Fungal Sequence Alignment Help



This page displays a Saccharomyces cerevisiae protein in a ClustalW alignment with identified orthologs in other fungal species.

Currently, this page displays other fungal sequences from Cliften et al. and Kellis et al.

ClustalW Protein Alignment and Sequence for YMR058W and Homologs


Choose two or more sequences for alignment:
Pick a sequence type:
Best Hits & Orthologs"Other" Hits

Select or unselect multiple options for sequence
name by pressing the Control (PC) or Command
(Mac) key while clicking.

Align selected sequences
selected sequences (FASTA format)


Symbols:
* = identical
: = strong similarity
. = weak similarity

SGD_Scer_FET3/YMR058W   1   MTNALLSIAVLLFSMLSLAQAETHTFNWTTGWDYRNVDGLKSRPVITCNG   50
MIT_Smik_c581_16623   1   MTNALLSVVVLLLSTLSLAQAKTHTFNWTTGWDYRNVDGLKSRPVITCND   50
MIT_Spar_c174_17084   
   --------------------------------------------------   
WashU_Sbay_Contig588.21   1   MTNALLSVAVLLFSMLSLAQAKTHTFNWTAGWDYRNVDGLMSRPVMTCND   50
WashU_Smik_Contig2379.2   1   MTNALLSVVVLLLSTLSLAQAKTHTFNWTTGWDYRNVDGLKSRPVITCND   50
Symbols










SGD_Scer_FET3/YMR058W   51   QFPWPDITVNKGDRVQIYLTNGMNNTNTSMHFHGLFQNGTASMDGVPFLT   100
MIT_Smik_c581_16623   51   QFPWPDITVNKGDRVQVYLTNGMNNTNTSMHFHGLFQNGTASMDGVPFLT   100
MIT_Spar_c174_17084   1   ------------------------------------------MDGVPFLT   8
WashU_Sbay_Contig588.21   51   QFPWPDITIDKGDRVQLYLTNGMNNTNTSLHFHGIFQNGSNSMDGVPFLT   100
WashU_Smik_Contig2379.2   51   QFPWPDITVNKGDRVQVYLTNGMNNTNTSMHFHGLFQNGTASMDGVPFLT   100
Symbols






********



SGD_Scer_FET3/YMR058W   101   QCPIAPGSTMLYNFTVDYNVGTYWYHSHTDGQYEDGMKGLFIIKDD-SFP   149
MIT_Smik_c581_16623   101   QCPIAPGSTMLYNFTVDDNVGTYWYHSHTDGQYEDGMKGLFIIKDD-NFP   149
MIT_Spar_c174_17084   9   QCPIAPGSTMLYNFTVDYNVGTYWYHSHTDGQYEDGMKGLFIIKDDDSFP   58
WashU_Sbay_Contig588.21   101   QCPIAPGSTMLYNFTVDDNVGTYWYHSHTDGQYEDGMKGLFIINDRENFP   150
WashU_Smik_Contig2379.2   101   QCPIAPGSTMLYNFTVDDNVGTYWYHSHTDGQYEDGMKGLFIIKDD-NFP   149
Symbols






***************** *************************:* .**



SGD_Scer_FET3/YMR058W   150   YDYDEELSLSLSEWYHDLVTDLTKSFMSVYNPTGAEPIPQNLIVNNTMNL   199
MIT_Smik_c581_16623   150   YDYDEELSLSLSEWYHDLVTDLTKSFMSVYNPTGAEPIPQNLIVNNTMNL   199
MIT_Spar_c174_17084   59   YDYDEELSLSLSEWYHDLVTDLTKSFLSVYNPTGAEPIPQNLIVNNTMNL   108
WashU_Sbay_Contig588.21   151   YDYDEELSLSVSEWYHDLVTDLTKSFLSVYNPTGAEPIPQNLIINNTMNL   200
WashU_Smik_Contig2379.2   150   YDYDEELSLSLSEWYHDLVTDLTKSFMSVYNPTGAEPIPQNLIVNNTMNL   199
Symbols






