Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YMR186W and Homologs


Choose two or more sequences for alignment:
Best Hits & Orthologs

Pick a sequence type:

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_HSC82/YMR186W   1   -MAGETFEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDKIRYQA   49
MIT_Smik_c448_17101   1   -MAGETFEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDKIRYQA   49
MIT_Spar_c161_16590   1   -MAGETFEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDKIRYQA   49
MIT_Suva_c936_18981   1   -MAGETFEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDKIRYKA   49
WashU_Sbay_Contig637.5   1   -MAGETFEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDKIRYKA   49
WashU_Scas_Contig720.29   1   -MSSETFEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDKIRYQA   49
WashU_Sklu_Contig2237.3   1   MSNQETYEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDKVRYQA   50
WashU_Skud_Contig1731.4   1   -MAGETFEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDKIRYQA   49
Symbols






**:**************************************:**:*



SGD_Scer_HSC82/YMR186W   50   LSDPKQLETEPDLFIRITPKPEEKVLEIRDSGIGMTKAELINNLGTIAKS   99
MIT_Smik_c448_17101   50   LSDPKQLETEPDLFIRITPRPEEKVLEIRDSGIGMTKAELINNLGTIAKS   99
MIT_Spar_c161_16590   50   LSDPKQLETEPDLFIRITPKPEEKVLEIRDSGIGMTKAELINNLGTIAKS   99
MIT_Suva_c936_18981   50   LSDPKELDSEPELFIRITPRPEEKVLEIRDSGIGMTKAELINNLGTIAKS   99
WashU_Sbay_Contig637.5   50   LSDPKQLETEPELFIRITPRPEEKVLEIRDSGIGMTKAELINNLGTIAKS   99
WashU_Scas_Contig720.29   50   LSDPKQLETEPELFIRLTPKPEQKVLEIRDSGIGMTKAELINNLGTIAKS   99
WashU_Sklu_Contig2237.3   51   LSDPKQLETEPELFIRITPRPEEKVLEIRDSGIGMTKAELINNLGTIAKS   100
WashU_Skud_Contig1731.4   50   LSDPKELETEPDLFIRLTPRPEEKVLEIRDSGIGMTKAELINNLGTIAKS   99
Symbols






*****:*::**:****:**:**:***************************



SGD_Scer_HSC82/YMR186W   100   GTKAFMEALSAGADVSMIGQFGVGFYSLFLVADRVQVISKNNEDEQYIWE   149
MIT_Smik_c448_17101   100   GTKAFMEALSAGADVSMIGQFGVGFYSLFLVADRVQVISKNNDDEQYIWE   149
MIT_Spar_c161_16590   100   GTKAFMEALSAGADVSMIGQFGVGFYSLFLVADRVQVISKNNDDEQYIWE   149
MIT_Suva_c936_18981   100   GTKAFMEALSAGADVSMIGQFGVGFYSLFLVADRVQVISKNNDDEQYIWE   149
WashU_Sbay_Contig637.5   100   GTKAFMEALSAGADVSMIGQFGVGFYSLFLVADRVQVISKNNDDEQYIWE   149
WashU_Scas_Contig720.29   100   GTKAFMEALSAGADVSMIGQFGVGFYSLFLVADRVQVISKHNDDEQYIWE   149
WashU_Sklu_Contig2237.3   101   GTKAFMEALSAGADVSMIGQFGVGFYSLFLVADKVQVISKHNDDEQYIWE   150
WashU_Skud_Contig1731.4   100   GTKAFMEALSAGADVSMIGQFGVGFYSLFLVADRVQVISKNNDDEQYIWE   149
Symbols






*********************************:******:*:*******



SGD_Scer_HSC82/YMR186W   150   SNAGGSFTVTLDEVNERIGRGTVLRLFLKDDQLEYLEEKRIKEVIKRHSE   199
MIT_Smik_c448_17101   150   SNAGGSFTVTLDEVNERIGRGTVLRLFLKDDQLEYLEEKRIKEVIKRHSE   199
MIT_Spar_c161_16590   150   SNAGGSFTVTLDEVNERIGRGTVLRLFLKDDQLEYLEEKRIKEVIKRHSE   199
MIT_Suva_c936_18981   150   SNAGGSFSVTLDEVNESIGRGTVLRLFLKDDQLEYLEEKKIKEVIKRHSE   199
WashU_Sbay_Contig637.5   150   SNAGGSFTVTLDEVNEKIGRGTVLRLFMKDDQLEYLEEKKIKEVIKRHSE   199
WashU_Scas_Contig720.29   150   SNAGGSFTVRLDEENEKIGRGSILRLFLKDDQLEYLEEKRIKEVVKRHSE   199
WashU_Sklu_Contig2237.3   151   SNAGGSFTVTLDEHNERIGRGTVLRLFLKEDQLEYLEEKRIKEVVKRHSE   200
WashU_Skud_Contig1731.4   150   SNAGGSFTVTLDEVNERIGRGTVLRLFLKDDQLEYLEEKKIKEVIKRHSE   199
Symbols






