVMY GAILVDLPTV IEVNKSVDRK NLLKTFDVSQ MLLCIRSIQQ

     201  EEEVYDLEAP DTEDLVVKHF EDIEDEIWEN KETFLKGYNG APLSDAEAKH

     251  MKEIALKGYD YKHGISPPLY NVRNRRFRRK MDPNEIDYVE KVVDMLLKQD

     301  KQAEEVSYDL VDRSELQTKQ ERVSSWENFK EEPGELSLGY VSKKEETHTI

     351  ISAAAKQKEE DAEEEEELDL GAAFESEEER ERSNADGDKD QLQEEVGDEV

     401  DQDTEGEDEE EDDEGDNEAA GGESESEDEK DENRQHTELL ADELNELETT

     451  LTHTKYKLSK ATNPLLKSRF VDSIKKLEKE AELKRKQLQQ TEDSVQKQHK

     501  HRSDTETANN EDEEEEEEDE EEEEEEEEEE EEEEEEQEEE EEEVEEVEEI

     551  EENGENEDEG EHTQENKVVR EADDAPAEEA LDQNDLDMMM LFGAEGDE*


Protein Sequence for MIT_Suva_c941_19162:

MIT_Suva_c941_19162  Length: 336  Mon Nov  7 16:20:25 2016  Type: P  Check: 2124  ..

       1  MGITTSNNVR NRRFRRKMGP NEIDYVEKVI DMLLKQDKQA EEVSYDLVDE

      51  SELQTKQERV SSWENFKEEP GEPSAGPQKK EERPTVPPAT AGQQEEGEEE

     101  EEEDLDLGAA FESEEEEEEE EEGNAADGNK RQQQEEVGDE VDQDTEGEDD

     151  EEEEDEEEED EGDNEVAGGE SESEEEKDEN RQHTELLVDE LNELETTLAH

     201  TRHKLGKATN PLLKSRFIDS IKKLEKEAEM KRKQLQLTEE SSQKQHQQPS

     251  DTEVPHNEEE DEEEDEEEEE EDEAEEEEDE EDENENEEED ENDEGEHAQE

     301  GKITGDVGEA PAEETHELDQ NDLDMMMLFG AEGDE*

Protein Sequence for WashU_Scas_Contig594.6:

WashU_Scas_Contig594.6  Length: 656  Mon Nov  7 16:20:25 2016  Type: P  Check: 797  ..

       1  MEGNKVHPSR QPDIITAKVI YWLVMVTIKL KRPNPPKETA EDSTNKEPKL

      51  KKIRIKTKNK DNEQIPKKPK LKISLKKRKV TDPLMDKPVG GPLKLKLHRK

     101  PSASPIVEKK VHKAPRLRLK PIRIPGEGYD SEASDIEDDP LIESGIILRV

     151  LPDIQVEFVK NSIESGDYSG LTVKWLGHRH AVVNINGNMY GAILVDLPTV

     201  IEVNKSVDRK NLLKTFDVSQ MLICIKTIQK EDEVFTLKAP NSEDLVTKHY

     251  SDIEEEILGN KKVLMKEQNT DLLSELEKQY LDEIATKGYD YKHGLSPPLY

     301  NVRNRRFRRK MGPSEFEYAE EVVETLLRQD EKAENVTYEL VDESEMLGRS

     351  NSTPIISEDY FKDADVQEPS AAIESTVPIL PIDENIRKEA KIQTNVNLED

     401  EDEDLDLAAV FGSDSDKEEF NNNTDLTSGQ TPTVDNQRFE TVEQESGSEG

     451  NEEEEEEEED DDEEDEEEED DEEEEEGETG ELVAKEDRQH VELLADELSE

     501  LETTLTHTRN KLQKVTNPLL RSRFIDNIKK LEKEVELKRR QFKIREDQLN

     551  NVNPHDSNDL HKSPSTKTSA LDMDDEEEEE DDMEDEEEED DEDEEEEEEE

     601  EEERNIEADE IVPEQSNSNT EAISMTNTDG ITNLQENLDQ NDLDMMMLFG

     651  AEGDE*

Protein Sequence for WashU_Smik_Contig2845.4:

WashU_Smik_Contig2845.4  Length: 599  Mon Nov  7 16:20:25 2016  Type: P  Check: 4945  ..

       1  MAVIRIKKPR EPKGEDQPLE SEPKLKRIRI KAKVNDDDVK SKPKLKISLN

      51  KKKDNSDNKE KKNSLKLKLN LKKNEESLKK IHRTPKLRLK PIRIPGEAYD

     101  SEASDIEDDP LIETGVILRI LPDIQLEFVK NSLESGDYSG ISIKWKNERH

     151  AVVTINDVMY GAILVDLPTV IEVNKSVDRK NLLKTFDVSQ MLLCIRSIQQ

     201  EEEVYDLEAP DTEDLVVKHF EDIEDEIWEN KETFLKGYNG APLSDAEAKH

     251  MKEIALKGYD YKHGISPPLY NVRNRRFRRK MDPNEIDYVE KVVDMLLKQD

     301  KQAEEVSYDL VDRSELQTKQ ERVSSWENFK EEPGELSLGY VSKKEETHTI

     351  ISAAAKQKEE DAEEEEELDL GAAFESEEER ERSNADGDKD QLQEEVGDEV

     401  DQDTEGEDEE EDDEGDNEAA GGESESEDEK DENRQHTELL ADELNELETT

     451  LTHTKYKLSK ATNPLLKSRF VDSIKKLEKE AELKRKQLQQ TEDSVQKQHK

     501  HRSDTETANN EDEEEEEEDE EEEEEEEEEE EEEEEEQEEE EEEVEEVEEI

     551  EENGENEDEG EHTQENKVVR EADDAPAEEA LDQNDLDMMM LFGAEGDE*