Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YMR194W and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_RPL36A/YMR194W   1   ---------------------------------MTVKTGIAIGLNKGKKV   17
MIT_Smik_c450_17130   
   --------------------------------------------------   
MIT_Spar_c161_16564   1   MMASKDRTSYPTSRRYIYAYICLFDTLLTEDNICFFYLGIAIGLNKGKKV   50
MIT_Suva_c938_19024   
   --------------------------------------------------   
WashU_Sbay_Contig651.34   
   --------------------------------------------------   
WashU_Scas_Contig720.61   
   --------------------------------------------------   
WashU_Skud_Contig1752.3   
   --------------------------------------------------   
Symbols










SGD_Scer_RPL36A/YMR194W   18   TSMTPAPKISYKKGAASNRTKFVRSLVREIAGLSPYERRLIDLIRNSGEK   67
MIT_Smik_c450_17130   1   --MTPAPKISYKKGAASNRTKFVRSLVREIAGLSPYERRLIDLIRNSGEK   48
MIT_Spar_c161_16564   51   TSMTPAPKISYKKGAASNRTKFVRSLVREIAGLSPYERRLIDLIRNSGEK   100
MIT_Suva_c938_19024   1   --MTPAPKISYKKGVASNRTKFVRSLVREIAGLSPYERRLIDLIRNSGEK   48
WashU_Sbay_Contig651.34   1   --MTPAPKISYKKGVASNRTKFVRSLVREIAGLSPYERRLIDLIRNSGEK   48
WashU_Scas_Contig720.61   1   --MTPAPKISYKKGVSSNRTKFVRSLVKEIAGLAPYERRLIDLVRNSGEK   48
WashU_Skud_Contig1752.3   1   --MTPAPKISYKKGAASNRTKFVRSLVREIAGLSPYERRLIDLIRNSGEK   48
Symbols






************.:***********:*****:*********:******



SGD_Scer_RPL36A/YMR194W   68   RARKVAKKRLGSFTRAKAKVEEMNNIIAASRRH   100
MIT_Smik_c450_17130   49   RARKVAKKRLGSFIRAKAKVEEMNNIIAASRRH   81
MIT_Spar_c161_16564   101   RARKVAKKRLGSFTRAKAKVEEMNNIIAASRRH   133
MIT_Suva_c938_19024   49   RARKVAKKRLGSFIRAKAKVEEMNNIIAASRRH   81
WashU_Sbay_Contig651.34   49   RARKVAKKRLGSFIRAKAKVEEMNNIIAASRRH   81
WashU_Scas_Contig720.61   49   RARKVAKKRLGSFKRAKAKVEEMNNVIAASRRH   81
WashU_Skud_Contig1752.3   49   RARKVAKKRLGSFIRAKAKVEEMNNIIVASRRH   81
Symbols






************* ***********:*.*****



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_RPL36A/YMR194W:

SGD_Scer_RPL36A/YMR194W  Length: 101  Mon Nov  7 16:19:33 2016  Type: P  Check: 911  ..

       1  MTVKTGIAIG LNKGKKVTSM TPAPKISYKK GAASNRTKFV RSLVREIAGL

      51  SPYERRLIDL IRNSGEKRAR KVAKKRLGSF TRAKAKVEEM NNIIAASRRH

     101  *

Protein Sequence for MIT_Smik_c450_17130:

MIT_Smik_c450_17130  Length: 82  Mon Nov  7 16:19:33 2016  Type: P  Check: 9921  ..

       1  MTPAPKISYK KGAASNRTKF VRSLVREIAG LSPYERRLID LIRNSGEKRA

      51  RKVAKKRLGS FIRAKAKVEE MNNIIAASRR H*

Protein Sequence for MIT_Spar_c161_16564:

MIT_Spar_c161_16564  Length: 134  Mon Nov  7 16:19:33 2016  Type: P  Check: 7583  ..

       1  MMASKDRTSY PTSRRYIYAY ICLFDTLLTE DNICFFYLGI AIGLNKGKKV

      51  TSMTPAPKIS YKKGAASNRT KFVRSLVREI AGLSPYERRL IDLIRNSGEK

     101  RARKVAKKRL GSFTRAKAKV EEMNNIIAAS RRH*

Protein Sequence for MIT_Suva_c938_19024:

MIT_Suva_c938_19024  Length: 82  Mon Nov  7 16:19:33 2016  Type: P  Check: 194  ..

       1  MTPAPKISYK KGVASNRTKF VRSLVREIAG LSPYERRLID LIRNSGEKRA

      51  RKVAKKRLGS FIRAKAKVEE MNNIIAASRR H*

Protein Sequence for WashU_Sbay_Contig651.34:

WashU_Sbay_Contig651.34  Length: 82  Mon Nov  7 16:19:33 2016  Type: P  Check: 194  ..

       1  MTPAPKISYK KGVASNRTKF VRSLVREIAG LSPYERRLID LIRNSGEKRA

      51  RKVAKKRLGS FIRAKAKVEE MNNIIAASRR H*

Protein Sequence for WashU_Scas_Contig720.61:

WashU_Scas_Contig720.61  Length: 82  Mon Nov  7 16:19:33 2016  Type: P  Check: 465  ..

       1  MTPAPKISYK KGVSSNRTKF VRSLVKEIAG LAPYERRLID LVRNSGEKRA

      51  RKVAKKRLGS FKRAKAKVEE MNNVIAASRR H*

Protein Sequence for WashU_Skud_Contig1752.3:

WashU_Skud_Contig1752.3  Length: 82  Mon Nov  7 16:19:33 2016  Type: P  Check: 320  ..

       1  MTPAPKISYK KGAASNRTKF VRSLVREIAG LSPYERRLID LIRNSGEKRA

      51  RKVAKKRLGS FIRAKAKVEE MNNIIVASRR H*