*******:* *** ** ****::****:*:*********:****:*****



SGD_Scer_HSC82/YMR186W   200   FVAYPIQLLVTKEVEKEVPIPEEEKKD------EEKKDEDDKKPKLEEVD   243
MIT_Smik_c448_17101   200   FVAYPIQLLVTKEVEKEVPIPEEEKKD-EEKKDEEKKDEDDKKPKLEEVD   248
MIT_Spar_c161_16590   200   FVAYPIQLLVTKEVEKEVPIPEEEKKD-EEKKDEEKKDEDDKKPKLEEVD   248
MIT_Suva_c936_18981   200   FVAYPIQLLVTKEVEKEVPIP---EEE-EEKKDEEKKDEDDKKPKLEEVD   245
WashU_Sbay_Contig637.5   200   FVAYPIQLLVTKEVEKEVPVP---EEEGEEKKDEEKKDEDDKKPKLEEVD   246
WashU_Scas_Contig720.29   200   FVAYPIQLVVTKEVEKEVPVAEEEKKD------EEAKEVDDKKPKLEEVK   243
WashU_Sklu_Contig2237.3   201   FVAYPIQLLVTKEVEKEVPVAEEEKKD-------EKDEEDDKKPKLEEVD   243
WashU_Skud_Contig1731.4   200   FVAYPIQLLVTKEVEKEVPIPEEEKKDDEEKEDEEKKDEDDKKPKLEEVD   249
Symbols






********:**********:. ::: * .: **********.



SGD_Scer_HSC82/YMR186W   244   EEEEEKKPKTKKVKEEVQELEELNKTKPLWTRNPSDITQEEYNAFYKSIS   293
MIT_Smik_c448_17101   249   EEEEEKKPKTKKVKEEVQELEELNKTKPLWTRNPSEITQEEYNAFYKSIS   298
MIT_Spar_c161_16590   249   EEEEEKKPKTKKVKEEVQELEELNKTKPLWTRNPSDITQEEYNAFYKSIS   298
MIT_Suva_c936_18981   246   EEEEEKKPKTKKVKEEVQELEELNKTKPLWTRNPSEITEEEYNAFYKSIS   295
WashU_Sbay_Contig637.5   247   EEEE-KKPKTKKVKEEVQELEELNKTKPLWTRNPSEITQEEYNAFYKSIS   295
WashU_Scas_Contig720.29   244   EGEEEEKPKTTKVKEEVTELEELNKTKPLWTRNPSEITQEEYNAFYKSIS   293
WashU_Sklu_Contig2237.3   244   EDGEEKKPETEKVKETVKELEELNKTKPLWTRNPSEVTQDEYNAFYKSIS   293
WashU_Skud_Contig1731.4   250   EEEEEKKPKTKKVKEEVQELEELNKTKPLWTRNPSDITQEEYNAFYKSIS   299
Symbols






* * :**:* **** * *****************::*::**********



SGD_Scer_HSC82/YMR186W   294   NDWEDPLYVKHFSVEGQLEFRAILFIPKRAPFDLFESKKKKNNIKLYVRR   343
MIT_Smik_c448_17101   299   NDWEDPLYVKHFSVEGQLEFRAILFIPKRAPFDLFESKKKKNNIKLYVRR   348
MIT_Spar_c161_16590   299   NDWEDPLYVKHFSVEGQLEFRAILFIPKRAPFDLFESKKKKNNIKLYVRR   348
MIT_Suva_c936_18981   296   NDWEDPLYVKHFSVEGQLEFRAILYIPKRAPFDLFESKKKKNNIKLYVRR   345
WashU_Sbay_Contig637.5   296   NDWEDPLYVKHFSVEGQLEFRAILYIPKRAPFDLFESKKKKNNIKLYVRR   345
WashU_Scas_Contig720.29   294   NDWEDPLYVKHFSVEGQLEFRAILFIPKRAPFDLFESKKKKSNIKLYVRR   343
WashU_Sklu_Contig2237.3   294   NDWEDPLAVKHFSVEGQLEFRAILFVPKRAPFDLFESKKKKNNIKLYVRR   343
WashU_Skud_Contig1731.4   300   NDWEDPLYVKHFSVEGQLEFRAILFIPKRAPFDLFESKKKKNNIKLYVRR   349
Symbols