**********:***************:****************:******



SGD_Scer_FET3/YMR058W   200   TWEVQPDTTYLLRIVNVGGFVSQYFWIEDHEMTVVEIDGITTEKNVTDML   249
MIT_Smik_c581_16623   200   TWEVQPDTTYLLRIVNVGGFVSQYFWIEDHEMTVVEIDGITTEKNVTDML   249
MIT_Spar_c174_17084   109   TWEVQPDTTYLLRIVNVGGFVSQYFWIEDHEMTVVEVDGITTEKNVTDML   158
WashU_Sbay_Contig588.21   201   TWEVQPDTTYLLRIVNVGGFVSQYFWIEDHNMTVVEIDGITTEKNVTDMI   250
WashU_Smik_Contig2379.2   200   TWEVQPDTTYLLRIVNVGGFVSQYFWIEDHEMTVVEIDGITTEKNVTDML   249
Symbols






******************************:*****:************:



SGD_Scer_FET3/YMR058W   250   YITVAQRYTVLVHTKNDTDKNFAIMQKFDDTMLDVIPSDLQLNATSYMVY   299
MIT_Smik_c581_16623   250   YITVAQRYTVLVHTKNETDKNFAIMQKFDETMLDVIPGDLQLNATSYMVY   299
MIT_Spar_c174_17084   159   YITVAQRYTVLVHTKNDTDKNFAIMQKFDDTMLDVIPSDLQLNATSYMVY   208
WashU_Sbay_Contig588.21   251   YITVAQRYTVLVHTKNDTDQNFAIMQKFDDTMLDVIPKDLQLNATSYMVY   300
WashU_Smik_Contig2379.2   250   YITVAQRYTVLVHTKNETDKNFAIMQKFDETMLDVIPGDLQLNATSYMVY   299
Symbols






****************:**:*********:******* ************



SGD_Scer_FET3/YMR058W   300   NKTAALPTQNYVDSIDNFLDDFYLQPYEKEAIYGEPDHVITVDVVMDNLK   349
MIT_Smik_c581_16623   300   NKSASLPTQNYVDSLDDFLDDFYLQPYEKQAIYGEPDHVITVDVVMDNLK   349
MIT_Spar_c174_17084   209   NKSAALPTQNYVDSIDDYLDDFYLQPYEKQAIYGEPDHVITVDVVMDNLK   258
WashU_Sbay_Contig588.21   301   NKSAPMPSQNYVDSLDNFLDDFYLQPYEKQAILGEPDHVITVDVVMDNLK   350
WashU_Smik_Contig2379.2   300   NKSASLPTQNYVDSLDDFLDDFYLQPYEKQAIYGEPDHVITVDVVMDNLK   349
Symbols






**:*.:*:******:*::***********:** *****************



SGD_Scer_FET3/YMR058W   350   NGVNYAFFNNITYTAPKVPTLMTVLSSGDQANNSEIYGSNTHTFILEKDE   399
MIT_Smik_c581_16623   350   NGVNYAFFNNITYTTPKVPTLMTVLSSGDQANNSEIYGTNTHTFILEKNE   399
MIT_Spar_c174_17084   259   NGVNYAFFNNITYTAPKVPTLMTVLSSGDQANNSEIYGSNTHTFILEKDE   308
WashU_Sbay_Contig588.21   351   NGVNYAFFNNITYTAPKVPTLMTVLSSGDQANNSEIYGTNTHTFILEKDE   400
WashU_Smik_Contig2379.2   350   NGVNYAFFNNITYTTPKVPTLMTVLSSGDQANNSEIYGTNTHTFILEKNE   399
Symbols






**************:***********************:*********:*



SGD_Scer_FET3/YMR058W   400   IVEIVLNNQDTGTHPFHLHGHAFQTIQRDRTYDDALGEVPHSFDPDNHPA   449
MIT_Smik_c581_16623   400   IVEIVLNNQDTGTHPFHLHGHAFQTIQRDRTYDDALGEVPHSYDPDNHPA   449
MIT_Spar_c174_17084   309   IVEIVLNNQDTGTHPFHLHGHAFQTIQRDRTYDDALGEVPHSFDPDNHPA   358
WashU_Sbay_Contig588.21   401   IVELVLNNQDTGTHPFHLHGHVFQTIQRDRTYDDALGEVPHSFDADDHPA   450
WashU_Smik_Contig2379.2   400   IVEIVLNNQDTGTHPFHLHGHAFQTIQRDRTYDDALGEVPHSYDPDNHPA   449
Symbols