******* ****************::***************.********



SGD_Scer_HSC82/YMR186W   344   VFITDEAEDLIPEWLSFVKGVVDSEDLPLNLSREMLQQNKIMKVIRKNIV   393
MIT_Smik_c448_17101   349   VFITDEAEDLIPEWLSFVKGVVDSEDLPLNLSREMLQQNKIMKVIRKNIV   398
MIT_Spar_c161_16590   349   VFITDEAEDLIPEWLSFVKGVVDSEDLPLNLSREMLQQNKIMKVIRKNIV   398
MIT_Suva_c936_18981   346   VFITDEAEDLIPEWMSFVKGVVDSEDLPLNLSREMLQQNKIMKVIRKNIV   395
WashU_Sbay_Contig637.5   346   VFITDEAEDLVPEWMSFVKGVVDSEDLPLNLSREMLQQNKIMKVIRKNIV   395
WashU_Scas_Contig720.29   344   VFITDEAEDLIPDWLSFVKGVVDSEDLPLNLSREMLQQNKIMKVIRKNII   393
WashU_Sklu_Contig2237.3   344   VFITDEAEELIPEWLSFVKGVVDSEDLPLNLSREMLQQNKIMKVIKKNIV   393
WashU_Skud_Contig1731.4   350   VFITDEAEDLIPEWLSFVKGVVDSEDLPLNLSREMLQQNKIMKVIRKNIV   399
Symbols






********:*:*:*:******************************:***:



SGD_Scer_HSC82/YMR186W   394   KKLIEAFNEIAEDSEQFDKFYSAFAKNIKLGVHEDTQNRAALAKLLRYNS   443
MIT_Smik_c448_17101   399   KKLIESFNEIAEDSEQFDKFYSAFAKNIKLGVHEDTQNRVALAKLLRYNS   448
MIT_Spar_c161_16590   399   KKLIESFNEIAEDSEQFDKFYSAFAKNIKLGVHEDTQNRVALAKLLRYNS   448
MIT_Suva_c936_18981   396   KKLIESFNEIAEDSEQFEKFYSAFAKNIKLGVHEDTQNRAALAKLLRYNS   445
WashU_Sbay_Contig637.5   396   KKMIESFNEIAEDSEQFEKFYSAFAKNIKLGVHEDTQNRAALAKLLRYNS   445
WashU_Scas_Contig720.29   394   KKLIESFNEIAEDSEQFEKFYSAFSKNIKLGVHEDSQNRAALAKLLRYNS   443
WashU_Sklu_Contig2237.3   394   KKLIETFNEIAEDSEQFEKFYSAFAKNIKLGIHEDTQNRTALAKLLRYNS   443
WashU_Skud_Contig1731.4   400   KKLIESFNEIAEDSEQFDKFYSAFAKNIKLGVHEDTQNRVALARLLRYNS   449
Symbols






**:**:***********:******:******:***:***.***:******



SGD_Scer_HSC82/YMR186W   444   TKSVDELTSLTDYVTRMPEHQKNIYYITGESLKAVEKSPFLDALKAKNFE   493
MIT_Smik_c448_17101   449   TKSVDELTSLTDYVTRMPEHQKNIYYITGESLKAVEKSPFLDALKAKNFE   498
MIT_Spar_c161_16590   449   TKSVDELTSLSDYVTRMPEHQKNIYYITGESLKAVEKSPFLDALKAKNFE   498
MIT_Suva_c936_18981   446   TKSVDELTSLTDYITRMPEHQKNVYYITGESLKAVEKSPFLDALKAKNFE   495
WashU_Sbay_Contig637.5   446   TKSVDELTSLTDYITRMPEHQKNIYYITGESLKAVEKSPFLDALKAKNFE   495
WashU_Scas_Contig720.29   444   TKSTDEMTSLTDYVTRMPEHQKNIYYITGESIKAIEKSPFLDALKAKDFE   493
WashU_Sklu_Contig2237.3   444   TKAIDEMTSLADYVTRMPEHQKNIYFITGESMKAVEKSPFLDALKAKNFE   493
WashU_Skud_Contig1731.4   450   TKSVDELTSLADYVTRMPEHQKNIYYITGESLKAVEKSPFLDALKAKNFE   499
Symbols






**: **:***:**:*********:*:*****:**:************:**



SGD_Scer_HSC82/YMR186W   494   VLFLTDPIDEYAFTQLKEFEGKTLVDITKDFELEETDEEKAEREKEIKEY   543
MIT_Smik_c448_17101   499   VLFLTDPIDEYAFTQLKEFEGKTLVDITKDFELEETDEEKAEREKEIKEF   548
MIT_Spar_c161_16590   499   VLFLTDPIDEYAFTQLKEFEGKTLVDITKDFELEETDEEKAEREKEIKEY   548
MIT_Suva_c936_18981   496   VLFLTDPIDEYAFTQLKEFEGKTLVDITKDFELEETDEEKAEREKEVKEY   545
WashU_Sbay_Contig637.5   496   VLFLTDPIDEYAFTQLKEFEGKTLVDITKDFELEETDEEKAEREKEVKEF   545
WashU_Scas_Contig720.29   494   VLFLADPIDEYAFTQMKEFDGKTLVDITKDFELEETEEEKAEREKEIKEF   543
WashU_Sklu_Contig2237.3   494   VLFLVDPIDEYAFTQLKEFEGKQLVDITKDFELEETEEEKAEREKEIQEF   543
WashU_Skud_Contig1731.4   500   VLFLTDPIDEYAFTQLKEFEGKTLVDITKDFELEETDEEKAEREKEIKEY   549
Symbols






****.**********:***:** *************:*********::*:



SGD_Scer_HSC82/YMR186W   544   EPLTKALKDILGDQVEKVVVSYKLLDAPAAIRTGQFGWSANMERIMKAQA   593
MIT_Smik_c448_17101   549   EPLTKALKDILGDQVEKVVVSYKLLDAPAAIRTGQFGWSANMERIMKAQA   598
MIT_Spar_c161_16590   549   EPLTKALKDILGDQVEKVVVSYKLLDAPAAIRTGQFGWSANMERIMKAQA   598
MIT_Suva_c936_18981   546   EPLTKALKDILGEQVEKVVVSYKLVDAPAAIRTGQFGWSANMERIMKAQA   595
WashU_Sbay_Contig637.5   546   EPLTKALKDILGDQVEKVVVSYKLVDAPAAIRTGQFGWSANMERIMKAQA   595
WashU_Scas_Contig720.29   544   EPLTTALKEILGEKVEKVVVSHKLLDAPAAIRTGQFGWSANMERIMKAQA   593
WashU_Sklu_Contig2237.3   544   EPLTKALKEVLGEQVEKVVVSHKLLDAPAAIRTGQFGWSANMERIMKAQA   593
WashU_Skud_Contig1731.4   550   EPLTKALKDILGDQVEKVVVSYKLLDAPAAIRTGQFGWSANMERIMKAQA   599
Symbols






****.***::**::*******:**:*************************



SGD_Scer_HSC82/YMR186W   594   LRDSSMSSYMSSKKTFEISPKSPIIKELKKRVDEGGAQDKTVKDLTNLLF   643
MIT_Smik_c448_17101   599   LRDSSMSSYMSSKKTFEISPKSPIIKELKKRVDEGGAQDKTVKDLTNLLF   648
MIT_Spar_c161_16590   599   LRDSSMSSYMSSKKTFEISPKSPIIKELKKRVDEGGAQDKTVKDLTNLLF   648
MIT_Suva_c936_18981   596   LRDSSMSSYMSSKKTFEISPKSPIIKELKKRVDEGGAQDKTVKDLTNLLF   645
WashU_Sbay_Contig637.5   596   LRDSSMSSYMSSKKTFEISPKSPIIKELKKRVDEGGAQDKTVKDLTNLLF   645
WashU_Scas_Contig720.29   594   LRDSTMSSYMSSKKTFEISPKSPIIKELKKRVDEGGAQDKTVKDLTNLLY   643
WashU_Sklu_Contig2237.3   594   LRDSTMSSYMSSKKIFEISPKSPIIRELKKKVEEGGAQDRTVKDLTNLLY   643
WashU_Skud_Contig1731.4   600   LRDSSMSSYMSSKKTFEISAKSPIIKELKKRVDEGGAQDKTVKDLTNLLF   649
Symbols