***:*****************.********************:*.*:***



SGD_Scer_FET3/YMR058W   450   FPEYPMRRDTLYVRPQSNFVIRFKADNPGVWFFHCHIEWHLLQGLGLVLV   499
MIT_Smik_c581_16623   450   FPEYPMRRDTLYVRPQSNFVIRFKADNPGVWFFHCHIEWHLLQGLGLVLV   499
MIT_Spar_c174_17084   359   FPEYPMRRDTLYVRPQSNFVIRFKADNPGVWFFHCHIEWHLLQGLGLVLV   408
WashU_Sbay_Contig588.21   451   FPEYPMRRDTLYVRPQSNFVVRFKADNPGVWFFHCHIEWHLLQGLGLVLV   500
WashU_Smik_Contig2379.2   450   FPEYPMRRDTLYVRPQSNFVIRFKADNPGVWFFHCHIEWHLLQGLGLVLV   499
Symbols






********************:*****************************



SGD_Scer_FET3/YMR058W   500   EDPFGIQDAHSQQLSENHLEVCQSCSVATEGNAAANTLDLTDLTGENVQH   549
MIT_Smik_c581_16623   500   EDPFGIQDAHSQQISENHLEVCKSCSVATEGNAAANAVDFTDLTGENVQH   549
MIT_Spar_c174_17084   409   EDPFGIQDAHSQQISENHLEVCQSCSVATEGNAAANTLDLTDLTGENVQH   458
WashU_Sbay_Contig588.21   501   EDPFGIQETQSQQISANHLEVCKSCSVSTEGNAAANTEDLTDLTGQNVQH   550
WashU_Smik_Contig2379.2   500   EDPFGIQDAHSQQISENHLEVCKSCSVATEGNAAANAVDFTDLTGENVQH   549
Symbols






*******:::***:* ******:****:********: *:*****:****



SGD_Scer_FET3/YMR058W   550   AFIPTGFTKKGIIAMTFSCFAGILGIITIAIYGMMDMEDATEKVIRDLHV   599
MIT_Smik_c581_16623   550   GLIPSGFTKKGIIAMTFSCFAGILGIITIAIYGMMDMEDATEKVIRDLHV   599
MIT_Spar_c174_17084   459   AFIPTGFTKKGIIAMTFSCFAGILGIITIAIYGMMDMEDATEKVIRDLRV   508
WashU_Sbay_Contig588.21   551   GTIPSGFTKKGIIAMTFSCFAGILGIITIAIYGMMDMEDATEKVIRDLRV   600
WashU_Smik_Contig2379.2   550   GLIPSGFTKKGIIAMTFSCFAGILGIITIAIYGMMDMEDATEKVIRDLHV   599
Symbols






. **:*******************************************:*



SGD_Scer_FET3/YMR058W   600   DPEVLLNEVDENEERQVNEDRHSTEKHQFLTKAKRFF   636
MIT_Smik_c581_16623   600   DPEVLIKDIDENEERQVNDDRHSTEKHHFLTKAKSFF   636
MIT_Spar_c174_17084   509   DPEVLINEIDENEEHEVNEDRHSTEKHQFLTKAKRFF   545
WashU_Sbay_Contig588.21   601   DPEVLINEDE--EEREINEDRHSTEKHQFLTKVKGYF   635
WashU_Smik_Contig2379.2   600   DPEVLIKDIDENEERQVNDDRHSTEKHHFLTKAKSFF   636
Symbols






*****::: : **:::*:********:****.* :*



Symbols:
* = identical
: = strong similarity
. = weak similarity


- Download all sequences in alignment, in FASTA format.
GCG format sequences are displayed below.




Protein Sequence for SGD_Scer_FET3/YMR058W:

SGD_Scer_FET3/YMR058W  Length: 637  Mon Nov  7 16:16:31 2016  Type: P  Check: 1659  ..