****:********* ****.*****:****:*:******:*********:



SGD_Scer_HSC82/YMR186W   644   ETALLTSGFSLEEPTSFASRINRLISLGLNIDEDEE---TETAPEASTEA   690
MIT_Smik_c448_17101   649   ETALLTSGFSLEEPTSFASRINRLISLGLNIDDEEE---VEAAPEASTEA   695
MIT_Spar_c161_16590   649   ETALLTSGFSLEEPTSFASRINRLISLGLNIDEEEE---TEAAPEASTEA   695
MIT_Suva_c936_18981   646   ETALLTSGFSLEEPTSFASRINRLISLGLNIDEEEEE--TEAATDAATDA   693
WashU_Sbay_Contig637.5   646   ETALLTSGFSLEEPTSFASRINRLISLGLNIDEEEE---TEAATDAATDA   692
WashU_Scas_Contig720.29   644   ETALLTSGFTLEEPNSFASRINRLISLGLNIDEDEEEEEEKTEPEAAAEA   693
WashU_Sklu_Contig2237.3   644   ETALLTSGFTLEEPASFATRINRLISLGLNIDEDEES--EETAPEAATEA   691
WashU_Skud_Contig1731.4   650   ETALLTSGFSLEEPTSFASRINRLISLGLNIDEEEE---TEAAPEASTEA   696
Symbols






*********:**** ***:*************::** :: .:*:::*



SGD_Scer_HSC82/YMR186W   691   PVEEVPADTEMEEVD   705
MIT_Smik_c448_17101   696   PVEEVPADTEMEEVD   710
MIT_Spar_c161_16590   696   PVEEVPADTEMEEVD   710
MIT_Suva_c936_18981   694   PVEEVPADTEMEEVD   708
WashU_Sbay_Contig637.5   693   PVEEVPADTEMEEVD   707
WashU_Scas_Contig720.29   694   EVEAVPADTEMEEVD   708
WashU_Sklu_Contig2237.3   692   PVEEVSAETEMEEVD   706
WashU_Skud_Contig1731.4   697   PVEEIPADTEMEEVD   711
Symbols






** :.*:*******



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_HSC82/YMR186W:

SGD_Scer_HSC82/YMR186W  Length: 706  Mon Nov  7 16:19:21 2016  Type: P  Check: 1304  ..

       1  MAGETFEFQA EITQLMSLII NTVYSNKEIF LRELISNASD ALDKIRYQAL

      51  SDPKQLETEP DLFIRITPKP EEKVLEIRDS GIGMTKAELI NNLGTIAKSG

     101  TKAFMEALSA GADVSMIGQF GVGFYSLFLV ADRVQVISKN NEDEQYIWES

     151  NAGGSFTVTL DEVNERIGRG TVLRLFLKDD QLEYLEEKRI KEVIKRHSEF

     201  VAYPIQLLVT KEVEKEVPIP EEEKKDEEKK DEDDKKPKLE EVDEEEEEKK

     251  PKTKKVKEEV QELEELNKTK PLWTRNPSDI TQEEYNAFYK SISNDWEDPL

     301  YVKHFSVEGQ LEFRAILFIP KRAPFDLFES KKKKNNIKLY VRRVFITDEA

     351  EDLIPEWLSF VKGVVDSEDL PLNLSREMLQ QNKIMKVIRK NIVKKLIEAF

     401  NEIAEDSEQF DKFYSAFAKN IKLGVHEDTQ NRAALAKLLR YNSTKSVDEL

     451  TSLTDYVTRM PEHQKNIYYI TGESLKAVEK SPFLDALKAK NFEVLFLTDP

     501  IDEYAFTQLK EFEGKTLVDI TKDFELEETD EEKAEREKEI KEYEPLTKAL

     551  KDILGDQVEK VVVSYKLLDA PAAIRTGQFG WSANMERIMK AQALRDSSMS

     601  SYMSSKKTFE ISPKSPIIKE LKKRVDEGGA QDKTVKDLTN LLFETALLTS

     651  GFSLEEPTSF ASRINRLISL GLNIDEDEET ETAPEASTEA PVEEVPADTE

     701  MEEVD*

Protein Sequence for MIT_Smik_c448_17101:

MIT_Smik_c448_17101  Length: 711  Mon Nov  7 16:19:21 2016  Type: P  Check: 9933  ..

       1  MAGETFEFQA EITQLMSLII NTVYSNKEIF LRELISNASD ALDKIRYQAL

      51  SDPKQLETEP DLFIRITPRP EEKVLEIRDS GIGMTKAELI NNLGTIAKSG

     101  TKAFMEALSA GADVSMIGQF GVGFYSLFLV ADRVQVISKN NDDEQYIWES

     151  NAGGSFTVTL DEVNERIGRG TVLRLFLKDD QLEYLEEKRI KEVIKRHSEF

     201  VAYPIQLLVT KEVEKEVPIP EEEKKDEEKK DEEKKDEDDK KPKLEEVDEE

     251  EEEKKPKTKK VKEEVQELEE LNKTKPLWTR NPSEITQEEY NAFYKSISND

     301  WEDPLYVKHF SVEGQLEFRA ILFIPKRAPF DLFESKKKKN NIKLYVRRVF

     351  ITDEAEDLIP EWLSFVKGVV DSEDLPLNLS REMLQQNKIM KVIRKNIVKK

     401  LIESFNEIAE DSEQFDKFYS AFAKNIKLGV HEDTQNRVAL AKLLRYNSTK

     451  SVDELTSLTD YVTRMPEHQK NIYYITGESL KAVEKSPFLD ALKAKNFEVL

     501  FLTDPIDEYA FTQLKEFEGK TLVDITKDFE LEETDEEKAE REKEIKEFEP

     551  LTKALKDILG DQVEKVVVSY KLLDAPAAIR TGQFGWSANM ERIMKAQALR

     601  DSSMSSYMSS KKTFEISPKS PIIKELKKRV DEGGAQDKTV KDLTNLLFET

     651  ALLTSGFSLE EPTSFASRIN RLISLGLNID DEEEVEAAPE ASTEAPVEEV

     701  PADTEMEEVD *

Protein Sequence for MIT_Spar_c161_16590:

MIT_Spar_c161_16590  Length: 711  Mon Nov  7 16:19:21 2016  Type: P  Check: 507  ..

       1  MAGETFEFQA EITQLMSLII NTVYSNKEIF LRELISNASD ALDKIRYQAL

      51  SDPKQLETEP DLFIRITPKP EEKVLEIRDS GIGMTKAELI NNLGTIAKSG

     101  TKAFMEALSA GADVSMIGQF GVGFYSLFLV ADRVQVISKN NDDEQYIWES

     151  NAGGSFTVTL DEVNERIGRG TVLRLFLKDD QLEYLEEKRI KEVIKRHSEF

     201  VAYPIQLLVT KEVEKEVPIP EEEKKDEEKK DEEKKDEDDK KPKLEEVDEE

     251  EEEKKPKTKK VKEEVQELEE LNKTKPLWTR NPSDITQEEY NAFYKSISND

     301  WEDPLYVKHF SVEGQLEFRA ILFIPKRAPF DLFESKKKKN NIKLYVRRVF

     351  ITDEAEDLIP EWLSFVKGVV DSEDLPLNLS REMLQQNKIM KVIRKNIVKK

     401  LIESFNEIAE DSEQFDKFYS AFAKNIKLGV HEDTQNRVAL AKLLRYNSTK

     451  SVDELTSLSD YVTRMPEHQK NIYYITGESL KAVEKSPFLD ALKAKNFEVL

     501  FLTDPIDEYA FTQLKEFEGK TLVDITKDFE LEETDEEKAE REKEIKEYEP

     551  LTKALKDILG DQVEKVVVSY KLLDAPAAIR TGQFGWSANM ERIMKAQALR

     601  DSSMSSYMSS KKTFEISPKS PIIKELKKRV DEGGAQDKTV KDLTNLLFET

     651  ALLTSGFSLE EPTSFASRIN RLISLGLNID EEEETEAAPE ASTEAPVEEV

     701  PADTEMEEVD *

Protein Sequence for MIT_Suva_c936_18981:

MIT_Suva_c936_18981  Length: 709  Mon Nov  7 16:19:21 2016  Type: P  Check: 8075  ..