       1  MTNALLSIAV LLFSMLSLAQ AETHTFNWTT GWDYRNVDGL KSRPVITCNG

      51  QFPWPDITVN KGDRVQIYLT NGMNNTNTSM HFHGLFQNGT ASMDGVPFLT

     101  QCPIAPGSTM LYNFTVDYNV GTYWYHSHTD GQYEDGMKGL FIIKDDSFPY

     151  DYDEELSLSL SEWYHDLVTD LTKSFMSVYN PTGAEPIPQN LIVNNTMNLT

     201  WEVQPDTTYL LRIVNVGGFV SQYFWIEDHE MTVVEIDGIT TEKNVTDMLY

     251  ITVAQRYTVL VHTKNDTDKN FAIMQKFDDT MLDVIPSDLQ LNATSYMVYN

     301  KTAALPTQNY VDSIDNFLDD FYLQPYEKEA IYGEPDHVIT VDVVMDNLKN

     351  GVNYAFFNNI TYTAPKVPTL MTVLSSGDQA NNSEIYGSNT HTFILEKDEI

     401  VEIVLNNQDT GTHPFHLHGH AFQTIQRDRT YDDALGEVPH SFDPDNHPAF

     451  PEYPMRRDTL YVRPQSNFVI RFKADNPGVW FFHCHIEWHL LQGLGLVLVE

     501  DPFGIQDAHS QQLSENHLEV CQSCSVATEG NAAANTLDLT DLTGENVQHA

     551  FIPTGFTKKG IIAMTFSCFA GILGIITIAI YGMMDMEDAT EKVIRDLHVD

     601  PEVLLNEVDE NEERQVNEDR HSTEKHQFLT KAKRFF*

Protein Sequence for MIT_Smik_c581_16623:

MIT_Smik_c581_16623  Length: 637  Mon Nov  7 16:16:31 2016  Type: P  Check: 3067  ..

       1  MTNALLSVVV LLLSTLSLAQ AKTHTFNWTT GWDYRNVDGL KSRPVITCND

      51  QFPWPDITVN KGDRVQVYLT NGMNNTNTSM HFHGLFQNGT ASMDGVPFLT

     101  QCPIAPGSTM LYNFTVDDNV GTYWYHSHTD GQYEDGMKGL FIIKDDNFPY

     151  DYDEELSLSL SEWYHDLVTD LTKSFMSVYN PTGAEPIPQN LIVNNTMNLT

     201  WEVQPDTTYL LRIVNVGGFV SQYFWIEDHE MTVVEIDGIT TEKNVTDMLY

     251  ITVAQRYTVL VHTKNETDKN FAIMQKFDET MLDVIPGDLQ LNATSYMVYN

     301  KSASLPTQNY VDSLDDFLDD FYLQPYEKQA IYGEPDHVIT VDVVMDNLKN

     351  GVNYAFFNNI TYTTPKVPTL MTVLSSGDQA NNSEIYGTNT HTFILEKNEI

     401  VEIVLNNQDT GTHPFHLHGH AFQTIQRDRT YDDALGEVPH SYDPDNHPAF

     451  PEYPMRRDTL YVRPQSNFVI RFKADNPGVW FFHCHIEWHL LQGLGLVLVE

     501  DPFGIQDAHS QQISENHLEV CKSCSVATEG NAAANAVDFT DLTGENVQHG

     551  LIPSGFTKKG IIAMTFSCFA GILGIITIAI YGMMDMEDAT EKVIRDLHVD

     601  PEVLIKDIDE NEERQVNDDR HSTEKHHFLT KAKSFF*

Protein Sequence for MIT_Spar_c174_17084:

MIT_Spar_c174_17084  Length: 546  Mon Nov  7 16:16:31 2016  Type: P  Check: 3731  ..

       1  MDGVPFLTQC PIAPGSTMLY NFTVDYNVGT YWYHSHTDGQ YEDGMKGLFI

      51  IKDDDSFPYD YDEELSLSLS EWYHDLVTDL TKSFLSVYNP TGAEPIPQNL

     101  IVNNTMNLTW EVQPDTTYLL RIVNVGGFVS QYFWIEDHEM TVVEVDGITT

     151  EKNVTDMLYI TVAQRYTVLV HTKNDTDKNF AIMQKFDDTM LDVIPSDLQL

     201  NATSYMVYNK SAALPTQNYV DSIDDYLDDF YLQPYEKQAI YGEPDHVITV

     251  DVVMDNLKNG VNYAFFNNIT YTAPKVPTLM TVLSSGDQAN NSEIYGSNTH

     301  TFILEKDEIV EIVLNNQDTG THPFHLHGHA FQTIQRDRTY DDALGEVPHS

     351  FDPDNHPAFP EYPMRRDTLY VRPQSNFVIR FKADNPGVWF FHCHIEWHLL

     401  QGLGLVLVED PFGIQDAHSQ QISENHLEVC QSCSVATEGN AAANTLDLTD

     451  LTGENVQHAF IPTGFTKKGI IAMTFSCFAG ILGIITIAIY GMMDMEDATE

     501  KVIRDLRVDP EVLINEIDEN EEHEVNEDRH STEKHQFLTK AKRFF*


Protein Sequence for WashU_Sbay_Contig588.21:

WashU_Sbay_Contig588.21  Length: 636  Mon Nov  7 16:16:31 2016  Type: P  Check: 4383  ..

       1  MTNALLSVAV LLFSMLSLAQ AKTHTFNWTA GWDYRNVDGL MSRPVMTCND

      51  QFPWPDITID KGDRVQLYLT NGMNNTNTSL HFHGIFQNGS NSMDGVPFLT

     101  QCPIAPGSTM LYNFTVDDNV GTYWYHSHTD GQYEDGMKGL FIINDRENFP

     151  YDYDEELSLS VSEWYHDLVT DLTKSFLSVY NPTGAEPIPQ NLIINNTMNL

     201  TWEVQPDTTY LLRIVNVGGF VSQYFWIEDH NMTVVEIDGI TTEKNVTDMI

     251  YITVAQRYTV LVHTKNDTDQ NFAIMQKFDD TMLDVIPKDL QLNATSYMVY

     301  NKSAPMPSQN YVDSLDNFLD DFYLQPYEKQ AILGEPDHVI TVDVVMDNLK

     351  NGVNYAFFNN ITYTAPKVPT LMTVLSSGDQ ANNSEIYGTN THTFILEKDE

     401  IVELVLNNQD TGTHPFHLHG HVFQTIQRDR TYDDALGEVP HSFDADDHPA

     451  FPEYPMRRDT LYVRPQSNFV VRFKADNPGV WFFHCHIEWH LLQGLGLVLV

     501  EDPFGIQETQ SQQISANHLE VCKSCSVSTE GNAAANTEDL TDLTGQNVQH

     551  GTIPSGFTKK GIIAMTFSCF AGILGIITIA IYGMMDMEDA TEKVIRDLRV

     601  DPEVLINEDE EEREINEDRH STEKHQFLTK VKGYF*

Protein Sequence for WashU_Smik_Contig2379.2:

WashU_Smik_Contig2379.2  Length: 637  Mon Nov  7 16:16:31 2016  Type: P  Check: 3067  ..

       1  MTNALLSVVV LLLSTLSLAQ AKTHTFNWTT GWDYRNVDGL KSRPVITCND

      51  QFPWPDITVN KGDRVQVYLT NGMNNTNTSM HFHGLFQNGT ASMDGVPFLT

     101  QCPIAPGSTM LYNFTVDDNV GTYWYHSHTD GQYEDGMKGL FIIKDDNFPY

     151  DYDEELSLSL SEWYHDLVTD LTKSFMSVYN PTGAEPIPQN LIVNNTMNLT

     201  WEVQPDTTYL LRIVNVGGFV SQYFWIEDHE MTVVEIDGIT TEKNVTDMLY

     251  ITVAQRYTVL VHTKNETDKN FAIMQKFDET MLDVIPGDLQ LNATSYMVYN

     301  KSASLPTQNY VDSLDDFLDD FYLQPYEKQA IYGEPDHVIT VDVVMDNLKN

     351  GVNYAFFNNI TYTTPKVPTL MTVLSSGDQA NNSEIYGTNT HTFILEKNEI

     401  VEIVLNNQDT GTHPFHLHGH AFQTIQRDRT YDDALGEVPH SYDPDNHPAF

     451  PEYPMRRDTL YVRPQSNFVI RFKADNPGVW FFHCHIEWHL LQGLGLVLVE

     501  DPFGIQDAHS QQISENHLEV CKSCSVATEG NAAANAVDFT DLTGENVQHG

     551  LIPSGFTKKG IIAMTFSCFA GILGIITIAI YGMMDMEDAT EKVIRDLHVD

     601  PEVLIKDIDE NEERQVNDDR HSTEKHHFLT KAKSFF*