       1  MAGETFEFQA EITQLMSLII NTVYSNKEIF LRELISNASD ALDKIRYKAL

      51  SDPKELDSEP ELFIRITPRP EEKVLEIRDS GIGMTKAELI NNLGTIAKSG

     101  TKAFMEALSA GADVSMIGQF GVGFYSLFLV ADRVQVISKN NDDEQYIWES

     151  NAGGSFSVTL DEVNESIGRG TVLRLFLKDD QLEYLEEKKI KEVIKRHSEF

     201  VAYPIQLLVT KEVEKEVPIP EEEEEKKDEE KKDEDDKKPK LEEVDEEEEE

     251  KKPKTKKVKE EVQELEELNK TKPLWTRNPS EITEEEYNAF YKSISNDWED

     301  PLYVKHFSVE GQLEFRAILY IPKRAPFDLF ESKKKKNNIK LYVRRVFITD

     351  EAEDLIPEWM SFVKGVVDSE DLPLNLSREM LQQNKIMKVI RKNIVKKLIE

     401  SFNEIAEDSE QFEKFYSAFA KNIKLGVHED TQNRAALAKL LRYNSTKSVD

     451  ELTSLTDYIT RMPEHQKNVY YITGESLKAV EKSPFLDALK AKNFEVLFLT

     501  DPIDEYAFTQ LKEFEGKTLV DITKDFELEE TDEEKAEREK EVKEYEPLTK

     551  ALKDILGEQV EKVVVSYKLV DAPAAIRTGQ FGWSANMERI MKAQALRDSS

     601  MSSYMSSKKT FEISPKSPII KELKKRVDEG GAQDKTVKDL TNLLFETALL

     651  TSGFSLEEPT SFASRINRLI SLGLNIDEEE EETEAATDAA TDAPVEEVPA

     701  DTEMEEVD*

Protein Sequence for WashU_Sbay_Contig637.5:

WashU_Sbay_Contig637.5  Length: 708  Mon Nov  7 16:19:21 2016  Type: P  Check: 7334  ..

       1  MAGETFEFQA EITQLMSLII NTVYSNKEIF LRELISNASD ALDKIRYKAL

      51  SDPKQLETEP ELFIRITPRP EEKVLEIRDS GIGMTKAELI NNLGTIAKSG

     101  TKAFMEALSA GADVSMIGQF GVGFYSLFLV ADRVQVISKN NDDEQYIWES

     151  NAGGSFTVTL DEVNEKIGRG TVLRLFMKDD QLEYLEEKKI KEVIKRHSEF

     201  VAYPIQLLVT KEVEKEVPVP EEEGEEKKDE EKKDEDDKKP KLEEVDEEEE

     251  KKPKTKKVKE EVQELEELNK TKPLWTRNPS EITQEEYNAF YKSISNDWED

     301  PLYVKHFSVE GQLEFRAILY IPKRAPFDLF ESKKKKNNIK LYVRRVFITD

     351  EAEDLVPEWM SFVKGVVDSE DLPLNLSREM LQQNKIMKVI RKNIVKKMIE

     401  SFNEIAEDSE QFEKFYSAFA KNIKLGVHED TQNRAALAKL LRYNSTKSVD

     451  ELTSLTDYIT RMPEHQKNIY YITGESLKAV EKSPFLDALK AKNFEVLFLT

     501  DPIDEYAFTQ LKEFEGKTLV DITKDFELEE TDEEKAEREK EVKEFEPLTK

     551  ALKDILGDQV EKVVVSYKLV DAPAAIRTGQ FGWSANMERI MKAQALRDSS

     601  MSSYMSSKKT FEISPKSPII KELKKRVDEG GAQDKTVKDL TNLLFETALL

     651  TSGFSLEEPT SFASRINRLI SLGLNIDEEE ETEAATDAAT DAPVEEVPAD

     701  TEMEEVD*

Protein Sequence for WashU_Scas_Contig720.29:

WashU_Scas_Contig720.29  Length: 709  Mon Nov  7 16:19:21 2016  Type: P  Check: 2497  ..

       1  MSSETFEFQA EITQLMSLII NTVYSNKEIF LRELISNASD ALDKIRYQAL

      51  SDPKQLETEP ELFIRLTPKP EQKVLEIRDS GIGMTKAELI NNLGTIAKSG

     101  TKAFMEALSA GADVSMIGQF GVGFYSLFLV ADRVQVISKH NDDEQYIWES

     151  NAGGSFTVRL DEENEKIGRG SILRLFLKDD QLEYLEEKRI KEVVKRHSEF

     201  VAYPIQLVVT KEVEKEVPVA EEEKKDEEAK EVDDKKPKLE EVKEGEEEEK

     251  PKTTKVKEEV TELEELNKTK PLWTRNPSEI TQEEYNAFYK SISNDWEDPL

     301  YVKHFSVEGQ LEFRAILFIP KRAPFDLFES KKKKSNIKLY VRRVFITDEA

     351  EDLIPDWLSF VKGVVDSEDL PLNLSREMLQ QNKIMKVIRK NIIKKLIESF

     401  NEIAEDSEQF EKFYSAFSKN IKLGVHEDSQ NRAALAKLLR YNSTKSTDEM

     451  TSLTDYVTRM PEHQKNIYYI TGESIKAIEK SPFLDALKAK DFEVLFLADP

     501  IDEYAFTQMK EFDGKTLVDI TKDFELEETE EEKAEREKEI KEFEPLTTAL

     551  KEILGEKVEK VVVSHKLLDA PAAIRTGQFG WSANMERIMK AQALRDSTMS

     601  SYMSSKKTFE ISPKSPIIKE LKKRVDEGGA QDKTVKDLTN LLYETALLTS

     651  GFTLEEPNSF ASRINRLISL GLNIDEDEEE EEEKTEPEAA AEAEVEAVPA

     701  DTEMEEVD*

Protein Sequence for WashU_Sklu_Contig2237.3:

WashU_Sklu_Contig2237.3  Length: 707  Mon Nov  7 16:19:21 2016  Type: P  Check: 45  ..

       1  MSNQETYEFQ AEITQLMSLI INTVYSNKEI FLRELISNAS DALDKVRYQA

      51  LSDPKQLETE PELFIRITPR PEEKVLEIRD SGIGMTKAEL INNLGTIAKS

     101  GTKAFMEALS AGADVSMIGQ FGVGFYSLFL VADKVQVISK HNDDEQYIWE

     151  SNAGGSFTVT LDEHNERIGR GTVLRLFLKE DQLEYLEEKR IKEVVKRHSE

     201  FVAYPIQLLV TKEVEKEVPV AEEEKKDEKD EEDDKKPKLE EVDEDGEEKK

     251  PETEKVKETV KELEELNKTK PLWTRNPSEV TQDEYNAFYK SISNDWEDPL

     301  AVKHFSVEGQ LEFRAILFVP KRAPFDLFES KKKKNNIKLY VRRVFITDEA

     351  EELIPEWLSF VKGVVDSEDL PLNLSREMLQ QNKIMKVIKK NIVKKLIETF

     401  NEIAEDSEQF EKFYSAFAKN IKLGIHEDTQ NRTALAKLLR YNSTKAIDEM

     451  TSLADYVTRM PEHQKNIYFI TGESMKAVEK SPFLDALKAK NFEVLFLVDP

     501  IDEYAFTQLK EFEGKQLVDI TKDFELEETE EEKAEREKEI QEFEPLTKAL

     551  KEVLGEQVEK VVVSHKLLDA PAAIRTGQFG WSANMERIMK AQALRDSTMS

     601  SYMSSKKIFE ISPKSPIIRE LKKKVEEGGA QDRTVKDLTN LLYETALLTS

     651  GFTLEEPASF ATRINRLISL GLNIDEDEES EETAPEAATE APVEEVSAET

     701  EMEEVD*

Protein Sequence for WashU_Skud_Contig1731.4:

WashU_Skud_Contig1731.4  Length: 712  Mon Nov  7 16:19:21 2016  Type: P  Check: 300  ..

       1  MAGETFEFQA EITQLMSLII NTVYSNKEIF LRELISNASD ALDKIRYQAL

      51  SDPKELETEP DLFIRLTPRP EEKVLEIRDS GIGMTKAELI NNLGTIAKSG

     101  TKAFMEALSA GADVSMIGQF GVGFYSLFLV ADRVQVISKN NDDEQYIWES

     151  NAGGSFTVTL DEVNERIGRG TVLRLFLKDD QLEYLEEKKI KEVIKRHSEF

     201  VAYPIQLLVT KEVEKEVPIP EEEKKDDEEK EDEEKKDEDD KKPKLEEVDE

     251  EEEEKKPKTK KVKEEVQELE ELNKTKPLWT RNPSDITQEE YNAFYKSISN

     301  DWEDPLYVKH FSVEGQLEFR AILFIPKRAP FDLFESKKKK NNIKLYVRRV

     351  FITDEAEDLI PEWLSFVKGV VDSEDLPLNL SREMLQQNKI MKVIRKNIVK

     401  KLIESFNEIA EDSEQFDKFY SAFAKNIKLG VHEDTQNRVA LARLLRYNST

     451  KSVDELTSLA DYVTRMPEHQ KNIYYITGES LKAVEKSPFL DALKAKNFEV

     501  LFLTDPIDEY AFTQLKEFEG KTLVDITKDF ELEETDEEKA EREKEIKEYE

     551  PLTKALKDIL GDQVEKVVVS YKLLDAPAAI RTGQFGWSAN MERIMKAQAL

     601  RDSSMSSYMS SKKTFEISAK SPIIKELKKR VDEGGAQDKT VKDLTNLLFE

     651  TALLTSGFSL EEPTSFASRI NRLISLGLNI DEEEETEAAP EASTEAPVEE

     701  IPADTEMEEV D*